Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR058C35034417750.0
Sklu_2411.83823698441e-111
Kwal_26.82193914017252e-93
KLLA0E07733g4693916425e-80
CAGL0M07590g4564155442e-65
Scas_576.54073944783e-56
YMR021C (MAC1)4171953939e-44
Scas_668.16291621533e-11
CAGL0L09339g877401385e-09
Scas_710.11743401369e-09
AEL295C544401351e-08
KLLA0A03047g567401351e-08
YPR008W (HAA1)694401351e-08
Kwal_14.1543599401323e-08
YGL166W (CUP2)225401231e-07
CAGL0I04180g265391152e-06
Kwal_23.652959863663.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR058C
         (344 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   688   0.0  
Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         329   e-111
Kwal_26.8219                                                          283   2e-93
KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   251   5e-80
CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   214   2e-65
Scas_576.5                                                            188   3e-56
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   155   9e-44
Scas_668.16                                                            64   3e-11
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    58   5e-09
Scas_710.11                                                            57   9e-09
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    57   1e-08
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    57   1e-08
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    57   1e-08
Kwal_14.1543                                                           55   3e-08
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    52   1e-07
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    49   2e-06
Kwal_23.6529                                                           30   3.0  

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/344 (97%), Positives = 334/344 (97%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMXX 60
           MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPM  
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMED 60

Query: 61  XXXXXXXXGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGVDKRFKFVT 120
                   GGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGVDKRFKFVT
Sbjct: 61  EDTEECCDGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGVDKRFKFVT 120

Query: 121 EKEFLLQNADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYTYKGVYLSTQCSCDDSA 180
           EKEFLLQNADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYTYKGVYLSTQCSCDDSA
Sbjct: 121 EKEFLLQNADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYTYKGVYLSTQCSCDDSA 180

Query: 181 CQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANER 240
           CQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANER
Sbjct: 181 CQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANER 240

Query: 241 TSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDIL 300
           TSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDIL
Sbjct: 241 TSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDIL 300

Query: 301 YLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAATGLDY 344
           YLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAATGLDY
Sbjct: 301 YLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAATGLDY 344

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  329 bits (844), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 177/369 (47%), Positives = 231/369 (62%), Gaps = 44/369 (11%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQV--PM 58
           MIIFDG+KYSC ACIRGHRS+TCKHSDRMLVKVRTRGRPSPMD+RKVI+VD  SQV  P+
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60

Query: 59  XXXXXXX-----XXXGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRAN-SDGV 112
                            K+C KM++QPILFL+A++TQKALLVDG LKIM+ED  + S   
Sbjct: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSIDS 120

Query: 113 DKRFKFVTEKEFLLQNADMLKARDGCGCQRPK--------RARVGCSTGAGSPH------ 158
            K+FK V+E+E++L++++  +  D C C+  +          R        + H      
Sbjct: 121 KKKFKLVSEREYMLKHSNN-RMPDCCSCKSEEAELPENELEQRTASFQSVKTFHNGNDVL 179

Query: 159 ---------------AVEPYTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSG 203
                           VE  T+KGVYLSTQCSC+D  CQC NCLIHRKEEEL+++IRQSG
Sbjct: 180 STTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSG 239

Query: 204 VPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVV 263
           +PLT++        E G   G   +       + +  + C C P  C+C  C  H  E++
Sbjct: 240 IPLTNLGNGRVTDDENGHGNGSIKT------ISCSTESVCRCPPQDCICPHCLDHPGEII 293

Query: 264 SMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQWFDN 323
           SM+ LLLHG+LNT LKRK  I+Y+ KLI SK+WWD + LQ  +    QLE+LDLL+WFD+
Sbjct: 294 SMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDS 353

Query: 324 IIETHGAAL 332
           I+E +G+ L
Sbjct: 354 IVEAYGSFL 362

>Kwal_26.8219
          Length = 391

 Score =  283 bits (725), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/401 (39%), Positives = 219/401 (54%), Gaps = 78/401 (19%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMXX 60
           MIIFDGEKYSC +CIRGHRS+TCKHS+RMLVKVRTRGRPS   +RKVILVDA SQV    
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60

Query: 61  XXXX--------XXXXGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGV 112
                             ++C KM++QPILFL+ + TQKALLVDGALKIMIED       
Sbjct: 61  HTEEDDQGQSPCCSSSASRSCTKMNKQPILFLRTMSTQKALLVDGALKIMIED--TDPAF 118

Query: 113 DKRFKFVTEKEFLLQN-------------------------------ADMLKARDGCGCQ 141
             ++KFV+E+++LL +                               +D L + +    +
Sbjct: 119 HGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKHE 178

