Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR054C31429810181e-139
Kwal_26.81903242543849e-44
KLLA0F04862g3162122747e-28
CAGL0L01793g3592902134e-19
Scas_711.453352641702e-13
YKL042W (SPC42)3631111675e-13
Scas_625.7d302991275e-08
KLLA0A09405g26934652.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR054C
         (308 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...   396   e-139
Kwal_26.8190                                                          152   9e-44
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...   110   7e-28
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...    87   4e-19
Scas_711.45                                                            70   2e-13
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...    69   5e-13
Scas_625.7d                                                            54   5e-08
KLLA0A09405g complement(820161..820970) no similarity, hypotheti...    30   2.6  

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score =  396 bits (1018), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 212/298 (71%)

Query: 1   MNISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLIK 60
           MNISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLIK
Sbjct: 1   MNISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLIK 60

Query: 61  QNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLXXXXXXXXXXXXXXXXXXXX 120
           QNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL                    
Sbjct: 61  QNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLQAQAQAARVPSPPEPAAEPA 120

Query: 121 XDYLQLPRRAPAAENDKKIGELYDKLEQLTKVVHQQHLHDXXXXXXXXXXXXXXXXXXTA 180
            DYLQLPRRAPAAENDKKIGELYDKLEQLTKVVHQQHLHD                  TA
Sbjct: 121 ADYLQLPRRAPAAENDKKIGELYDKLEQLTKVVHQQHLHDPPAPARPRSPARSRSPARTA 180

Query: 181 VXXXXXXXXXXXXLKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGVXXXXXX 240
           V            LKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGV      
Sbjct: 181 VSDDDIMISESSELKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGVSSSSPA 240

Query: 241 XXXLLFDRQXXXXXXXXXXXXXXXXXXXXXXXXXXLKKPAMDIKNALQTPTPSRTRRD 298
              LLFDRQ                          LKKPAMDIKNALQTPTPSRTRRD
Sbjct: 241 SSALLFDRQPSPTSAASSAPLAHAHCEQCHHAEDALKKPAMDIKNALQTPTPSRTRRD 298

>Kwal_26.8190
          Length = 324

 Score =  152 bits (384), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 135/254 (53%), Gaps = 31/254 (12%)

Query: 1   MNISPTPKRYQSSNH-MPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLI 59
           MNISPTP+RY S  +  PR  +  +H     +++      +DRIVP+EY++NS MI+ LI
Sbjct: 1   MNISPTPRRYNSRGYDYPRETDEAFH----PFNQEPPMIPSDRIVPEEYRVNSQMINKLI 56

Query: 60  KQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLXXXXXXXXXXXXXXXXXXX 119
           KQNK+L  +LD K  E+++LNVLVGSLRGKLIKYTELNKKL                   
Sbjct: 57  KQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKL-------GQTSTHPPRFSP 109

Query: 120 XXDYLQL-----PR--RAPAAEN---DKKIGELYDKLEQLTKVVHQQHLHDXXXXXXXXX 169
             D LQ+     PR  R P   +   + +IG++Y KLE LT ++    L           
Sbjct: 110 DEDVLQVNKNRQPRESREPDTRDSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQR 169

Query: 170 XXXXXXXXXTAV---------XXXXXXXXXXXXLKRLEEQVDQLKRKVLIKSENELRKLS 220
                     +V                     LK LE+Q+D LKRK+LIK ENELRKLS
Sbjct: 170 DHVLRVPTSASVSHRPLHGGASEDDILTQESAELKSLEDQIDLLKRKLLIKRENELRKLS 229

Query: 221 LNQQLADLMHKLGV 234
           LN++L DLM KL V
Sbjct: 230 LNKELLDLMDKLDV 243

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score =  110 bits (274), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 110/212 (51%), Gaps = 25/212 (11%)

Query: 41  DRIVPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL 100
           +RIVP+EYK NS+MI+ LIKQNKDL  ++ EK  E+++LNVL+GS R KLIKYTELNKK+
Sbjct: 20  ERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKKM 79

Query: 101 XXXXXXXX------------------XXXXXXXXXXXXXDYLQLPRRAPAAENDKKIGEL 142
                                                  +YLQ+ +     EN  KI ++
Sbjct: 80  QRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEYLQIKKNNRHDEN--KIDDI 137

Query: 143 YDKLEQLTKVVHQQHLHDXXXXXXXXXXXXXXXXXXTAVXXXXXXXXXXXXLKRLEEQVD 202
           Y KLE LT +V     +D                    V             K+L++Q+D
Sbjct: 138 YQKLELLTNLV-----NDAIHKQNNGEQREPSNFNSRIVSDDDIIISESQEFKQLQDQID 192

Query: 203 QLKRKVLIKSENELRKLSLNQQLADLMHKLGV 234
            LKRK+LIK ENELRKLSLN++LADLM +L +
Sbjct: 193 LLKRKLLIKKENELRKLSLNKELADLMDELSM 224

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 118/290 (40%), Gaps = 56/290 (19%)

