Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ACL009C32131512521e-175
Sklu_2419.73071631711e-13
Kwal_56.224883081491411e-09
CAGL0E02409g357641251e-07
Scas_644.13343631171e-06
YOL007C3411431082e-05
KLLA0F03465g35975974e-04
ADL251C23654681.00
CAGL0J10076g37862691.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL009C
         (315 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [...   486   e-175
Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement        70   1e-13
Kwal_56.22488                                                          59   1e-09
CAGL0E02409g complement(228503..229576) similar to sp|Q08054 Sac...    53   1e-07
Scas_644.13                                                            50   1e-06
YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protei...    46   2e-05
KLLA0F03465g complement(325270..326349) no similarity, hypotheti...    42   4e-04
ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -...    31   1.00 
CAGL0J10076g complement(985926..987062) weakly similar to sp|P53...    31   1.2  

>ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [966
           bp, 321 aa]
          Length = 321

 Score =  486 bits (1252), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 246/315 (78%), Positives = 246/315 (78%)

Query: 1   MKLHISRQSINNSWXXXXXXXPCTFCQVLAISTVRGRRFNSTTPGIITNPRHPIRYHRSI 60
           MKLHISRQSINNSW       PCTFCQVLAISTVRGRRFNSTTPGIITNPRHPIRYHRSI
Sbjct: 1   MKLHISRQSINNSWLLLLLLLPCTFCQVLAISTVRGRRFNSTTPGIITNPRHPIRYHRSI 60

Query: 61  TSIPIXXXXXXXXXXXXXXXXXIAPQQNRAAHANITKIPASYTNQQIASQTTHIMEYTPG 120
           TSIPI                 IAPQQNRAAHANITKIPASYTNQQIASQTTHIMEYTPG
Sbjct: 61  TSIPIPKRPTERPTDTRRRVTTIAPQQNRAAHANITKIPASYTNQQIASQTTHIMEYTPG 120

Query: 121 IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA 180
           IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA
Sbjct: 121 IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA 180

Query: 181 SRYQNAALYNLXXXXXXXXXXXXXLVLKVRKMDQLNRXXXXXXXXXXXXXXXEHSKDANR 240
           SRYQNAALYNL             LVLKVRKMDQLNR               EHSKDANR
Sbjct: 181 SRYQNAALYNLSSDSADSAPYDSDLVLKVRKMDQLNRLSLYSLGSMSSLGGGEHSKDANR 240

Query: 241 RSLENRASMYISPTNLIQHQKLFMXXXXXXXXXXXXXXXXXKDLPFPAPASTRAASGLPL 300
           RSLENRASMYISPTNLIQHQKLFM                 KDLPFPAPASTRAASGLPL
Sbjct: 241 RSLENRASMYISPTNLIQHQKLFMLSTRTPSTLSLTPTAALKDLPFPAPASTRAASGLPL 300

Query: 301 RHSMASTKYIPKSSA 315
           RHSMASTKYIPKSSA
Sbjct: 301 RHSMASTKYIPKSSA 315

>Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement
          Length = 307

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 10/163 (6%)

Query: 108 ASQTTHIMEYTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSW 167
           +S++T    + P IP   +N+NI  +    G +F+  G  +  +   F V W ++ +R+W
Sbjct: 58  SSKSTAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAW 117

Query: 168 YFARKEHRFQAMASRYQ------NAALYNLXXXXXXXXXXXXXLVLKVRKMDQLNRXXXX 221
           Y ARKE++ QA+ ++YQ      NA                  +  KV K +Q  R    
Sbjct: 118 YCARKEYKLQALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQSRRKSTH 177

Query: 222 XXXXXXXXXXXEHSKDANRRSL----ENRASMYISPTNLIQHQ 260
                         ++  ++++     +RASM+ISPT ++Q Q
Sbjct: 178 SLGSSSTLNLLNKYENGGKQAVPAVTSSRASMFISPTEILQQQ 220

>Kwal_56.22488
          Length = 308

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 8/149 (5%)

Query: 117 YTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRF 176
           +TP +P    N+NI ++   +G +F+A G  + V+   F ++W  +  ++W+ ARKE+  
Sbjct: 95  FTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHL 154

