Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR051C48447520310.0
Sklu_2168.25003939231e-119
Kwal_26.81645003938581e-110
Scas_709.555193978291e-105
KLLA0D11198g5153227272e-90
YMR013C (SEC59)5194047161e-88
CAGL0M07700g4873206941e-85
Sklu_2266.5285153740.44
ADL222W516194740.48
CAGL0I09812g28166720.79
Scas_665.1129670673.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR051C
         (475 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   786   0.0  
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        360   e-119
Kwal_26.8164                                                          335   e-110
Scas_709.55                                                           323   e-105
KLLA0D11198g complement(954239..955786) some similarities with s...   284   2e-90
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   280   1e-88
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   271   1e-85
Sklu_2266.5 YOR311C, Contig c2266 9409-10266                           33   0.44 
ADL222W [1519] [Homologous to ScYIL097W (FYV10) - SH] complement...    33   0.48 
CAGL0I09812g complement(936925..937770) highly similar to tr|Q12...    32   0.79 
Scas_665.11                                                            30   3.3  

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/475 (84%), Positives = 403/475 (84%)

Query: 1   MMAVKTANAEQAVKAEEQADTGAVPLGGKXXXXXXXXXXXXXXXXXFGKDEAGRXXXXXX 60
           MMAVKTANAEQAVKAEEQADTGAVPLGGK                 FGKDEAGR      
Sbjct: 1   MMAVKTANAEQAVKAEEQADTGAVPLGGKAVQAVVLAVTVHLAAEVFGKDEAGRAAFYSA 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXYVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVL 120
                                 YVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVL
Sbjct: 61  LSVAAAYGAAAAAGRVPAFNAVYVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVL 120

Query: 121 QQLTILYLQXXXXXXXXXXXXXXXXXXXXXXXXXXXWSELRSLDMVDCGLLSILLTNVLF 180
           QQLTILYLQ                           WSELRSLDMVDCGLLSILLTNVLF
Sbjct: 121 QQLTILYLQPAARGRGFPGRGGVGGAPGGVVGRWRGWSELRSLDMVDCGLLSILLTNVLF 180

Query: 181 VIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILA 240
           VIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILA
Sbjct: 181 VIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILA 240

Query: 241 FLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHF 300
           FLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHF
Sbjct: 241 FLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHF 300

Query: 301 ALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQ 360
           ALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQ
Sbjct: 301 ALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQ 360

Query: 361 GPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTL 420
           GPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTL
Sbjct: 361 GPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTL 420

Query: 421 AFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILEGNSDLNDNILIPSFML 475
           AFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILEGNSDLNDNILIPSFML
Sbjct: 421 AFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILEGNSDLNDNILIPSFML 475

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 270/393 (68%), Gaps = 3/393 (0%)

Query: 83  YVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVLQQLTILYLQXXXXXXXXXXXXX 142
           Y++YLP M+SLLF R LV VN AMA     +PV L++  QL  + +              
Sbjct: 104 YLLYLPFMLSLLFARRLVLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKA 163

Query: 143 XXXXXXXXXXXXXXWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLV 202
                          S+L+SLD VDC L SILLTNVL++I   + V FQIL+  LYGF+V
Sbjct: 164 IAINVALCYVLEKI-SDLKSLDHVDCNLFSILLTNVLYLIDSPT-VHFQILQKVLYGFIV 221

Query: 203 AVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSA 262
           AV  NY         + Y+R+ +L + F+L+FP  +   L +D     L WL +YIFSS 
Sbjct: 222 AVSVNYALSFPLRYASTYLRSLILFSSFSLIFPLTVTRILTID-RKKPLTWLYEYIFSSD 280

Query: 263 LRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIA 322
            R++I+  WL+ L VLIP+V + KS+ SLNTSRKIWHF +L LL+  + ++PEF  V+++
Sbjct: 281 TRIKIIFIWLLCLLVLIPNVMIFKSNFSLNTSRKIWHFLILFLLIPPLQLDPEFVKVSLS 340

Query: 323 GTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINR 382
           GTVV+FL+VEY RY+ L P G +++ +LR+F+DFRD++GPII+SY+YLI+GVS P+LIN 
Sbjct: 341 GTVVLFLVVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGPIIISYIYLIIGVSAPILING 400

Query: 383 SLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEG 442
           SLVGVISLGVGDSLASI+G ++G+  WPGTNKTVEGTL FI+A++A+ L CQ  + +F  
Sbjct: 401 SLVGVISLGVGDSLASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSP 460

