Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR057W52051026420.0
Sklu_2411.949749611891e-159
Kwal_26.821450250310911e-144
Scas_709.5055250810691e-140
YMR020W (FMS1)50850610451e-137
KLLA0E07744g5335119061e-116
CAGL0M07612g5815888271e-104
Kwal_23.347340944810.074
Kwal_26.8602428162800.092
Sklu_2151.5116870780.24
KLLA0E14806g40038760.28
Kwal_27.10088498202740.50
YEL047C47045711.2
KLLA0F16753g48754711.4
Scas_709.1950545692.2
YMR168C (CEP3)60864692.6
KLLA0E19723g214162683.5
Scas_678.468058673.8
ADR290W219540683.9
YJR051W (OSM1)50145674.2
AEL148W57342665.1
Kwal_33.14854216340666.2
CAGL0L04004g96846656.8
AFR367W50372657.1
Scas_608.1048745657.6
AER383W25072647.9
CAGL0L01177g46544648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR057W
         (510 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...  1022   0.0  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      462   e-159
Kwal_26.8214                                                          424   e-144
Scas_709.50                                                           416   e-140
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   407   e-137
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   353   e-116
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   323   e-104
Kwal_23.3473                                                           36   0.074
Kwal_26.8602                                                           35   0.092
Sklu_2151.5 YPR164W, Contig c2151 4571-8077 reverse complement         35   0.24 
KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Cand...    34   0.28 
Kwal_27.10088                                                          33   0.50 
YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasm...    32   1.2  
KLLA0F16753g complement(1541959..1543422) similar to sp|P21375 S...    32   1.4  
Scas_709.19                                                            31   2.2  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    31   2.6  
KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680 Saccha...    31   3.5  
Scas_678.4                                                             30   3.8  
ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH] complement(...    31   3.9  
YJR051W (OSM1) [2945] chr10 (529775..531280) Mitochondrial solub...    30   4.2  
AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH] complement(...    30   5.1  
Kwal_33.14854                                                          30   6.2  
CAGL0L04004g 469248..472154 similar to sp|P53550 Saccharomyces c...    30   6.8  
AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -...    30   7.1  
Scas_608.10                                                            30   7.6  
AER383W [2884] [Homologous to ScYDR262W - SH] complement(1357717...    29   7.9  
CAGL0L01177g complement(134729..136126) highly similar to sp|P32...    29   8.2  

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/510 (97%), Positives = 495/510 (97%)

Query: 1   MIENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGR 60
           MIENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGR
Sbjct: 1   MIENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGR 60

Query: 61  RYDLGASWHHDTLSNXXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLMLEAL 120
           RYDLGASWHHDTLSN               GYVFDDVPTMVVSPAGRRLDGDFGLMLEAL
Sbjct: 61  RYDLGASWHHDTLSNELFAEELRLPEAERAGYVFDDVPTMVVSPAGRRLDGDFGLMLEAL 120

Query: 121 QREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAID 180
           QREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAID
Sbjct: 121 QREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAID 180

Query: 181 WKLLSAKLSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTA 240
           WKLLSAKLSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTA
Sbjct: 181 WKLLSAKLSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTA 240

Query: 241 DGACYVSKCAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFE 300
           DGACYVSKCAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFE
Sbjct: 241 DGACYVSKCAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFE 300

Query: 301 FDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQ 360
           FDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQ
Sbjct: 301 FDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQ 360

Query: 361 NMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAIVVALRALGSKEECLFDLGNTQ 420
           NMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAIVVALRALGSKEECLFDLGNTQ
Sbjct: 361 NMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAIVVALRALGSKEECLFDLGNTQ 420

Query: 421 PQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHT 480
           PQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHT
Sbjct: 421 PQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHT 480

Query: 481 VMEGNGCTYGAWESGRREAEYVLEYLRRFP 510
           VMEGNGCTYGAWESGRREAEYVLEYLRRFP
Sbjct: 481 VMEGNGCTYGAWESGRREAEYVLEYLRRFP 510

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  462 bits (1189), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/496 (45%), Positives = 316/496 (63%), Gaps = 8/496 (1%)