Query: 142 ----------RPKRARVGCSTG--------AGSPHAVEPYTYKGVYLSTQCSCDDSACQC 183
                     RP     G  T         A +   VE +T+KGVYLSTQCSCD+  C C
Sbjct: 179 YPDIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSC 238

Query: 184 ANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANERTSC 243
            NCLIHRKEEEL+ +I+QSGVPL+++                  +G + +    + + + 
Sbjct: 239 VNCLIHRKEEELESYIQQSGVPLSTI-----------------GNGRITFPIEQSSKDAF 281

Query: 244 AC--SPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILY 301
            C  S   C  +DC +H  E++S+N + ++G++N P+KRK  I++K KLI SKFWW +L 
Sbjct: 282 VCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLK 341

Query: 302 LQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAATGL 342
            +       Q  + D+ QWF++IIET  A +P+    +  L
Sbjct: 342 EELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESDGSVNL 382

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  251 bits (642), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 155/391 (39%), Positives = 213/391 (54%), Gaps = 66/391 (16%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMXX 60
           MIIF+GEKYSC +CIRGHRS++CKHS+RMLVKVRTRGRPSP+DIRKVILVD  S+V    
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60

Query: 61  XXXXXXXXGGKT--CGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDG------V 112
                   G ++  C  M++QP+LFL+A+ T+KALL++G LKIM+   + +        V
Sbjct: 61  GSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYEVARKV 120

Query: 113 DKRFKFVTEKEFLLQ--------------------------------------------- 127
               KFVTE EFLL                                              
Sbjct: 121 SDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDATNTTENYAKRVKFERQDMTN 180

Query: 128 --NADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYTYKGVYLSTQCSCDDSACQCAN 185
             N ++L A D           VG ST   S   VE +T  G YLST     +  CQC N
Sbjct: 181 LSNHELLSAGDNVQLNS-----VGNSTFQDS--VVELFTQNGAYLST-TCSCNENCQCNN 232

Query: 186 CLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLL-GYDYAANERTSCA 244
           CLIHR+E EL++++ +   P+  ++L   +   A +   + +     G     N  T C 
Sbjct: 233 CLIHREEAELERYLTELNQPM--INLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCL 290

Query: 245 CSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILYLQC 304
           C P  C C +CE H +EVV+++ LLL+G+LN   K+KM I+Y+ K+I+SK+WW  L ++ 
Sbjct: 291 CEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEI 350

Query: 305 AVAREPQLEALDLLQWFDNIIETHGAALPDA 335
               E QL +LDL++WFDN+I +H A LP+A
Sbjct: 351 PSMNEKQLRSLDLMEWFDNLISSHSAELPEA 381

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  214 bits (544), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/415 (34%), Positives = 188/415 (45%), Gaps = 103/415 (24%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILV---------- 50
           MIIF  +KY+C  CIRGHRS+ C H+ RMLVKVR RGR   +D+R  I+V          
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60

Query: 51  -------DAGSQ--VPMXXXXXXXXXXGGKTCGKMDRQPILFLKALKTQKALLVDGALKI 101
                  D   Q   P              TC  M++QPILF++A K  KA L+ G LK 
Sbjct: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120

Query: 102 MIE---DRANSDGVDKRFKFVTEK----EFLLQNA----------DMLKARDGCGCQRPK 144
           M E    R   D  D      T      E L  N           DM+   D        
Sbjct: 121 MSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNIDDDMVLVDD-------T 173

Query: 145 RARVGCSTG--------------------AGSPHAVEPY--------------------- 163
           +   G S G                       PH ++P                      
Sbjct: 174 KNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAATETEKYPFFQLL 233

Query: 164 TYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACC 223
           T +GVYLSTQCSC  + C C+NCLIHR EEE++ +I  SGVPLT++D             
Sbjct: 234 TKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLD------------- 280

Query: 224 GDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMS 283
              ++ L       + R SC C P  C C  C+IH  EVV   R+++HG++NT L +K  
Sbjct: 281 --SSTSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTL 338

Query: 284 IQYKGKLINSKFWWD--ILYLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAE 336
           IQY+ KLI  K+WWD  ++Y+ C   R    + LD++ +FDNII+ HG  L DA+
Sbjct: 339 IQYRKKLIGQKYWWDYCMVYIPC--LRCNNFDGLDIVGFFDNIIKEHGHELEDAK 391

>Scas_576.5
          Length = 407

 Score =  188 bits (478), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 193/394 (48%), Gaps = 61/394 (15%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMXX 60
           MII+  EKY+CA+CIRGHRS+TCKH++RMLVKVRTRGRPSP +IR VI+VD+ S++    
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 61  XXXXXXXXG-------GKTCGK-MDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGV 112
                             +C + M+RQP+LF++   ++KA L++G L+I+++D A+S+  
Sbjct: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120