Query: 177 QAMASRYQNAALY------NLXXXXXXXXXXXXXLVLKVRKMDQLNRXXXXXXXXXXXXX 230
            A+ +RYQ           +               VLK R   +                
Sbjct: 155 DAIQNRYQTDPFLFHTSEGDSDSSEGSDRSDVSERVLKTRASTR--PSIYSLGSQSTLNL 212

Query: 231 XXEHSKDANRRSLENRASMYISPTNLIQH 259
              H +D    +  NR SM+ISPT +I++
Sbjct: 213 LQRHPQDNAHITTANRGSMFISPTEIIKN 241

>CAGL0E02409g complement(228503..229576) similar to sp|Q08054
           Saccharomyces cerevisiae YOL007c CSI2 involved in chitin
           synthesis, hypothetical start
          Length = 357

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 121 IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA 180
           IPS  NN+ +  +  PSG +F AFG  L  +    ++ W  + LRSW  ARKE++ +   
Sbjct: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCLAFIALVLVLVWIALTLRSWKNARKEYQIRERE 186

Query: 181 SRYQ 184
           ++YQ
Sbjct: 187 NKYQ 190

>Scas_644.13
          Length = 343

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 122 PSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMAS 181
           P+ + N NI  +    G +F+AFG  L  +     V W ++ L++W   RKE++ +A+  
Sbjct: 108 PNTNGNYNIYHTNYTDGTVFIAFGSCLLFITLILSVVWAVLGLKAWRDERKEYQLRALEE 167

Query: 182 RYQ 184
           +YQ
Sbjct: 168 KYQ 170

>YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protein
           of unknown function [1026 bp, 341 aa]
          Length = 341

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 121 IPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMA 180
           IP    N+ + ++  P+G +F+AF   L  ++ +   +W  + ++SW  ARKE++ + + 
Sbjct: 115 IPVTDGNKFLYQAHHPNGTVFIAFAGCLGAILLSLTGAWIALNIKSWRSARKENKLRNLE 174

Query: 181 SRYQNAALY-----NLXXXXXXXXXXXXXLVLKVRKMDQLNRXXXXXXXXXXXXXXXEHS 235
           ++YQ+   Y     N              +  KV K +  +R                + 
Sbjct: 175 NQYQHDPFYFQTNINDDESETSSHSDDSDISEKVLKNNS-SRMSLYTLGSTSVLNLLNNK 233

Query: 236 KDANRRSLENRASMYISPTNLIQ 258
            DAN      R+SM+ISPT ++Q
Sbjct: 234 TDANDNF---RSSMFISPTEILQ 253

>KLLA0F03465g complement(325270..326349) no similarity, hypothetical
           start
          Length = 359

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 111 TTHIMEYTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFA 170
           TT +ME    +PS   N NI  S  P+G +F+A G A   +  A LV + I    S+  A
Sbjct: 88  TTPVME----LPSAKGNPNIWSSNKPTGTVFIAVGSAAGFIFLALLVWFIINTWMSYSQA 143

Query: 171 RKEHRFQAMASRYQN 185
           ++  +F  M  ++QN
Sbjct: 144 KQLKKFNNMEKQFQN 158

>ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -
           SH] (259355..260065) [711 bp, 236 aa]
          Length = 236

 Score = 30.8 bits (68), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 122 PSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHR 175
           PS  NN NI KS  P G +F+  G A+   +   L+ W   +L + + +R+E R
Sbjct: 31  PSAANNPNIWKSSQPPGAVFIFVG-AVAAGVFLILIIW---YLVTEHISRRETR 80

>CAGL0J10076g complement(985926..987062) weakly similar to sp|P53947
           Saccharomyces cerevisiae YNL058c, hypothetical start
          Length = 378

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 122 PSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSWYFARKEHRFQAMAS 181
           PS  NN  I ++   SG +F+A G     ++    + W I    ++   +K++  ++MA+
Sbjct: 99  PSAENNPYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDY-LESMAT 157

Query: 182 RY 183
           +Y
Sbjct: 158 QY 159

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.131    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,238,652
Number of extensions: 222434
Number of successful extensions: 542
Number of sequences better than 10.0: 13
Number of HSP's gapped: 540
Number of HSP's successfully gapped: 13
Length of query: 315
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 213
Effective length of database: 13,065,073
Effective search space: 2782860549
Effective search space used: 2782860549
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)