Query: 443 VATRNIILACVVSGILEGNSDLNDNILIPSFML 475
           ++  N++L C+VSGILEGNS LNDNILIP FML
Sbjct: 461 ISNGNVVLTCIVSGILEGNSVLNDNILIPPFML 493

>Kwal_26.8164
          Length = 500

 Score =  335 bits (858), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/393 (46%), Positives = 266/393 (67%), Gaps = 5/393 (1%)

Query: 83  YVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVLQQLTILYLQXXXXXXXXXXXXX 142
           Y++Y+P ++SLLF R+L  VN A+A      P++LR+  Q  I  L              
Sbjct: 104 YLLYIPSLLSLLFARDLTVVNMALAFNCTDHPLILRLPLQ-AIFVLMNNDFGDKRSKNLK 162

Query: 143 XXXXXXXXXXXXXXWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLV 202
                           +L+S D V+  L SI LTNVL+++   SS+ FQ+LR  L GFL 
Sbjct: 163 AIGINCLIEFLIERIGQLKSFDRVESNLFSICLTNVLYLLES-SSLHFQVLRHVLLGFLA 221

Query: 203 AVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSA 262
           AV  N+  +    R N Y+R+A+L   F +VFP  IL   +++   N  +WL  YI S+ 
Sbjct: 222 AVAFNFPLLIITSRFNPYLRSAILSTSFFVVFPLTILYTFEVEG-QNPAIWLFDYITSND 280

Query: 263 LRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIA 322
           +R++I+AGWL  L +L+P++ + KS+ SLNTSRKIWHF +L L+      +P+F  +++A
Sbjct: 281 IRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLA 340

Query: 323 GTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINR 382
           GT+V+FL VEY R++ L P+G+ ++++LR+F DFRDE+GPII+SY+YLI+GV+ P+LIN 
Sbjct: 341 GTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPIIISYIYLIIGVATPILING 400

Query: 383 SLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFL-AFE 441
           SLVGVISLGVGDSLASI+G R+G++ WPGT+KT+EGT AFI+ S ++C +C + FL AF+
Sbjct: 401 SLVGVISLGVGDSLASIVGYRWGRHQWPGTSKTLEGTFAFIL-STSICSLCFKLFLGAFQ 459

Query: 442 GVATRNIILACVVSGILEGNSDLNDNILIPSFM 474
            + +  +ILAC++SGILEGNS LNDNILIP++M
Sbjct: 460 EITSAQVILACILSGILEGNSVLNDNILIPAYM 492

>Scas_709.55
          Length = 519

 Score =  323 bits (829), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 172/397 (43%), Positives = 258/397 (64%), Gaps = 5/397 (1%)

Query: 83  YVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVLQQLTILYLQXXXXXXXXXXXXX 142
           Y+++LP M S LF++EL   N  +AL  + +P+  ++  Q   +                
Sbjct: 116 YLLFLPFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYG 175

Query: 143 XXXXXXXXXXXXXXWSELRSLDMVDCGLLSILLTNVLFVIGGE-SSVQFQILRACLYGFL 201
                           +L+SLD++DC L SI+LTNVL++I  E  S+ FQILR  L  F 
Sbjct: 176 MLLNFSICQTLMKI-GQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFF 234

Query: 202 VAVGANYVF--VRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDN-ALVWLIKYI 258
           V V  NY+   +    ++N ++++  L ++F +VFP ++   + L+  D    +WL++Y+
Sbjct: 235 VTVAINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYV 294

Query: 259 FSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTT 318
             S+ R  I+  WL FL +LIP+V + KS+ SLNTSRKIWHF +L L+     ++P F  
Sbjct: 295 LGSSARKSILLVWLSFLLILIPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVK 354

Query: 319 VAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPL 378
           +A++GT+V+FL VEY R++ L PFG YI+++LR+F DFRD++GPII+SY+YLI+G+S PL
Sbjct: 355 IALSGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIYLIIGISTPL 414

Query: 379 LINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFL 438
           LIN S VG+ISLGVGDSLASIIG ++G+YHWPGT KT+EGTL+FI+ ++ +  + +    
Sbjct: 415 LINDSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYME 474

Query: 439 AFEGVATRNIILACVVSGILEGNSDLNDNILIPSFML 475
            F  +   N++  C +SGILEGNS+LNDNILIP++M+
Sbjct: 475 YFADITFSNLLWVCTISGILEGNSELNDNILIPTYMM 511

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  284 bits (727), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 222/322 (68%), Gaps = 8/322 (2%)

