Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL013C26325812571e-177
Sklu_2419.42992477881e-105
Kwal_56.224972802587501e-100
KLLA0C06028g3052357464e-99
YOL009C (MDM12)2712676713e-88
CAGL0E02365g2572566461e-84
Scas_644.112722396411e-83
Sklu_2275.54541151091e-05
YLL006W (MMM1)4261161019e-05
Kwal_33.151694421201011e-04
KLLA0F15796g4341351001e-04
Scas_638.24455100973e-04
AAL166C444123963e-04
CAGL0D05698g431106770.076
CAGL0L06666g39838690.83
ACL116W80494671.8
KLLA0A02893g63780626.1
CAGL0H09174g1031121627.8
Kwal_23.454871169618.3
ADR374C164030619.0
Kwal_23.30071170139619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL013C
         (258 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH] (335717..3...   488   e-177
Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement        308   e-105
Kwal_56.22497                                                         293   e-100
KLLA0C06028g complement(532044..532961) some similarities with s...   291   4e-99
YOL009C (MDM12) [4807] chr15 complement(309324..310139) Mitochon...   263   3e-88
CAGL0E02365g complement(226360..227133) similar to sp|Q92328 Sac...   253   1e-84
Scas_644.11                                                           251   1e-83
Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement         47   1e-05
YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential f...    44   9e-05
Kwal_33.15169                                                          44   1e-04
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    43   1e-04
Scas_638.24                                                            42   3e-04
AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315...    42   3e-04
CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces c...    34   0.076
CAGL0L06666g 752336..753532 highly similar to sp|P39676 Saccharo...    31   0.83 
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    30   1.8  
KLLA0A02893g 256320..258233 similar to ca|CA5008|IPF12577 Candid...    28   6.1  
CAGL0H09174g complement(898883..901978) some similarities with s...    28   7.8  
Kwal_23.4548                                                           28   8.3  
ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH] (1372612....    28   9.0  
Kwal_23.3007                                                           28   9.9  

>ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH]
           (335717..336511) [795 bp, 264 aa]
          Length = 263

 Score =  488 bits (1257), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/258 (93%), Positives = 242/258 (93%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID
Sbjct: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60

Query: 61  NPLDDFYEALRLEGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLT 120
           NPLDDFYEALRLEGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLT
Sbjct: 61  NPLDDFYEALRLEGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLT 120

Query: 121 ISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDSNGPAFLGSKAVERISLIRS 180
           ISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDSNGPAFLGSKAVERISLIRS
Sbjct: 121 ISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDSNGPAFLGSKAVERISLIRS 180

Query: 181 IKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDFNXXXXXXXXX 240
           IKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDFN         
Sbjct: 181 IKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDFNEDVSADVES 240

Query: 241 XXXXXXXLPHRDDAQDFS 258
                  LPHRDDAQDFS
Sbjct: 241 SSSAEESLPHRDDAQDFS 258

>Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement
          Length = 299

 Score =  308 bits (788), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 189/247 (76%), Gaps = 19/247 (7%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSF+INW+K+ ED+ INQ  + F N+HL S+ LPSYV+N+++T+F LG IPP ITLKQID
Sbjct: 19  MSFEINWDKLQEDTRINQSIKDFFNDHLRSISLPSYVNNVQVTNFSLGNIPPHITLKQID 78

Query: 61  NPLDDFYEAL------RLEGASI-------------GGRDDVQFLMEVDYKGDMLIELSA 101
           +PL++FY  +      ++E  S              G ++D+QFL+E+DYKGDMLIE+ A
Sbjct: 79  DPLEEFYGYISKESNEKIESTSDEIEHDPQCPIVMDGKQNDIQFLVEIDYKGDMLIEVGA 138

Query: 102 ELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDS 161
           ELVLNYPSP FM LPVKL+ISDI +HSLCL+AYL +QLFISFL  VSD  LDN ES LD+
Sbjct: 139 ELVLNYPSPTFMTLPVKLSISDIGMHSLCLIAYLSKQLFISFLCDVSDPILDNSESILDT 198