Query: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASW 68
           E +VV++GAGIAGLKAA++L++     CVVLE+R R GGRL  VE   + GR+YDLGASW
Sbjct: 4   EKSVVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIGGRLHTVEG--YDGRKYDLGASW 61

Query: 69  HHDTLSNXXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYI 128
           HHDTL N                +VFDD   ++ +  G+RLD D  L+LE L+ E++ +I
Sbjct: 62  HHDTLMNGLFLEELQLPEQERTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFI 121

Query: 129 EEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKL 188
           E Q+FESL+ +D+ +F++++ YLY+RR  L+D+Q++ LP   R+ E WH IDWK LS K 
Sbjct: 122 ELQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKY 181

Query: 189 SEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVSK 248
           + +++ GRNA VL+Y  +++RV S  P+EW++L T V ++ R    V + T +   YV  
Sbjct: 182 AHIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEET-YVCD 240

Query: 249 CAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDT 308
             +VTVPQS+LELSL  E   GRIEF PPLN +I  +F + HY +LGK+ FEFDKC W T
Sbjct: 241 YVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWST 300

Query: 309 QRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQNMVALAGI 368
           +R ++    K P+ F+ +VR A D   L++     T  +LG D +DFP  F N+    G+
Sbjct: 301 ERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGV 360

Query: 369 PTLIAFTQTPLTEHVERL-SKQEIVDYFKPAIVVALRALGSKEE-CLFDLGNTQPQDDSH 426
           P+ +   Q PLT +VE L  K+ + +YFKP +    + LGS    C F+ G    +++  
Sbjct: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENV- 419

Query: 427 PGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNG 486
             PILKNV    W+++ YS G+Y+    +DD +   +AL  GQDS IRFAGEHTVM+G G
Sbjct: 420 --PILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAG 477

Query: 487 CTYGAWESGRREAEYV 502
           C YGAWESG+REA Y+
Sbjct: 478 CVYGAWESGKREASYI 493

>Kwal_26.8214
          Length = 502

 Score =  424 bits (1091), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 214/503 (42%), Positives = 304/503 (60%), Gaps = 5/503 (0%)

Query: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASW 68
           E  VV++GAGI+GLKAA+ LH  G + C+V+EAR R GGRL  V  S + GR+YD+GASW
Sbjct: 3   EKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTV--SGYKGRKYDVGASW 60

Query: 69  HHDTLSNXXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYI 128
           HHDTL N                +VFDD   +V   A  R+D D  + LE L  E+  Y 
Sbjct: 61  HHDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYT 120

Query: 129 EEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKL 188
           + QYFE LE  D+ +F+ +M YLYERR +LTDDQIQ LP   RF E WH IDWK  S+K 
Sbjct: 121 QLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKG 180

Query: 189 SEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVSK 248
            E+ + GRNAFVLN+  + +RV S +P+EW  L T V ++++  + V ++T+ G      
Sbjct: 181 LEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELETEVREVKKEGEKVLVSTSKGETISCD 240

Query: 249 CAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDT 308
             IVT+PQS+L  SL+PE   GRIEF PPL+  I ++ E AH+  LGK+ FEF+ C W  
Sbjct: 241 YVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSK 300

Query: 309 QRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQ-DCFDFPQEFQNMVALAG 367
           +R R     K   D ++++R+A DL +L+      ++      + +DFP  F N+     
Sbjct: 301 ERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTD 360

Query: 368 IPTLIAFTQTPLTEHVERLS-KQEIVDYFKPAIVVALRALGSKEECLFDLGNTQPQDDSH 426
           IP+ I     PLTE++E +  K+++ ++FKP +   L   G  E  + D  +    +D  
Sbjct: 361 IPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEK 420

Query: 427 PGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNG 486
             P+LKN++   W+ D Y+ G+Y+  +  DD + + +AL+N Q SRIRFAGEHT+M+G G
Sbjct: 421 K-PVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAG 479

