Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR052W50950020510.0
Sklu_2168.34794248141e-103
Kwal_26.81704935087526e-94
KLLA0D11220g4775075276e-61
Scas_709.544702254401e-48
YMR014W (BUD22)5194494255e-46
CAGL0M07678g4732412473e-22
Kwal_47.1732437246664.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR052W
         (500 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   794   0.0  
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           318   e-103
Kwal_26.8170                                                          294   6e-94
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   207   6e-61
Scas_709.54                                                           174   1e-48
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   168   5e-46
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...   100   3e-22
Kwal_47.17324                                                          30   4.2  

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/500 (80%), Positives = 403/500 (80%)

Query: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60
           MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA
Sbjct: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60

Query: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120
           DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG
Sbjct: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120

Query: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180
           VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG
Sbjct: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180

Query: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVX 240
           RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAV 
Sbjct: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPSVDEDALVSQYAGMLAASD 300
                                                 RSPSVDEDALVSQYAGMLAASD
Sbjct: 241 ARSAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSPSVDEDALVSQYAGMLAASD 300

Query: 301 EEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQXXXXXXXXXXXXXXXLKKQKTSKTKV 360
           EEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQ               LKKQKTSKTKV
Sbjct: 301 EEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDSSDSDSSAPPLKKQKTSKTKV 360

Query: 361 QLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHIQ 420
           QLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHIQ
Sbjct: 361 QLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHIQ 420

Query: 421 QQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRPAFKDSAIRXXXXXXXXXXXXXVAQ 480
           QQF                              TRPAFKDSAIR             VAQ
Sbjct: 421 QQFEKEREERARKQREYEERAAKRPAKEAELARTRPAFKDSAIRAAEPGAAKSAAKPVAQ 480

Query: 481 ELHPSWEAKKLSQEKQKAAK 500
           ELHPSWEAKKLSQEKQKAAK
Sbjct: 481 ELHPSWEAKKLSQEKQKAAK 500

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/424 (40%), Positives = 242/424 (57%), Gaps = 29/424 (6%)

Query: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60
           MP  K NL++KLD+ EYQYH LNNT+ +F PRL +T K ++ +GKK ++++ KLL+  T 
Sbjct: 1   MP--KENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATL 58

Query: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120
           D + QQ+  L+   L+ KV+H++ +L   L K L+ Q   L K  ++ E     L+ LE 
Sbjct: 59  DSVSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALED 118

Query: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180
           ++    F +F +LI +SK+V++V+ KI PTK LK +PP WF++  IL  + +KEDECNP 
Sbjct: 119 IKSDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPS 178

Query: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVX 240
            VW +VV  + G E+L+S ++++K  ++L+ + +  +D+ LG  +E++  +   E     
Sbjct: 179 NVWNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVE----- 233

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPSVDEDALVSQYAGMLAASD 300
                                                    + DE+ALV QY GMLA SD
Sbjct: 234 ---------ANKKSSNALDDDSGEDFTDDGVSDREDDAEFSTADEEALVQQYKGMLAGSD 284

Query: 301 EED--DDPDGYHLDPNVDYNEVTDEEPDQSADETIQXXXXXXXXXXXXXXXLKKQKTSKT 358
           EED  D+  GYHLDPNVDYNEVTDEEP  +                        +K  K 
Sbjct: 285 EEDDADEQQGYHLDPNVDYNEVTDEEPTDN----------ESELEEEEKLEEPPKKKQKN 334

Query: 359 KVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKH 418
           K QLP LMAGY+SG  D + E+ D   K +    PKRKNRRGQRARQKIWEKKYG+NAKH
Sbjct: 335 KAQLPELMAGYFSGGSDDEIED-DRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKH 393

Query: 419 IQQQ 422
           +Q+Q
Sbjct: 394 VQRQ 397

>Kwal_26.8170
          Length = 493

 Score =  294 bits (752), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 265/508 (52%), Gaps = 31/508 (6%)

Query: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60
           MP  K NL++KLD+ EYQYH LNN++  F PRL  TAK +N +GKKA++R++KLL     
Sbjct: 1   MP--KENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNL 58

Query: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120
             + + + SL+ E+++ K +H+E+KL+ LL K L+ Q + L KN   +E+   +L+ L  
Sbjct: 59  TEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKN--SNEKNKDRLKTLAT 116

Query: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180
           +++      F +LI + +  K+++ K+  TKAL+ DPP W +++  +  F +K +  NPG
Sbjct: 117 LEKSYTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPG 176

Query: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVX 240
           +VW EV+ A  G E+L+S  ++ K  ++LL+  ++++DL +  KKER  + +   + +  
Sbjct: 177 KVWNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQS-- 234

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPSVDEDALVSQYAGMLAASD 300
                                                  S  +DED ++ QY GML ASD
Sbjct: 235 ----KPSRAVPETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYEGMLVASD 290

Query: 301 EEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQXXXXXXXXXXXXXXXLKKQK------ 354
           EE +D     L+P+++YNEVTDEEP +S +++                 LKKQK      
Sbjct: 291 EEGEDLTMPSLNPDINYNEVTDEEPSESENDS----DISLSDGEEDVPPLKKQKRSQERE 346