Query: 162 NGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAA 221
           NGP F+  +++ERISLIRSIKIQ+EIG     EG+ LRSVGKLEQFL ++F+N LRKEAA
Sbjct: 199 NGPNFMSKRSLERISLIRSIKIQSEIGEYKDGEGSTLRSVGKLEQFLVEIFRNALRKEAA 258

Query: 222 WPSWINL 228
           WPSWINL
Sbjct: 259 WPSWINL 265

>Kwal_56.22497
          Length = 280

 Score =  293 bits (750), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 189/258 (73%), Gaps = 27/258 (10%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSF+INW  + ED  +N   + FLN HL+S+ LPSYV ++++TDF LG  PP+ITL++I 
Sbjct: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60

Query: 61  NPLDDFYE-------ALRLEGASI--------------GGRD------DVQFLMEVDYKG 93
           NPL++FYE       A  +E +S                G+D      D+QFL+E+DYKG
Sbjct: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHGENDDSGKDEKDSDSDLQFLVEIDYKG 120

Query: 94  DMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALD 153
           DMLI +SAEL LNYPSP+FM LPVKLTISD+ +H+LCLVAYL +QLFISFL  V+D  LD
Sbjct: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180

Query: 154 NVESPLDSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFK 213
             ES +D+   AFLG++++ERISLIRSIKI +EIG Q+ +EG++LRSVG+LEQFL +VF+
Sbjct: 181 AQESNIDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEVFR 240

Query: 214 NLLRKEAAWPSWINLDFN 231
            +L+ EAAWPSWINLDFN
Sbjct: 241 TILKTEAAWPSWINLDFN 258

>KLLA0C06028g complement(532044..532961) some similarities with
           sp|Q92328 Saccharomyces cerevisiae YOL009c MDM12
           involved in mitochondrial inheritance singleton,
           hypothetical start
          Length = 305

 Score =  291 bits (746), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 183/235 (77%), Gaps = 5/235 (2%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MS +I+W+ I  D ++NQ  + FLN  L+  +LPSYV+N+K+T+F LGT+PP + LKQ+D
Sbjct: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60

Query: 61  NPLDDFYEALRLEG-----ASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQL 115
           +PLD+FY  L  EG     A+     DVQ L+E+DYKGDM IELSA+LVLNYPSP FM L
Sbjct: 61  DPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQFMIL 120

Query: 116 PVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNVESPLDSNGPAFLGSKAVERI 175
           PVKL ISDI +H LCL+AYL++QLFISFL  VSD  L+N +  +D +GP F+G +A+ERI
Sbjct: 121 PVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLENDKLQVDPSGPNFMGKRALERI 180

Query: 176 SLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDF 230
           SLIR+IKI TE+G  D  EG++LRSVGKLE+FL D+F+NL+RKEAAWPSWI+LDF
Sbjct: 181 SLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLDF 235

>YOL009C (MDM12) [4807] chr15 complement(309324..310139)
           Mitochondrial inheritance protein which may function in
           a complex with Mdm10p at the mitochondrial surface [816
           bp, 271 aa]
          Length = 271

 Score =  263 bits (671), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 179/267 (67%), Gaps = 36/267 (13%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSFDINW+ +  D+ +N   R  LN +L++ QLPSYVSN+++ DF LG + P ITLK+I 
Sbjct: 1   MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEIT 60

Query: 61  NPLDDFYEALRLEGASI------------------------GGRDD------------VQ 84
           +PLD+FY+++R E                            G +DD            +Q
Sbjct: 61  DPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQ 120

Query: 85  FLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFL 144
           FL+EV+YKGD+L+ + A+LVLNYP   FM LPVKL+ISDI +HSLC+VA L +QLF+SFL
Sbjct: 121 FLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFL 180

Query: 145 GHVSDHALDNVESPLDSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKL 204
             VSD ALD+ ++ LD  GP    +K +ERIS++RS+KI+TEIG Q   +G++LRSVG+L
Sbjct: 181 CDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGEL 240

Query: 205 EQFLSDVFKNLLRKEAAWPSWINLDFN 231
           EQFL  +FK+ LRKE AWPSWINLDFN
Sbjct: 241 EQFLFTIFKDFLRKELAWPSWINLDFN 267