Query: 487 CTYGAWESGRREAEYVLEYLRRF 509
           C YGAWESG+REA ++ + L  F
Sbjct: 480 CVYGAWESGKREALFIEDKLNGF 502

>Scas_709.50
          Length = 552

 Score =  416 bits (1069), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 208/508 (40%), Positives = 310/508 (61%), Gaps = 17/508 (3%)

Query: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASW 68
           E  V+++GAGIAGLKAA+ L++ GI+ C+V+EAR R GGRLL V+   + G +YDLGA W
Sbjct: 51  EQQVIIIGAGIAGLKAASTLYANGIKNCLVIEARDRIGGRLLTVKG--YKGDKYDLGAGW 108

Query: 69  HHDTLSN-XXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHY 127
           HHDTL N                 +VF+D   + +     R+D D  + LE +  E++ +
Sbjct: 109 HHDTLMNPLFLEEAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKF 168

Query: 128 IEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAK 187
              ++++SL+ +D  F+ +++ YL +RR  LTDDQI+      R+ E WH   W  LSAK
Sbjct: 169 TGLEFYQSLDVKDCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAK 228

Query: 188 LSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVS 247
            +  ++ GRNA V N+D ++ R+    P++WIRL T V  IER    V I  + G  Y+ 
Sbjct: 229 DTYFDHQGRNALVTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYIC 288

Query: 248 KCAIVTVPQSVLELSLK---PERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKC 304
           +  IVT+PQSVL+LSL+        GRI+F+PPLN  I  AF++ H+  LGK+ FEFDKC
Sbjct: 289 QYTIVTIPQSVLQLSLQLPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKC 348

Query: 305 TWDTQRPRVAIAAKVPDDFSAQVRKAQDLQEL---LRSASAQTEVKLGQDCFDFPQEFQN 361
           TW  +  R+   A   ++F   VRKA+  + L   L++ S+Q    L ++C+DFP  F N
Sbjct: 349 TWSNESSRIFTLAHSQENFVEDVRKAETWEGLIDNLKTPSSQ----LFENCWDFPLLFIN 404

Query: 362 MVALAGIPTLIAFTQTPLTEHVERLS--KQEIVDYFKPAIVVALRALGSKEECLFDLGNT 419
           +    G PTLI   Q+PL+ ++E +   KQ++ ++F+P +   +  L S +  + +  + 
Sbjct: 405 LAKSIGRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNK--VINGLSA 462

Query: 420 QPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEH 479
            P +     PILKN++   W+ D YSRG+Y+     DD L + +A++NGQDSRIRFAGEH
Sbjct: 463 NPTEAETNSPILKNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEH 522

Query: 480 TVMEGNGCTYGAWESGRREAEYVLEYLR 507
           T+M+G G  +G+WESGRRE EY+LE+L+
Sbjct: 523 TIMDGAGAVHGSWESGRREGEYILEHLK 550

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  407 bits (1045), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 208/506 (41%), Positives = 305/506 (60%), Gaps = 18/506 (3%)

Query: 12  VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASWHHD 71
           V+++GAGIAGLKAA+ LH  GI+ C+VLEAR R GGRL  V    + GR+YD+GASWHHD
Sbjct: 11  VIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTG--YQGRKYDIGASWHHD 68

Query: 72  TLSN-XXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYIEE 130
           TL+N                 +VFDD   + +     R+D D  L+LE +  E+  + E 
Sbjct: 69  TLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAEL 128

Query: 131 QYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKLSE 190
           ++ + L   D  FF+LVM YL +RR  LT+DQI+ LP   R+ E WH +DWKLLSAK + 
Sbjct: 129 EFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDTY 188

Query: 191 VENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERV-RDTVHITTADGACYVSKC 249
             + GRNAF LNYD +++R+    P+ W++L   V  I R     V +   DG  Y +  
Sbjct: 189 FGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNADY 248

Query: 250 AIVTVPQSVLELSLKPER-VPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDT 308
            I+TVPQSVL LS++PE+ + GRIEF+PPL   I  AF++ H+ +LGK+ FEF++C W  
Sbjct: 249 VIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWSN 308