Query: 158 SELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRR 217
           S+L+SLD  +C + ++L T++L ++  +S + FQ+ + C   F+V V        +YG  
Sbjct: 190 SKLKSLDKTECHMFALLCTDILALVESDS-IYFQVFQVCFTSFIVLVTVTSAV--SYGLE 246

Query: 218 N----QYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSALRMQIMAGWLV 273
           +    +++RT +LL +  + F   I   L +++      WLI YI SS +R++IM  WL 
Sbjct: 247 SVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVP-PFTWLIDYIGSSMIRLKIMGIWLG 305

Query: 274 FLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEY 333
              +L+PSVF +KS+ SLNTSRK+WHFA+LPLL+  + ++  F  +A+AGTV +FLIVEY
Sbjct: 306 SALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEY 365

Query: 334 FRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVG 393
            R++++YP G Y++  LR+F DFRDE+GPII+SYLY I+G+S P LIN S++G+ISLGVG
Sbjct: 366 IRFLHIYPVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGISLPFLINGSIIGIISLGVG 425

Query: 394 DSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILACV 453
           DSLASIIG+++G+  WP T KT EGT AFI A+    ++ +  F  F  V+  N++L C 
Sbjct: 426 DSLASIIGKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMKVYFNFFTEVSFMNLVLVCF 485

Query: 454 VSGILEGNSDLNDNILIPSFML 475
           ++GILEGNS LNDN+LIP+FML
Sbjct: 486 LAGILEGNSTLNDNLLIPTFML 507

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  280 bits (716), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/404 (40%), Positives = 229/404 (56%), Gaps = 24/404 (5%)

Query: 83  YVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRVLQQLTILYLQXXXXXXXX----- 137
           Y +YLP MVSLLF      +N  + L  +      R   QL ++ LQ             
Sbjct: 121 YSLYLPFMVSLLFDTSSTVINTILILSVLNS---YRWRTQLVVIILQLCLIFFNFEAGDR 177

Query: 138 XXXXXXXXXXXXXXXXXXXWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACL 197
                                +L+SLD +D  L SILLTN+L+V     +V F+IL+  +
Sbjct: 178 LKNIISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYV-SEAGTVHFRILKGII 236

Query: 198 YGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWLIKY 257
                 +  NYV      ++  + +  +L   FA+  P     F+ L+D +N L+WL+KY
Sbjct: 237 LALTTIISINYVL-----KKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWLVKY 291

Query: 258 IFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFT 317
           I  S +R +I+  W   L + IPS+ + K  LSLNTSRK+WHF +  L++    ++  F 
Sbjct: 292 ILESTIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFV 351

Query: 318 TVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFP 377
            +A++GT+ VFL +EY R+ NL P G  I  QLR F D RD  GP+I+SYLYL+ G+S P
Sbjct: 352 KIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTP 411

Query: 378 LLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAF 437
           LL+N S +G+I LG+GDSLASIIG+RYG+  W GT KT+EGTLAFIV S  +CLV     
Sbjct: 412 LLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLV----L 467

Query: 438 LAFEGVATRN------IILACVVSGILEGNSDLNDNILIPSFML 475
           L F+  A  N      ++  C +SG+LEGNS LNDNILIP+FM+
Sbjct: 468 LRFDKAAIFNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFMM 511

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  271 bits (694), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 205/320 (64%), Gaps = 7/320 (2%)

Query: 159 ELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRN 218
           +L++LD +DC L  ILLT+ L +    +     +L+  +   ++ +  N+   R     +
Sbjct: 163 QLKTLDQIDCNLFGILLTDCLMINNATAPNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLS 222

Query: 219 QYVRTAVLLAVFALVFPSVILAFLDLDD---TDNALVWLIKYIFSSALRMQIMAGWLVFL 275
               + VL   F ++FP ++   +D  +   T  AL WLI +I  S +R  IM  W++ L
Sbjct: 223 N---SIVLAGNFLVLFPILVNHLIDFSNEKITSPAL-WLIDFILESEIRQYIMLSWVIVL 278

Query: 276 GVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFR 335
            V IP V + KS +SLNTSRKIWHF +  L+V    ++PEF  +++ G +  FL VEY R
Sbjct: 279 VVFIPLVILFKSKISLNTSRKIWHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLR 338

Query: 336 YMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDS 395
           Y+ + P+G++++  LR+F D+RD++GP+IVSY+YLI G++ PLL+  S VG++SLGVGDS
Sbjct: 339 YLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDS 398

