Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR055C67866523870.0
Kwal_26.81765921246033e-69
Scas_106.14231075834e-68
YMR016C (SOK2)7851075687e-63
KLLA0F04840g6361085608e-63
Scas_709.527251085455e-60
CAGL0L01771g4351065232e-59
YKL043W (PHD1)3661065112e-58
Scas_625.85211075204e-58
CAGL0M07634g2571043822e-41
Scas_510.21043801203e-06
KLLA0E05357g754771185e-06
YDL056W (MBP1)833771151e-05
Kwal_27.10756922831062e-04
AGL297C970831052e-04
YER111C (SWI4)1093801052e-04
CAGL0D01012g802771033e-04
AFR600C815771024e-04
Scas_683.3782077998e-04
Sklu_2055.374377998e-04
Kwal_26.935974277970.002
Sklu_1824.2179150900.003
KLLA0E20867g93390920.006
CAGL0A04565g104178910.008
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR055C
         (665 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   924   0.0  
Kwal_26.8176                                                          236   3e-69
Scas_106.1                                                            229   4e-68
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   223   7e-63
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   220   8e-63
Scas_709.52                                                           214   5e-60
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   206   2e-59
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   201   2e-58
Scas_625.8                                                            204   4e-58
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   151   2e-41
Scas_510.2                                                             51   3e-06
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    50   5e-06
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    49   1e-05
Kwal_27.10756                                                          45   2e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    45   2e-04
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    45   2e-04
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    44   3e-04
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    44   4e-04
Scas_683.37                                                            43   8e-04
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            43   8e-04
Kwal_26.9359                                                           42   0.002
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         39   0.003
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    40   0.006
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    40   0.008

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/665 (73%), Positives = 489/665 (73%)

Query: 1   MSYYGDWYHYYPQSQQQDGHSTQSEXXXXXXXXXXXXXSNMVSAQQPPQPAFGGLFGQHQ 60
           MSYYGDWYHYYPQSQQQDGHSTQSE             SNMVSAQQPPQPAFGGLFGQHQ
Sbjct: 1   MSYYGDWYHYYPQSQQQDGHSTQSEQQAPLPGPLPPQQSNMVSAQQPPQPAFGGLFGQHQ 60

Query: 61  SHNGRRPPGEPQKAQASAAXXXXXXXXXXXXXXXXXXXFFXXXXXXXXXXXXXXRREEGP 120
           SHNGRRPPGEPQKAQASAA                   FF              RREEGP
Sbjct: 61  SHNGRRPPGEPQKAQASAAGPGVYCYYYPQQPYSGYSPFFGGTQGGGPAKVGGGRREEGP 120

Query: 121 FRHGGCPAPTAYQYPGFQPATYGDPSGAARYAGYAQEQRAAAHQTPAFTXXXXXXXXXXX 180
           FRHGGCPAPTAYQYPGFQPATYGDPSGAARYAGYAQEQRAAAHQTPAFT           
Sbjct: 121 FRHGGCPAPTAYQYPGFQPATYGDPSGAARYAGYAQEQRAAAHQTPAFTQHQQHEKPQQQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGXXXXXXXXXXXXXXXXXXXXXXXXXSLQ 240
                                         GG                         SLQ
Sbjct: 181 PQPQQHQHQNQHQHQQRAAVPAAAAYMRQVGGPEALPATAATAASTATTTPVPTTNTSLQ 240

Query: 241 SNSPGATKNPFVEPVPSIIPQNSXXXXXXXXXXXXXXXSPASTPATVKKNKAGEGSLLAI 300
           SNSPGATKNPFVEPVPSIIPQNS               SPASTPATVKKNKAGEGSLLAI
Sbjct: 241 SNSPGATKNPFVEPVPSIIPQNSVGAGLGLGGTRVGDGSPASTPATVKKNKAGEGSLLAI 300

Query: 301 ATGSHGNTXXXXXXXXXXXXXXXXXXXXPRVTTTMWEDEHTLCYQVEANGVSVVRRADND 360
           ATGSHGNT                    PRVTTTMWEDEHTLCYQVEANGVSVVRRADND
Sbjct: 301 ATGSHGNTAKAASVADSGSSSSGFESQGPRVTTTMWEDEHTLCYQVEANGVSVVRRADND 360

Query: 361 MINGTKLLNVAKMTRGRRDGILKAEKVRHVVKIGSMHLKGVWIPFERALALAQREKIVDM 420
           MINGTKLLNVAKMTRGRRDGILKAEKVRHVVKIGSMHLKGVWIPFERALALAQREKIVDM
Sbjct: 361 MINGTKLLNVAKMTRGRRDGILKAEKVRHVVKIGSMHLKGVWIPFERALALAQREKIVDM 420