Query: 309 QRPRVAIAAKVPDDFSAQVRKAQDLQEL---LRSASAQTEVKLGQDCFDFPQEFQNMVAL 365
           +  ++   A   ++F   VR A++L EL   L    +Q    +   C+  P  F N+   
Sbjct: 309 ESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVT--CWSQPLFFVNLSKS 366

Query: 366 AGIPTLIAFTQTPLTEHVE--RLSKQEIVDYFKPAIVVALRALGSKEECLFDLGNTQPQD 423
            G+ + +   Q PLT H+E  R  K+ +  +F+P +   ++ L S++     +   +P +
Sbjct: 367 TGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDV----IDGMRPIE 422

Query: 424 D--SHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTV 481
           +  +   P+L+N+I + W++D YSRG+Y+     DD + + VA++NGQDSRIRFAGEHT+
Sbjct: 423 NIANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTI 482

Query: 482 MEGNGCTYGAWESGRREAEYVLEYLR 507
           M+G GC YGAWESGRREA  + + L+
Sbjct: 483 MDGAGCAYGAWESGRREATRISDLLK 508

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/511 (38%), Positives = 295/511 (57%), Gaps = 31/511 (6%)

Query: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGR--RYDLGA 66
           +Y+V+V+GAGI+GLKA ++L  +GIE  + +E+R R GGRL     +   GR  +YD+G 
Sbjct: 35  DYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRL-----NTRQGRNGKYDIGG 89

Query: 67  SWHHDTLSNXXXXXXXXXXXXXXXGYVFDDVPTMVVSPAGRRLDGDFGLM----LEALQR 122
           SWHHDTLSN               G+VFDD     +      +D   G++    LE L  
Sbjct: 90  SWHHDTLSNGLFMEEMSLPESERAGFVFDDEDRACL------VDKKLGVLEVDQLECLAY 143

Query: 123 EVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWK 182
           E E ++E +Y++SL+  D+ +F+L + + + R+  LTD+Q+  LP  +R+ E WH +DW 
Sbjct: 144 EFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWY 203

Query: 183 LLSAKLSEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADG 242
            LS K S +E+NGRNA VL+YDK+L R+ + V ++ I L   V  I+++ +  +    D 
Sbjct: 204 ALSGKWSGIEHNGRNALVLHYDKILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDK 262

Query: 243 ACYVSKCAIVTVPQSVLELSLKPERV------PGRIEFRPPLNDNITSAF-ERAHYASLG 295
             Y+    IVTVPQSVL +S + E          RI F PPLN +I  A   +A + SLG
Sbjct: 263 GKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLG 322

Query: 296 KIFFEFDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDF 355
           K+ FEFD   W     R+    + P DF   +R A+DL+ LL+    Q   +  +D +  
Sbjct: 323 KVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKDIE-QKLPRSHEDSWKN 381

Query: 356 PQEFQNMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAIVVALRALGSKEECLFD 415
           P  F N+       + +A  Q P+TE++E L+ +E+ ++F+P +   L +LGS +  + D
Sbjct: 382 PTCFLNLAKHTDTASFVALIQQPVTEYIETLTTEEVEEFFRPVLNKLLNSLGSSDY-ISD 440

Query: 416 LGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRF 475
           L +   +  +   PILKN++ + WS D +S G+Y+     DD + L +ALN GQ   +RF
Sbjct: 441 LNDEVKESKT---PILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRF 496

Query: 476 AGEHTVMEGNGCTYGAWESGRREAEYVLEYL 506
           AGEHT+M+G GC YGAWESG+REA Y++E L
Sbjct: 497 AGEHTIMDGAGCAYGAWESGKREANYIIEKL 527

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 202/588 (34%), Positives = 296/588 (50%), Gaps = 101/588 (17%)

Query: 10  YTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASWH 69
           Y VVVVGAGIAGLKAA+ L  +G + C+V+E+R R GGRL  V    + G RYDLGASWH
Sbjct: 5   YDVVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTG--YNGARYDLGASWH 61

Query: 70  HDTLSNXXXXXXXXXXXXXXXG------------------------------------YV 93
           HDTL+N                                                    +V
Sbjct: 62  HDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPFV 121