>CAGL0E02365g complement(226360..227133) similar to sp|Q92328
           Saccharomyces cerevisiae YOL009c MDM12, start by
           similarity
          Length = 257

 Score =  253 bits (646), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 171/256 (66%), Gaps = 25/256 (9%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSF+INW K++ DS +    R  LN + + L+LPSYV  I++ DF  G I P ITL++I 
Sbjct: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60

Query: 61  NPLDDFYEALRLE-------GASIGGRD------------------DVQFLMEVDYKGDM 95
           +PL DFY+A+  E        + + GRD                  D QFL+E +YKGDM
Sbjct: 61  SPLQDFYDAVNEEYEEDNETSSEMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120

Query: 96  LIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALDNV 155
            + L+AELVLNYP   FM LP+K++IS+I +HSLCLV+YL +Q+FIS L  VSD  LD+V
Sbjct: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMLCDVSDPVLDDV 180

Query: 156 ESPLDSNGPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNL 215
           +  LD NGP  L +K +ERIS+IRS+KI+TEIG +   +G+ LRSVG+LE+F+    K+ 
Sbjct: 181 DCVLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLKDF 240

Query: 216 LRKEAAWPSWINLDFN 231
           LRKE AWPSW+NLDFN
Sbjct: 241 LRKELAWPSWVNLDFN 256

>Scas_644.11
          Length = 272

 Score =  251 bits (641), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 170/239 (71%), Gaps = 8/239 (3%)

Query: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60
           MSF+INW++I  D++I++  +  L+ +L+++ LPS+V+N+K+TDF  G I P I LK+I 
Sbjct: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60

Query: 61  NPLDDFYEALRL------EGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQ 114
           +PL DFYE++        EG +I    D QFL+EV+YKGD+ + +S ELVLNYPS  F++
Sbjct: 61  DPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIK 120

Query: 115 LPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALD--NVESPLDSNGPAFLGSKAV 172
           LP+KL +++I  HSLCLVAYL +Q+F+S L  VSD  LD  N E  LD NG      K  
Sbjct: 121 LPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKKPF 180

Query: 173 ERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDFN 231
           ERIS+IRS+ I TEIG Q   EG+ L++VGKLEQFL + FK+LLRKE AWPSWINLD +
Sbjct: 181 ERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDLS 239

>Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement
          Length = 454

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 57/115 (49%), Gaps = 17/115 (14%)

Query: 29  ESLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDF--YEALRLEGASIGGRDDVQFL 86
           +S +LP Y+S+IK+T+  +G               DDF  +   R++ +    +  ++  
Sbjct: 252 KSTELPHYLSSIKVTELDIG---------------DDFPIFSNCRIQYSPNSNKKRLEAK 296

Query: 87  MEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFI 141
           +++D    + + +  +L++NYP P    LPV+LT+S +   +   V+    + F+
Sbjct: 297 IDIDLSDRLALGIETKLLMNYPKPFTAALPVQLTVSIVRFQACLTVSLTTDEEFV 351

>YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential for
           establishment and maintenance of mitochondrial shape and
           structure, involved in coupling mitochondria to the
           actin cytoskeleton, required for maintenance of
           mitochondrial genome [1281 bp, 426 aa]
          Length = 426

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 17/116 (14%)

Query: 29  ESLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDF--YEALRLEGASIGGRDDVQFL 86
           +S  LP Y+  IK+T+   G               DDF  +   R++ +   G   ++  
Sbjct: 233 KSPDLPEYLDTIKITELDTG---------------DDFPIFSNCRIQYSPNSGNKKLEAK 277

Query: 87  MEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFIS 142
           +++D    + + +  +L+LNYP P    LP+ L +S +   +   V+    + F S
Sbjct: 278 IDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFAS 333

>Kwal_33.15169
          Length = 442

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 61/120 (50%), Gaps = 15/120 (12%)

Query: 24  LNEHL--ESLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDFYEALRLEGASIGGRD 81
           LN+++  +S +LP Y+ +IK+T+  +G           D P+   +   R++ +    + 
Sbjct: 237 LNDYISRKSEELPQYLDSIKITELDIGE----------DFPI---FSNCRIQYSPNSNKQ 283