Query: 355 --TSKTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKY 412
              SK K  LP LM GYYSG  D +  E ++A K    E PKRKNRRGQRARQKIWEKKY
Sbjct: 347 DDQSKVKTNLPELMTGYYSGGSDDEISEDEVAAKQASNE-PKRKNRRGQRARQKIWEKKY 405

Query: 413 GRNAKHIQQQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRPAFKDSAIRXXXXXXXX 472
           G NAKH+Q+Q                                    +++  R        
Sbjct: 406 GHNAKHVQRQVEAEKSERERKKQEYEARVAKRAARAQD--------REATTRKRPSDPKT 457

Query: 473 XXXXXVAQELHPSWEAKKLSQEKQKAAK 500
                    +HPSWEAKK+++EKQK AK
Sbjct: 458 WEAPAKDAPIHPSWEAKKMAEEKQKGAK 485

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  207 bits (527), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 225/507 (44%), Gaps = 48/507 (9%)

Query: 3   LNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTADG 62
           + K NL++KLD+ EYQ H +NN   +F PR   T +++N + +K  ++V KLL       
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 63  LLQQISSLKAELLDHKVHHVESKL-SHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEGV 121
           +  +ISSL+ ++LD K+HHV  +L +H +            KNP         L + E  
Sbjct: 61  INGEISSLRLKILDQKIHHVLQRLQTHWI------------KNP---------LILREPE 99

Query: 122 QRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPGR 181
               G EQF++ +  SK+VK+ +  +   K      P WF+ H   Q   +K +E NP R
Sbjct: 100 VAKIGAEQFIKYMSYSKLVKLTMSLMGGNKTC----PEWFREHEFYQISNDKTNELNPSR 155

Query: 182 VWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKERRQNSDAAEKTAVXX 241
           ++  V  +      LVS+LL+ K  +DL+   E  + ++L  K + ++++  A       
Sbjct: 156 IYNGVF-SKNKLNSLVSKLLNNKNVKDLIQTYENGIHVILNEKDKIQKDTTTASTKQSKT 214

Query: 242 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPSVD---EDALVSQYAGMLAA 298
                                                 +P +D   E+ L  QY G+L  
Sbjct: 215 KSEDTSTDKNIDGVSKTEKGATESESESDLLEENSEREAPELDSETEELLSKQYDGLLVG 274

Query: 299 SDEEDDDPDGYHLDPNVDYNEVTDEEPDQ--SADETIQXXXXXXXXXXXXXXXLKKQKTS 356
           SDEE  +P+ + LDP +DYN+VTDEE  +  SADE  +                      
Sbjct: 275 SDEE-SEPE-FQLDPTIDYNQVTDEEDKEEYSADEDDEENSDSDSGEPS---------NK 323

Query: 357 KTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNA 416
           K K  LP LM GY SGD++ D +  D   + +    P +KNRRGQRARQKIWEKKYG  A
Sbjct: 324 KPKYNLPELMNGYISGDEEEDLD--DKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQA 381

Query: 417 KHIQQQFXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXTRPAFKDSAIRXXXXXXXXX 473
           KH+Q+Q                                   R +  +S            
Sbjct: 382 KHVQRQLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTSNIPPPPQ 441

Query: 474 XXXXVAQELHPSWEAKKLSQEKQKAAK 500
                 + +HPSWEAK++++EKQK  K
Sbjct: 442 PVITADKPIHPSWEAKRIAEEKQKNVK 468

>Scas_709.54
          Length = 470

 Score =  174 bits (440), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 131/225 (58%), Gaps = 10/225 (4%)

Query: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60
           MP  K NL++KLD+ EYQ H LNNT+  F PRL  T K+YN +G+K  ++VEKLL  +  
Sbjct: 1   MP--KDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKI 58

Query: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120
           + + +Q++ +K E+ D K+HH E+ L+  L+K LEN+ + L KN  K          LE 
Sbjct: 59  EDVERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDK--------TTLEA 110

Query: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180
           ++   G  QF +L+  SK +K+  GKI P      D P WF  H   + + +K +E NP 
Sbjct: 111 IKNQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPS 170

Query: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKK 225
           R+W EV+  +   + LVS +++ K  +D++ + E  +D+ LG  K
Sbjct: 171 RIWNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINK 215

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 81/134 (60%), Gaps = 20/134 (14%)

Query: 289 VSQYAGMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQXXXXXXXXXXXXXX 348
           ++QY GMLAASD+E+ + +   LD  ++YNEVTDEEP    D                  
Sbjct: 272 LNQYEGMLAASDDEEGE-EASGLDKTINYNEVTDEEPSDDEDSE---------------- 314

Query: 349 XLKKQKTSKTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIW 408
               ++ S+ K +LP LM GYYSG + SD E+ D   + +    P+RKNRRGQRAR+KIW
Sbjct: 315 ---SEEPSRKKPKLPELMGGYYSGGESSDDEKEDKIAREQMSNKPQRKNRRGQRARRKIW 371