Query: 94  FDDVPTMVVSPA-GRRLDGDFGLMLEALQREVEHYIEEQY-------------FESLEAR 139
           FDD   ++V    G   D    L+ + +++ +E Y   +Y              E     
Sbjct: 122 FDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRA 181

Query: 140 DMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKLSEVENNGRNAF 199
           DMP F++++ YL +R   LTDDQ+       R+ E WH + W  LS++ S   + GRNAF
Sbjct: 182 DMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAF 241

Query: 200 VLNYDKLLRRVESGVPREW--IRLGTRVTKIERV--RDTVHITT---------------A 240
           V+NYD +  R+   +  E   ++L + VTKIE      TV  TT               A
Sbjct: 242 VMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHGA 301

Query: 241 DGACYVSKCA--IVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIF 298
            G  +  +C+  IVT+PQS+L          G +EF+PPL   I++A ++ H+ SLGK+ 
Sbjct: 302 AGQQHTVQCSYVIVTIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVV 353

Query: 299 FEFDKCTWDTQRPR-VAIAAKVPD---DFSAQVRK--------AQDLQELLRSASAQT-E 345
           FEF++C WD    + VA+A    D   +F+A +RK        AQ LQ L++       +
Sbjct: 354 FEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGD 413

Query: 346 VKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTPLTEHVERL-SKQEIVDYFKPAIVVALR 404
             +  DC++ P  F NM    G+P+L+     PLT ++E L    ++ ++FKP +   + 
Sbjct: 414 DAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMS 473

Query: 405 ALGSKEECL--FDLGNTQPQDD---SHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQL 459
              +    +   D+      DD   S  GPIL+NVI   W+ D YS+G+Y+  +  DD L
Sbjct: 474 VCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDAL 533

Query: 460 PLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESGRREAEYVLEYLR 507
            + +A++NGQ SR+RFAGEHT+++G GC YGAWESG REA Y+L+ ++
Sbjct: 534 DMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYILKQMK 581

>Kwal_23.3473
          Length = 409

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 3  ENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTG 46
           +AG+ +Y+  V+G G+ GL  A+EL      K V++E    TG
Sbjct: 27 SSAGSVDYSHAVIGGGVVGLAVASELSKIAGNKVVLIEKNPSTG 70

>Kwal_26.8602
          Length = 428

 Score = 35.4 bits (80), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 69/162 (42%), Gaps = 28/162 (17%)

Query: 217 EWIR-----LGT---RVTKIERVRDTVHITTADGACYVSKCAIVTVPQSVLELSLKPERV 268
           EW++     LGT   +  +IE +R+ +     D   Y+S       P+  +ELSL+P   
Sbjct: 50  EWLKNEISHLGTLKFKEDEIEYLRNVIPYIPEDFLAYLSSGQPSICPEKQIELSLEPAEE 109

Query: 269 PGR----IEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVP---- 320
            GR    +E R    D I   +E    + + + +F+F    W T   +V IA +      
Sbjct: 110 AGRYSIHMEIRGLWRDTIL--YEIPLLSLISEAYFKFVDTDW-TYDNQVEIAYQKAKTLI 166

Query: 321 ------DDFSAQVRKAQDLQELLRSASAQT---EVKLGQDCF 353
                  +F ++ R++ + Q+L+     Q      + G+ CF
Sbjct: 167 ENGLNFSEFGSRRRRSMNTQDLVMKGIMQAVEEHGETGKKCF 208

>Sklu_2151.5 YPR164W, Contig c2151 4571-8077 reverse complement
          Length = 1168

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 9/70 (12%)

Query: 401 VALRALGSKEECLFDLGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLP 460
           V + + G   E L DL N Q     +  P L N+I         SR +   +HVD + L 
Sbjct: 437 VIITSFGRTFELLLDLSNIQEISKDYKIPSLSNII---------SRRTIDAAHVDGETLM 487

Query: 461 LTVALNNGQD 470
              +LNN +D
Sbjct: 488 CIRSLNNDRD 497

>KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294
          Candida albicans unknown function, hypothetical start
          Length = 400