Query: 421 LFPLFVRDIQSVIQQTSTTSGPAENGAKLGKLIQATGAPSRNXXXXXXXXXXXXXXAAAS 480
           LFPLFVRDIQSVIQQTSTTSGPAENGAKLGKLIQATGAPSRN              AAAS
Sbjct: 421 LFPLFVRDIQSVIQQTSTTSGPAENGAKLGKLIQATGAPSRNGPPPPYGQQDQQHGAAAS 480

Query: 481 MSVPSQPRRASAVAASSLPQQTXXXXXXXXXXXXXXXGRTGYLPQPISYANYDTGGSALS 540
           MSVPSQPRRASAVAASSLPQQT               GRTGYLPQPISYANYDTGGSALS
Sbjct: 481 MSVPSQPRRASAVAASSLPQQTPYLVSSYPSSSQPYYGRTGYLPQPISYANYDTGGSALS 540

Query: 541 NYGYSPAGSTSTGTARRPPRSQSPFQALTQVSALAQKQLNSKDQQLLPVGPIAALSSGTP 600
           NYGYSPAGSTSTGTARRPPRSQSPFQALTQVSALAQKQLNSKDQQLLPVGPIAALSSGTP
Sbjct: 541 NYGYSPAGSTSTGTARRPPRSQSPFQALTQVSALAQKQLNSKDQQLLPVGPIAALSSGTP 600

Query: 601 ALGQQHFQRREHMQNSLGRSTSDEGHANMLPPPQALIQRDHTVPQGHPHLLSKFTPIATL 660
           ALGQQHFQRREHMQNSLGRSTSDEGHANMLPPPQALIQRDHTVPQGHPHLLSKFTPIATL
Sbjct: 601 ALGQQHFQRREHMQNSLGRSTSDEGHANMLPPPQALIQRDHTVPQGHPHLLSKFTPIATL 660

Query: 661 SSTVA 665
           SSTVA
Sbjct: 661 SSTVA 665

>Kwal_26.8176
          Length = 592

 Score =  236 bits (603), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (93%), Gaps = 2/124 (1%)

Query: 331 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV 390
           VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK+RHV
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 391 VKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTSTT--SGPAENGAK 448
           VKIGSMHLKGVWIPF+RALA+AQREKIVD+LFPLFVRDIQSVIQQ ++T   GPA +GA 
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGAT 336

Query: 449 LGKL 452
            G +
Sbjct: 337 AGGM 340

>Scas_106.1
          Length = 423

 Score =  229 bits (583), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 104/107 (97%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PRVTTTMWEDE TLCYQVEA GVSVVRRADNDMINGTKLLNV KMTRGRRDGILKAEK+R
Sbjct: 154 PRVTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKIR 213

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQ 435
           HVVKIGSMHLKGVWIPF+RALA+AQREKIVD+LFPLFVRDIQSVIQQ
Sbjct: 214 HVVKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQ 260

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  223 bits (568), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 95/107 (88%), Positives = 103/107 (96%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PRVTTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNV KMTRGRRDGILKAEK+R
Sbjct: 413 PRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIR 472

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQ 435
           HVVKIGSMHLKGVWIPFERALA+AQREKI D L+PLF+RDIQSV++Q
Sbjct: 473 HVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQ 519

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  220 bits (560), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 96/108 (88%), Positives = 104/108 (96%)

Query: 330 RVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRH 389
           +VTTTMWEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV +MTRGRRDGILKAEK+RH
Sbjct: 364 KVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRH 423

Query: 390 VVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTS 437
           VVKIGSMHLKGVWIPFERAL +AQREKIVD+L+ LFVRDIQS+IQQ S
Sbjct: 424 VVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQES 471

>Scas_709.52
          Length = 725

 Score =  214 bits (545), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PRVTTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNV KMTRGRRDGILK+EK+R
Sbjct: 384 PRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIR 443

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQT 436
           HVVKIGSMHLKGVW+PFERA  +A RE I+D+L+PLFVRDI+SV++QT
Sbjct: 444 HVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQT 491

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  206 bits (523), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PR+ TT+WEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV KMTRG+RDGIL++EK R
Sbjct: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQ 434
            VVKIGSMHLKGVWIPFERAL +A+REKIVD+L+PLFVRDI SV++
Sbjct: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  201 bits (511), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PRV TTMWEDE+T+CYQVEANG+SVVRRADN+MINGTKLLNV KMTRGRRDGIL++EKVR
Sbjct: 185 PRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR 244

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQ 434
            VVKIGSMHLKGVWIPFERA  LAQRE+I+D L+PLFV+DI+S++ 
Sbjct: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVD 290

>Scas_625.8
          Length = 521

 Score =  204 bits (520), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (92%)

Query: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388
           PRV TTMWEDE TLCYQVE NGV+VVRRADNDMINGTKLLNV KMTRGRRDGIL+AEKVR
Sbjct: 208 PRVITTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVR 267

Query: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQ 435
            V+KIGSMHLKGVWIPF+RAL +A+REKIVD+L+PLFV+DI S++ Q
Sbjct: 268 SVIKIGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSILSQ 314