Query: 82  DVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFI 141
            ++  +++D    + + +  +L++NYP P    LPV+LT+S +   +   V+    + F+
Sbjct: 284 RLEAKIDIDLSDRLALGIETKLLINYPKPFTAALPVQLTVSVVRFQACLTVSLTAAEEFV 343

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 62/135 (45%), Gaps = 19/135 (14%)

Query: 24  LNEHLE--SLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDF--YEALRLEGASIGG 79
           LN+ +E  S +LP Y+  IK+T+  +G               DDF  +    ++ +    
Sbjct: 226 LNDFIERRSNELPQYLDQIKITEVDIG---------------DDFPIFSNCIIQYSPNSN 270

Query: 80  RDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQL 139
           +  ++  +++D    + + +  +L+LNYP P    LP+KLT+S +   +   V+    + 
Sbjct: 271 KKRLEAKIDIDLSDRLALGIETKLLLNYPKPFSAALPIKLTVSIVRFQACLTVSLTTDEQ 330

Query: 140 FISFLGHVSDHALDN 154
           F+      +D  + N
Sbjct: 331 FVPTSEETNDDEMGN 345

>Scas_638.24
          Length = 455

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 47  LGTIPPRITLKQIDNPLDDFY---EALRLEGASIG-GRDDVQFLMEVDYKGDMLIELSAE 102
           LG +   IT+ +ID  + D++      R+   S   G+ ++Q  +++D    +   +  E
Sbjct: 250 LGDLLGPITITEID--IGDYFPIFSNCRITTVSNSVGKKNLQAKIDIDMNDRLAFGVETE 307

Query: 103 LVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFIS 142
           L+LNYP   F  LP+KL ++ +       V++   + FIS
Sbjct: 308 LMLNYPRAAFATLPIKLNVAIVRFQGCLNVSFTTAEDFIS 347

>AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315)
           [1335 bp, 444 aa]
          Length = 444

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 29  ESLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDF--YEALRLEGASIGGRDDVQFL 86
           +S QLP+Y+  +K+T+  +G               DDF  +   R++ +    +  ++  
Sbjct: 243 KSSQLPNYLDAVKITELDIG---------------DDFPIFSNCRIKYSPPLNKKRLEAK 287

Query: 87  MEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGH 146
           +++D    + + +   L++NYP      LPVKLT+S +   +   V+    + F+  +  
Sbjct: 288 IDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVSLTTAEEFVPTMAA 347

Query: 147 VSD 149
            +D
Sbjct: 348 TTD 350

>CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1, start by similarity
          Length = 431

 Score = 34.3 bits (77), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 14/106 (13%)

Query: 30  SLQLPSYVSNIKMTDFKLGTIPPRITLKQIDNPLDDFYEALRLEGASIGGRDDVQFLMEV 89
           S  LP Y+  I +T+  +G           D P+   +   R++ A       ++  +++
Sbjct: 232 SSDLPDYLDKITITELDIGE----------DFPI---FSNCRIQYAPNSSDKKLEAKIDI 278

Query: 90  DYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYL 135
           D    +   +S  L+LNYP      LP+ L +S +   + CL   L
Sbjct: 279 DLNDKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQA-CLTVSL 323

>CAGL0L06666g 752336..753532 highly similar to sp|P39676
           Saccharomyces cerevisiae YGR234w YHB1 flavohemoglobin,
           start by similarity
          Length = 398

 Score = 31.2 bits (69), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 191 DLSEGTILRSVGKLEQFLSDVFKNL---LRKEAAWPSW 225
           D++   I+ + G+  Q ++DVF ++   + KEAAWP W
Sbjct: 112 DVATPEIITAWGEAYQEIADVFISVEAKMYKEAAWPGW 149

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 103 LVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQLFISFLGH---VSDHALDNVESPL 159
           L L   S     L V  T +D+ ++S+C+ A +  +L  +  GH   + D A        
Sbjct: 171 LALQKLSDGCYMLAVSGTSTDLMVYSVCVAATVDVELSATVEGHEDWIKDLA-------F 223

Query: 160 DSNGPA--FLGSKAVERISLIRSIKIQTEIGPQD 191
            SNGP    L S A +R   +  IK    I  +D
Sbjct: 224 RSNGPGDWMLASGAQDRYIRLWRIKANNNIEEED 257