Query: 113 --------DKRFKFVTEKEFLLQNADMLKARDGCGCQRPKRARVGCSTGAGSPHAVEPYT 164
                   +   KF+ E E+L Q +                +   C             T
Sbjct: 121 GSSVSSKDNGNSKFIPEVEYLKQLSGSSSGSGSNSLGSTPNSNTCCHHHTTCASMAAAAT 180

Query: 165 YKGVYLSTQCSCDDSACQCANCL------IHRKEEELD--QFIRQ---SGVPLTSVDLED 213
                 S     D++     N        I + EE L+  ++  Q   S  PL  VDL  
Sbjct: 181 ANTSTQSLLSKNDNNMTTSTNMTEDNNLDIGKIEESLNSMEYFEQVLDSKTPL--VDLFT 238

Query: 214 RKPAEAGACCG-----------------------DRASGL----LGYDYAANERTSC--- 243
            K     + C                         R SG+    +G     NE   C   
Sbjct: 239 HKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELMECTTS 298

Query: 244 --ACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILY 301
             AC+ V C+C+DC +H  E++S++++LL+G+L+  L+RK  I++K KLI S++WWD L 
Sbjct: 299 NCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKLIPSQYWWDFLI 358

Query: 302 LQCAVAREPQLEALDLLQWFDNIIETHGAALPDA 335
            +    +E  LE++D++ WFD++I  +   L DA
Sbjct: 359 GKTVKLQEGDLESIDIIGWFDSLINKYPMELLDA 392

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  155 bits (393), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 109/195 (55%), Gaps = 25/195 (12%)

Query: 151 STGAGSPHA------VEPYTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGV 204
           +T   +PH+      VE  T+KG++LSTQCSC+D +C C NCLIHR EEEL+ +I+QSGV
Sbjct: 235 TTTIAAPHSSDVASKVEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGV 294

Query: 205 PLTSV---DLEDRKPAEAGAC-CGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAE 260
           PLT++    + D+       C C D+                C C P +C C  C  H+ 
Sbjct: 295 PLTNIGEAQITDKMMDYLDDCKCTDK---------------ECICPPDNCTCDGCFSHST 339

Query: 261 EVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQW 320
            ++   +   +GILN  L RK  I++KGKL+ SK+WWD L LQ  +  + QLE LD+  W
Sbjct: 340 NIIPFEKFFFYGILNARLTRKTQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLELLDIHAW 399

Query: 321 FDNIIETHGAALPDA 335
           F  ++  +   L DA
Sbjct: 400 FQKLVSNYAPHLSDA 414

 Score =  128 bits (322), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 89/136 (65%), Gaps = 10/136 (7%)

Query: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQVPMXX 60
           MIIF+G KY+CA+CIRGHRS+TC+HS RML+KVRTRGRPSPM IR  ILVD+ SQ     
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQ---ST 57

Query: 61  XXXXXXXXGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIED-------RANSDGVD 113
                    G  C  M++QPILF++A   +KA +++G L I++E+       +  S   D
Sbjct: 58  EYENGAQIEGDCCSAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEPKDISTFTD 117

Query: 114 KRFKFVTEKEFLLQNA 129
              K++TE EFL +++
Sbjct: 118 DGNKYITETEFLRKHS 133

>Scas_668.16
          Length = 291

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 5/62 (8%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPM-----DIRKVILVDAGSQ 55
          MI+ +GEKY+C  CIRGHRS++C H DR L K++ +GRPS       ++RKV  V+    
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGRPSTTCMHCKEMRKVKNVNPSGG 60

Query: 56 VP 57
           P
Sbjct: 61 CP 62

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC HSD+ L+ ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPS 40

>Scas_710.11
          Length = 743

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 30/40 (75%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC H+D+ L  ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPS 40

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>Kwal_14.1543
          Length = 599

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR TTC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR+  C H+D  L  +R +GRPS
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPS 40

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 29/39 (74%)

Query: 1  MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRP 39
          M++ +G KY+C +CI+ H++  C+H+DR L  ++ RGRP
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRP 39

>Kwal_23.6529
          Length = 598

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 244 ACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLI------NSKFWW 297
           +C      C  CE+ A+E +++ ++ +  I    L++ M+   + K I        K+WW
Sbjct: 526 SCITFCLFCCGCELVADEYITLRKIYVDHI-EVLLRKGMTSAQQAKTIMEECWEGRKYWW 584

Query: 298 DIL 300
           DIL
Sbjct: 585 DIL 587

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,306,653
Number of extensions: 408659
Number of successful extensions: 844
Number of sequences better than 10.0: 18
Number of HSP's gapped: 828
Number of HSP's successfully gapped: 26
Length of query: 344
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 242
Effective length of database: 13,065,073
Effective search space: 3161747666
Effective search space used: 3161747666
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)