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  151 bits (382), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (77%)

Query: 330 RVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRH 389
           RV TT WEDEHT+C+ V  NGV+VVRRADNDM+NGTKLLNV  MTRGRRDGILK E VR 
Sbjct: 121 RVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRD 180

Query: 390 VVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVI 433
           VVK G M LKGVWIP +RA A+A++E I   L+PLF+ D+   I
Sbjct: 181 VVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAI 224

>Scas_510.2
          Length = 1043

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK---VRHVVKIGSMHLK 399
           CY        V+RR  +D IN T++  +A  ++  R  +L+ E    +   V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 400 GVWIPFERALALAQREKIVD 419
           G WIP E AL L Q+ KI D
Sbjct: 124 GTWIPLESALMLVQKYKIND 143

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R  ++ +N T +L  AK  + +R  IL+ E +      V+ G    +G WIP E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 409 LALAQREKIVDMLFPLF 425
             LA++ +++D L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R  +D +N T +L  A   + +R  IL+ E ++     V+ G    +G W+P   A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 409 LALAQREKIVDMLFPLF 425
             LA++  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>Kwal_27.10756
          Length = 922

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK--VRH-VVKIGSMHLK 399
           CY        V+RR  +D +N T++  +A  ++ +R  IL+ E   V+H  ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 400 GVWIPFERALALAQREKIVDMLF 422
           G WIP E A  L Q+  + D++ 
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVVV 128

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KVRH-VVKIGSMHLK 399
           CY        V+RR  +D +N T++  VA  ++ +R  IL+ E   + H  ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 400 GVWIPFERALALAQREKIVDMLF 422
           G WIP + A  L  + +I D++ 
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIVV 115

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KVRH-VVKIGSMHLK 399
           CY        V+RR  +D IN T++  +A+ ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 50  CYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQ 109

Query: 400 GVWIPFERALALAQREKIVD 419
           G WIP + A  L  + +I+D
Sbjct: 110 GTWIPLDSAKFLVNKYEIID 129

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R ++  +N T +L  A   + +R  IL+ E ++ +   V+ G    +G W+P   A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 409 LALAQREKIVDMLFPLF 425
           + LA++  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R  +D +N T +L  AK  + +R  IL+ E ++     V+ G    +G W+P + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 409 LALAQREKIVDMLFPLF 425
             LAQ+ ++++ L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>Scas_683.37
          Length = 820

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE---KVRHVVKIGSMHLKGVWIPFERA 408
           SV++R  +D +N T +L  A   + +R  IL  E   +    V+ G    +G W+P E A
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKVQGGFGKYQGTWVPLEIA 83

Query: 409 LALAQREKIVDMLFPLF 425
             LA +  + + L  LF
Sbjct: 84  TELAMKFDVYEELRALF 100

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R  +D +N T +L  AK  + +R  IL+ E ++ +   V+ G    +G W+P + A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 409 LALAQREKIVDMLFPLF 425
             LA +  +++ L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>Kwal_26.9359
          Length = 742

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 352 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHV---VKIGSMHLKGVWIPFERA 408
           S+++R ++D +N T +L  AK  + +R  IL+ E ++     V+ G    +G W+P + A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 409 LALAQREKIVDMLFPLF 425
             LA + +++  L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 39.3 bits (90), Expect = 0.003,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK--VRH-VVKIGSMHLK 399
           CY        V+RR  ++ +N T++  +A  ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 400 GVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTSTTSGPAENGAKLGKLIQATG-- 457
           G WIP E A  L  + K+ D++    V+ I S I   S         + + KL  AT   
Sbjct: 88  GTWIPLENARYLVSKYKVDDII----VKTILSFIPDPSNLPPRRSKNSVIKKLSPATKIT 143

Query: 458 APSRNXXXXXXXXXXXXXXAAASMSVPSQP 487
           +PS                  A +S  +QP
Sbjct: 144 SPSSYNKTPKKSSTAKKPKKRAVVSKRTQP 173

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KVRH-VVKIGSMHLK 399
           CY  +     ++RR +++ +N T++      T+ +R  IL+ E  +++H  ++ G    +
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQ 168

Query: 400 GVWIPFERALALAQREKIVDMLFPLFVRDI 429
           G WIP+E    L ++  I + +    V  I
Sbjct: 169 GTWIPWESTKYLVEKYNINNKVVKRIVEFI 198

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 343 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KVRH-VVKIGSMHLK 399
           CY        V+RR  +D +N T++  +A+ ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 52  CYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQGGYGRFQ 111

Query: 400 GVWIPFERALALAQREKI 417
           G W+P E A  +  +  I
Sbjct: 112 GTWVPLEAAKFMTTKYNI 129

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.127    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,581,932
Number of extensions: 515826
Number of successful extensions: 1100
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1122
Number of HSP's successfully gapped: 32
Length of query: 665
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 557
Effective length of database: 12,857,365
Effective search space: 7161552305
Effective search space used: 7161552305
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)