Query: 396 LASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILACVVS 455
           LASI+G++ G+ HW GTNKT+EGT+AFIV +  +  + Q+ F  F  +    I++ C   
Sbjct: 399 LASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTG 458

Query: 456 GILEGNSDLNDNILIPSFML 475
           G+LEGNS+LNDNILIP FM+
Sbjct: 459 GVLEGNSELNDNILIPLFMV 478

>Sklu_2266.5 YOR311C, Contig c2266 9409-10266
          Length = 285

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 73/153 (47%), Gaps = 27/153 (17%)

Query: 295 RKIWHFALLPLLVCQMAVEPEFTTVA---IAGTVVVFLIVEYFRYMNLYPFGD----YIN 347
           RK++H ++  + +       +++ V    I G V++F I++  R +N  PF      ++ 
Sbjct: 71  RKVFHSSIGFITLYLYTTGADYSKVKWPLICGFVILF-ILDLIR-LNCQPFNKLYCFFVG 128

Query: 348 AQLRTFTDFRDEQGPIIVSY---LYLILGVSFPLLINRSLVGVISL---GVGDSLASIIG 401
           A +R     R+     I SY   L+ +LG+ F        V +ISL      D+ AS IG
Sbjct: 129 ALMRK----RE-----IHSYNGVLWYLLGLVFSFSFFSKDVALISLFLLSWCDTAASTIG 179

Query: 402 RRYGKYHWP--GTNKTVEGTLAFIVASAALCLV 432
           R+YG    P    NK++ G++A  V   A+CL 
Sbjct: 180 RKYGHLT-PKLARNKSMAGSIAAFVVGFAICLT 211

>ADL222W [1519] [Homologous to ScYIL097W (FYV10) - SH]
           complement(314281..315831) [1551 bp, 516 aa]
          Length = 516

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 79/194 (40%), Gaps = 35/194 (18%)

Query: 220 YVRTAVLLAVFALVFPSVILAFLDLDDTDNALV----WLIKYIFSSALRMQIMAGWLVFL 275
           Y++    +  F   F   I  ++ ++D   A+      L+K+++S+ L +Q  AG LVF+
Sbjct: 233 YLKHTSSMLEFEARFQEYI-EYVKVEDYSKAITCFQTHLVKFLYSNPLDLQQAAGLLVFI 291

Query: 276 GVLIPSVF----------VMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTV 325
                ++           ++K    L +    W F  L L   + + +   T + +    
Sbjct: 292 KACKSNISSYVPTPRHEEIVKQQTLLQSKEDFWSFFFLKL--PKSSKKDHKTNIEVKNNE 349

Query: 326 VVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQ-GPIIVSYLYLILGVSF--PLLINR 382
           +    V+  RYM L               D R E+   + +   Y + G+S+  PLLI  
Sbjct: 350 LA-ASVDIKRYMEL-------------LDDRRWEKLNEMFLKAYYSMYGISYHDPLLIYL 395

Query: 383 SLVGVISLGVGDSL 396
           SL G+ SL   D L
Sbjct: 396 SL-GISSLKTKDCL 408

>CAGL0I09812g complement(936925..937770) highly similar to tr|Q12382
           Saccharomyces cerevisiae YOR311c, hypothetical start
          Length = 281

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 384 LVGVISLGVGDSLASIIGRRYGKYHWPG--TNKTVEGTLAFIVASAALCLVCQQAFLAFE 441
           L+ +  L   D+ AS IGRRYG Y  P    NK++ G+LA  V     CL     F+   
Sbjct: 158 LISLFLLSWSDTAASTIGRRYG-YLTPKITKNKSLAGSLAAFVVGFLTCLSFYGFFVPHY 216

Query: 442 GVATRN 447
             A ++
Sbjct: 217 NWANKS 222

>Scas_665.11
          Length = 296

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 368 LYLILGVSFPLLINRSLVGVISL---GVGDSLASIIGRRYGKYHWP--GTNKTVEGTLAF 422
           L+ ILG+ F        V +ISL      D+ AS  GR+YG Y  P    NK++ G++A 
Sbjct: 154 LWYILGLIFSFSFFSKDVALISLFLLSWSDTAASTFGRKYG-YLTPKLARNKSLAGSIAA 212

Query: 423 IVASAALCLV 432
            +     CL 
Sbjct: 213 FIVGFLTCLT 222

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.143    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,397,901
Number of extensions: 411385
Number of successful extensions: 1033
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1032
Number of HSP's successfully gapped: 19
Length of query: 475
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 370
Effective length of database: 12,961,219
Effective search space: 4795651030
Effective search space used: 4795651030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)