Query: 1   MNISPTPKRY----------QSSNHMPRA---------VNHNYHSAVPAYHEHAAGQN-- 39
           MNISPTPKRY          Q+   +P            N  Y    P  +++    N  
Sbjct: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60

Query: 40  ADRIVPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKK 99
            D++VP+E K+   +I+ LI QNK+L   +  +  E+E+LN+++G  R KL KY+ +N+K
Sbjct: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120

Query: 100 LXXXXXXXXXXXXX--------------XXXXXXXXDYLQLP--RRAPAAENDK--KIGE 141
           L                                   DY+Q+P  R     + DK  +  +
Sbjct: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180

Query: 142 LYDKLEQLTKVVHQQHLHDXXXXXXXXXXXXXXXXXXTAVXXXXXX-------------- 187
           L D+L QL +++ +   ++                                         
Sbjct: 181 LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSSPKIRDPSEE 240

Query: 188 ---XXXXXXLKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKLGV 234
                    LK LE Q++ +K+K+LIK ENELRKLSL  +L +LM +L  
Sbjct: 241 DILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQLST 290

>Scas_711.45
          Length = 335

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 107/264 (40%), Gaps = 38/264 (14%)

Query: 1   MNISPTPKRYQSSNHMPRAVNH---------------------NYHSAVPAYHEHAAGQN 39
           MN+SPTPKRY S    PR V                        Y      Y +H     
Sbjct: 1   MNVSPTPKRYISGTFNPRRVPEPEYNNYHHNYNNHNYQRDNLPRYDDVKRPYQDHLD--- 57

Query: 40  ADRIVPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTEL--- 96
            D ++PD+ K ++     L++ N+ L  +L+ K +E+EKL +L  SL+ KLIKYT L   
Sbjct: 58  -DALLPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTAN 116

Query: 97  -NKKLXXXXXXXXXXXXXXXXXXXXXDYLQLPRRAPAAENDKKI-------GELYDKLEQ 148
            N ++                     +      +    ++DKK+        EL +K+E+
Sbjct: 117 SNDEIEILKRRIEDLEKENKRLRRRDELFN--EKIKEEDSDKKVFTETTEDDELLEKIEK 174

Query: 149 LTKVVHQQHLHDXXXXXXXXXXXXXXXXXXTAVXXXXXXXXXXXXLKRLEEQVDQLKRKV 208
           LT ++ +                                      LK LE+QV++++ K+
Sbjct: 175 LTAMILKHKQEQRNSGTTPAKTSWKEQNSKAYPTEETLLTQESLELKSLEDQVEKIRHKL 234

Query: 209 LIKSENELRKLSLNQQLADLMHKL 232
            +K ENE RK+SLN++L  L   L
Sbjct: 235 ALKRENEQRKISLNKELLKLKSSL 258

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 65/111 (58%), Gaps = 15/111 (13%)

Query: 1   MNISPTPKRYQSSN--------HMPRAVNHNYHSAVPA---YHEHAAGQNADRIVPDEYK 49
           MN SPTPKRY S +        ++P    + Y +  P    Y++  +  NAD++VP+EYK
Sbjct: 1   MNGSPTPKRYSSKSSRLYDDYYNIP----YQYSNPTPMNRDYNDVGSRINADKLVPEEYK 56

Query: 50  INSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL 100
            N+  I+  ++QNK+L  KL EK  E+ +L  +  +LR KL KY ++ KKL
Sbjct: 57  RNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKL 107

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 32/35 (91%)

Query: 194 LKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADL 228
           LKR+EE++++LKRK+L++ +++LRKLSLN QL +L
Sbjct: 258 LKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQEL 292

>Scas_625.7d
          Length = 302

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 17/99 (17%)

Query: 2   NISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLIKQ 61
           NISPTP+RY +  +    +                 +  D ++P+E +++++ I+ LI  
Sbjct: 16  NISPTPQRYGTEKYARYGL-----------------RKTDELLPEESRLSNDAINELIDM 58

Query: 62  NKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL 100
           N+ L   L +++ EL++   L  SL+ KLIKYT LN KL
Sbjct: 59  NRQLKKTLRDREDELDRYGRLTESLQSKLIKYTNLNNKL 97

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 32/39 (82%)

Query: 194 LKRLEEQVDQLKRKVLIKSENELRKLSLNQQLADLMHKL 232
           +K LE+QV++L++K L+K ENELRK+SL+ +L +L  KL
Sbjct: 226 IKNLEDQVEELRKKTLLKQENELRKISLSNELLELATKL 264

>KLLA0A09405g complement(820161..820970) no similarity, hypothetical
           start
          Length = 269

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 22  HNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMI 55
           HNY+S+ P  H+    QNA ++ P    IN++M+
Sbjct: 126 HNYYSSSPVRHQPPEQQNAPQLPPRADNINTSML 159

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,438,342
Number of extensions: 243601
Number of successful extensions: 1297
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1287
Number of HSP's successfully gapped: 29
Length of query: 308
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 207
Effective length of database: 13,099,691
Effective search space: 2711636037
Effective search space used: 2711636037
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 61 (28.1 bits)