Query: 409 EKKYGRNAKHIQQQ 422
           EKKYG  AKH+Q++
Sbjct: 372 EKKYGSQAKHVQRE 385

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  168 bits (425), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 136/449 (30%), Positives = 213/449 (47%), Gaps = 40/449 (8%)

Query: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60
           MP      +YKLD  EYQYH L  ++ +F PR   TAK YN  GKK  +++EKLL  L  
Sbjct: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLEL 60

Query: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKK--DEQRNSK--LQ 116
             L +++    ++LL++K+H+ E+ LS  + +Q++    + +KN  K  D Q+N    + 
Sbjct: 61  KTLDKELDESYSKLLNNKIHYYETHLSKCIKEQIQ---KISKKNSSKVKDAQKNKSPSID 117

Query: 117 VLEGVQRGPGFEQFVRLIVRSKVVKIVLGKIC-PTKALKNDP--PAWFQNHRILQQFGNK 173
           + + +      +     + R +++KI+  +I   +K ++ D     W  N+       +K
Sbjct: 118 IEKMLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDK 177

Query: 174 EDECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLG--TKKERRQNS 231
             + NP  +W EV+  +   E+L + +  +K  ++L  + + S+ L+ G      + +  
Sbjct: 178 TSKWNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKY 237

Query: 232 DAAEKTAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPSVDEDALVSQ 291
            A EKTA                                         + S +ED L+ +
Sbjct: 238 GAREKTA---NANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKE 294

Query: 292 YAGMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQ-SADETIQXXXXXXXXXXXXXXXL 350
           Y GML +S +E     G +L+PN++YNEVTDEEP + S+DE                   
Sbjct: 295 YEGMLGSSGDEG--EGGGYLNPNINYNEVTDEEPSEASSDE--DDSDERFSDSEENEPRR 350

Query: 351 KKQKTSKTKVQLPALMAGYYSGDD---DSDAEE-------------HDLAGKAEPLEPPK 394
           KK K       LP LMAGYYSG+D   +SD +               D   + +    PK
Sbjct: 351 KKPKLH----NLPELMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPK 406

Query: 395 RKNRRGQRARQKIWEKKYGRNAKHIQQQF 423
           RKNRRGQRAR+KIWEKKYG  AKH+Q++ 
Sbjct: 407 RKNRRGQRARRKIWEKKYGSQAKHVQREL 435

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 126/241 (52%), Gaps = 25/241 (10%)

Query: 3   LNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTADG 62
           ++K NL+ KLD  EYQ+H L  T  +F PR   T +++N +GKK  ++V K+L     + 
Sbjct: 1   MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKNNKKVTKILESSDKEK 60

Query: 63  LLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQ-VLEGV 121
           +   +  ++ E+L+ K+H+VE  +++ L K +++  +    N K      S  Q VLE V
Sbjct: 61  VRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVS----NDK------SVFQPVLEAV 110

Query: 122 QR-----GPGFEQFVRLIVRSKVVKIVLGKICPTK---ALKNDP------PAWFQNHRIL 167
           +        G   F  ++ +SK +K ++ K+  +    A  N+       P W  +H  +
Sbjct: 111 EAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKWAADHEYV 170

Query: 168 QQFGNKEDECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKER 227
           + + +K ++ NP +VW E V  +   + L+S++++ K  + ++   + S+DL L   K++
Sbjct: 171 KMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDLFLNINKQK 230

Query: 228 R 228
           R
Sbjct: 231 R 231

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 64/136 (47%), Gaps = 6/136 (4%)

Query: 365 LMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNAKHIQQQFX 424
           LM GY SG  D + E  D+A +   ++P K KNRRGQRAR+KIWE+KYG  AKH+Q++  
Sbjct: 335 LMVGYVSGGSDEEIEVDDIAKEQIEIKPQK-KNRRGQRARRKIWEQKYGSKAKHVQREIE 393

Query: 425 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRPAFKDSAIRXXXXXXXXXXXXXVAQELHP 484
                                         +   K + I+                E HP
Sbjct: 394 KEMEKKRKRQAEYEERVAKRAARAEQNEEYQA--KKAEIKREKEEHRKKLEKI---EDHP 448

Query: 485 SWEAKKLSQEKQKAAK 500
           SW AKK++++K+K AK
Sbjct: 449 SWVAKKMAEDKEKNAK 464

>Kwal_47.17324
          Length = 372

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 4/46 (8%)

Query: 351 KKQKTSKTKVQLPALMAGYYSGDDDSDAEEH---DLAGKAEPLEPP 393
           K+QK+S  K QL A+++      D SD+E+H   D++GK + +EPP
Sbjct: 153 KQQKSSPIKRQL-AIISDSEGDIDWSDSEDHAAHDVSGKKQRIEPP 197

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,541,776
Number of extensions: 519433
Number of successful extensions: 2221
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2233
Number of HSP's successfully gapped: 44
Length of query: 500
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 394
Effective length of database: 12,926,601
Effective search space: 5093080794
Effective search space used: 5093080794
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)