>KLLA0A02893g 256320..258233 similar to ca|CA5008|IPF12577 Candida
           albicans unknown function, start by similarity
          Length = 637

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 22  AFLNEHLESLQLPSYVSNIK-----MTDFKLGTIPPRITLKQIDNPLDDFYEALRLEGAS 76
           +F+N    SL   S++++ +     +  FK  T+    T +    P++   + + L G  
Sbjct: 467 SFVNGETSSLMGSSHITSQEDIRTCLHSFKFKTLTNNKTHRVSLRPIEGVSKLVELIGEK 526

Query: 77  IGGRDDVQFLMEVDYKGDML 96
           +GG DDV+ L  VD + D++
Sbjct: 527 LGGSDDVEILY-VDDENDLV 545

>CAGL0H09174g complement(898883..901978) some similarities with
           sp|P24004 Saccharomyces cerevisiae YKL197c PAS1,
           hypothetical start
          Length = 1031

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 52/121 (42%), Gaps = 18/121 (14%)

Query: 33  LPSYVSNIKMTDFKLGTIPPRITLK---QIDNPLDDFYEAL----------RLEGASIGG 79
           +P  V  +K+TD  L  + P++  K   ++ N + +  + L           LEG ++  
Sbjct: 151 VPENVKTVKLTDGTLVVVAPKLNTKSKQKLKNSVPEKCKRLVKSRLCEQQENLEGLTVII 210

Query: 80  RDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQLPVKLTISDIAIHSLCLVAYLQRQL 139
           R + +   E +Y     I +  +L +    P   Q+PV++  SD+      L+A L  Q 
Sbjct: 211 RGEPE--KESEYG---CISVKRKLHVKNKDPYLRQIPVRVCYSDLVAQEHVLIAPLVWQC 265

Query: 140 F 140
            
Sbjct: 266 L 266

>Kwal_23.4548
          Length = 711

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 10  INEDSTINQRARAFLNEHLESLQLPSYVSNIK--MTDFKLGTIPPRITLKQIDNPLDDFY 67
           +N+         AF  +H    +L SYV++I+  +TD  L +   R    +I+  L D  
Sbjct: 621 VNQAEEFKAADEAFAKKHEARQRLESYVASIEQTVTDPVLSSKMKRGAKSKIETALSDAM 680

Query: 68  EALRLEGAS 76
            AL +E +S
Sbjct: 681 AALEIEDSS 689

>ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH]
            (1372612..1377534) [4923 bp, 1640 aa]
          Length = 1640

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 143  FLGHVSDHALDNVESPLDSNGPAFLGSKAV 172
            FLG VS++  D +ES +DSN   F G   V
Sbjct: 1112 FLGSVSENFQDKLESFIDSNASLFKGQATV 1141

>Kwal_23.3007
          Length = 1170

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 57/139 (41%), Gaps = 24/139 (17%)

Query: 3   FDINWNKINEDSTINQRARAFLNEHLES-LQLPSYVSNIKMTDFKLGTIPPRITLKQIDN 61
            D  W ++  +  ++Q     +NE L +   +P++V  + +  F LG  PPR+ L +   
Sbjct: 180 LDKYWTRLEPE--VSQMVVQQVNEILATNPAIPAFVKALWIDKFTLGVKPPRVDLVKTYQ 237

Query: 62  PLDDFYEALRLEGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPS------PNFMQL 115
             D                D V     V +    L +LS++ + NY +           L
Sbjct: 238 NTD---------------TDVVVMDWGVSFTPHDLSDLSSKQLKNYVNQKATVKAKVFGL 282

Query: 116 PVKLTISDIAIHSLCLVAY 134
           P+ + +SD+A  +L  V +
Sbjct: 283 PISVAVSDLAFKTLLKVRF 301

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,789,930
Number of extensions: 307108
Number of successful extensions: 823
Number of sequences better than 10.0: 31
Number of HSP's gapped: 809
Number of HSP's successfully gapped: 32
Length of query: 258
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 159
Effective length of database: 13,168,927
Effective search space: 2093859393
Effective search space used: 2093859393
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)