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 9  EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTG 46
          +Y+  V+GAG+ GL  A EL      K +VLE  A+ G
Sbjct: 26 DYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIG 63

>Kwal_27.10088
          Length = 498

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 82/202 (40%), Gaps = 39/202 (19%)

Query: 7   TPEYT--VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV---FPGRR 61
           T ++T  VV++G+G+AGL AA +L        V+LE  +  GG  ++  S +       +
Sbjct: 33  TSKFTTPVVIIGSGLAGLTAANQLVLKHKVPIVMLEKASSLGGNSIKASSGINGALTSTQ 92

Query: 62  YDLG-----ASWHHDTLSNXXXXXXXXXXXXXXXGYVFDDVPTMV------VSPAGRRLD 110
             LG     ++++ DTLS+                     VP ++       S A   L 
Sbjct: 93  KTLGVNDSPSAFYQDTLSSAKGA----------------GVPPLMNKLAQESSSAVSWLQ 136

Query: 111 GDFGLMLEALQREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTV 170
            +FG+ L+ L +   H     +  S   +  P FE+V A     +G+   D     P  V
Sbjct: 137 QEFGIKLDLLAQLGGHSAPRTHRSS--GKLPPGFEIVQALSNSLKGISEKD-----PELV 189

Query: 171 RFREFWHAIDWKLLSAKLSEVE 192
           +        D +++  K+  V+
Sbjct: 190 KIHLNSRVFDVEIVKNKVEAVK 211

>YEL047C (YEL047C) [1381] chr5 complement(65385..66797)
          Cytoplasmic soluble fumarate reductase, involved with
          Osm1p in the reoxidation of NADH and the production of
          succinate during anaerobic growth [1413 bp, 470 aa]
          Length = 470

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 12 VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          VVV+G G+AGL AA EL +       +LE  +  GG  ++  S +
Sbjct: 6  VVVIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGI 50

>KLLA0F16753g complement(1541959..1543422) similar to sp|P21375
          Saccharomyces cerevisiae YJR051w OSM1 osmotic growth
          protein, start by similarity
          Length = 487

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 3  ENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          +N  T    VVV+G+G+AGL  + +L    I   V+LE     GG  ++  S +
Sbjct: 24 KNQATMSKPVVVIGSGLAGLTTSTQLVKFNIP-IVLLEKTGSIGGNSIKASSGI 76

>Scas_709.19
          Length = 505

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 12 VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          VVV+G+G+AGL A+  L S      V+L+  +  GG  ++  S +
Sbjct: 42 VVVIGSGLAGLTASNRLVSKYNIPVVLLDKASSMGGNSIKASSGI 86

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
           (subunit b) of the Cbf3 kinetochore protein complex
           [1827 bp, 608 aa]
          Length = 608

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 273 EFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQD 332
           +FRP LND+   +  +    +LG+IF+    C +    PR  IA     + S+ ++ A  
Sbjct: 271 DFRPLLNDDPVESIAKV---TLGRIFYRLCGCDYLQSGPRKPIALHT--EVSSLLQHAAY 325

Query: 333 LQEL 336
           LQ+L
Sbjct: 326 LQDL 329

>KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase
            (NAPDPH) (GOGAT) singleton, start by similarity
          Length = 2141

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 12   VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRL------LQVESSVFPGRRYDLG 65
            V V+G+G AG+  A +L+ AG    VV E   R GG L      ++++ S+   RR DL 
Sbjct: 1784 VAVIGSGPAGMACADQLNRAG-HSVVVYERADRCGGLLMYGIPNMKLDKSIVQ-RRLDLL 1841

Query: 66   AS 67
            A+
Sbjct: 1842 AA 1843

>Scas_678.4
          Length = 680

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 15/58 (25%)

Query: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGA 66
           EY  VVVGAG AGL+A   L  AG +   +               S +FP R + + A
Sbjct: 92  EYDCVVVGAGGAGLRATFGLAEAGFKTACI---------------SKLFPTRSHTVAA 134

>ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH]
            complement(1196235..1202822) [6588 bp, 2195 aa]
          Length = 2195

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 11   TVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLL 50
            TV ++G+G AGL  A +L+ AG     V E   R GG L+
Sbjct: 1837 TVAIIGSGPAGLSCADQLNRAG-HSVTVYERADRCGGLLM 1875

>YJR051W (OSM1) [2945] chr10 (529775..531280) Mitochondrial
          soluble fumarate reductase involved with Yel047p in
          succinate production and reoxidation of NADH during
          anaerobic growth and involved in osmotic regulation
          [1506 bp, 501 aa]
          Length = 501

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 12 VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          VVV+G+G+AGL  +  L S      V+L+  A  GG  ++  S +
Sbjct: 37 VVVIGSGLAGLTTSNRLISKYRIPVVLLDKAASIGGNSIKASSGI 81

>AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH]
           complement(351089..352810) [1722 bp, 573 aa]
          Length = 573

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 321 DDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQNM 362
           D+F  ++   Q L E + SA+ + E K  +D    P+EF++M
Sbjct: 511 DNFDIELFAIQILNEAICSATTKIEFKYNRDKIKSPEEFEDM 552

>Kwal_33.14854
          Length = 2163

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 11   TVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLL 50
            T+ ++G+G AGL  A +L+ AG     V E   R GG L+
Sbjct: 1803 TIAIIGSGPAGLACADQLNRAG-HSVTVYERADRCGGLLM 1841

>CAGL0L04004g 469248..472154 similar to sp|P53550 Saccharomyces
           cerevisiae YNL118c PSU1 suppressor protein of a yeast
           pet mutant, start by similarity
          Length = 968

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 415 DLGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLP 460
           D GNTQ  +++ PG    N  F     D  S G+   SH DDD LP
Sbjct: 482 DSGNTQHGNNNSPGVFASNKHF-----DNNSNGA--SSHSDDDNLP 520

>AFR367W [3559] [Homologous to ScYEL047C - SH; ScYJR051W (OSM1) -
           SH] complement(1101019..1102530) [1512 bp, 503 aa]
          Length = 503

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 12  VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRR--------YD 63
           VVVVG G+AGL   A+L   G+   ++++  +  GG  ++  S +             YD
Sbjct: 46  VVVVGLGLAGLSTGAQLVKNGV-PVILMDKASAIGGNSVKASSGINGAGTQVQELLGVYD 104

Query: 64  LGASWHHDTLSN 75
              S++ DT+++
Sbjct: 105 SADSFYRDTVAS 116

>Scas_608.10
          Length = 487

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 12 VVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          VVV+G+G+AGL  + +L +      V++E  A  GG  ++  S +
Sbjct: 22 VVVIGSGLAGLATSNQLVNKYQIPIVLVEKEASLGGNSIKASSGI 66

>AER383W [2884] [Homologous to ScYDR262W - SH]
           complement(1357717..1358469) [753 bp, 250 aa]
          Length = 250

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 109 LDGDFGLMLEALQREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPG 168
           LD D  L+ + +QR     +EE+ +  L  RD+          ++  GV  DD++Q LP 
Sbjct: 49  LDFDEILLRDTMQRNAA--MEEEDYRELGKRDIEV-------AFQNTGVTLDDRLQSLPA 99

Query: 169 TVRFREFWHAID 180
              F  +   ID
Sbjct: 100 ISLFGRYVRDID 111

>CAGL0L01177g complement(134729..136126) highly similar to
          sp|P32614 Saccharomyces cerevisiae YEL047c FRDS1
          soluble fumarate reductase, hypothetical start
          Length = 465

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 13 VVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSV 56
          V+VG G+AGL  A +L   G    ++L+     GG   +  S +
Sbjct: 4  VIVGTGLAGLTCANQLLELGKSPVILLDKTGTIGGNSTKASSGI 47

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,934,775
Number of extensions: 664070
Number of successful extensions: 1596
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1596
Number of HSP's successfully gapped: 38
Length of query: 510
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 404
Effective length of database: 12,926,601
Effective search space: 5222346804
Effective search space used: 5222346804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)