Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR050W1228120561210.0
YMR012W (CLU1)1277117226900.0
CAGL0M07722g1267116026560.0
Scas_709.561281121025970.0
Kwal_26.81611229116525690.0
KLLA0F25322g1269121223080.0
CAGL0E05500g164364761.1
ADR374C164037732.3
Scas_492.1185037723.6
Kwal_47.1695453681705.2
CAGL0I06875g22578685.9
CAGL0J05104g41188687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR050W
         (1205 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...  2362   0.0  
YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...  1040   0.0  
CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...  1027   0.0  
Scas_709.56                                                          1004   0.0  
Kwal_26.8161                                                          994   0.0  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...   893   0.0  
CAGL0E05500g 538976..543907 highly similar to sp|P10964 Saccharo...    34   1.1  
ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH] (1372612....    33   2.3  
Scas_492.1                                                             32   3.6  
Kwal_47.16954                                                          32   5.2  
CAGL0I06875g 666380..667057 similar to sp|P40084 Saccharomyces c...    31   5.9  
CAGL0J05104g complement(483260..484495) similar to sp|P47040 Sac...    31   7.0  

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score = 2362 bits (6121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1149/1205 (95%), Positives = 1149/1205 (95%)

Query: 1    MSKELDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEV 60
            MSKELDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEV
Sbjct: 1    MSKELDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEV 60

Query: 61   DEQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVA 120
            DEQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVA
Sbjct: 61   DEQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVA 120

Query: 121  KFRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDVLKGGS 180
            KFRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDVLKGGS
Sbjct: 121  KFRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDVLKGGS 180

Query: 181  ALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKF 240
            ALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKF
Sbjct: 181  ALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKF 240

Query: 241  DPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSS 300
            DPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSS
Sbjct: 241  DPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSS 300

Query: 301  LPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAA 360
            LPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAA
Sbjct: 301  LPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAA 360

Query: 361  SKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDL 420
            SKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDL
Sbjct: 361  SKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDL 420

Query: 421  HIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAIQAK 480
            HIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAIQAK
Sbjct: 421  HIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAIQAK 480

Query: 481  NDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDKR 540
            NDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDKR
Sbjct: 481  NDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDKR 540

Query: 541  NYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEA 600
            NYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEA
Sbjct: 541  NYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEA 600

Query: 601  AYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDI 660
            AYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDI
Sbjct: 601  AYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDI 660

Query: 661  MHKNGINIRYLGRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLIKE 720
            MHKNGINIRYLGRVI                HLQQVEADNKEFTEWEANYLKHIESLIKE
Sbjct: 661  MHKNGINIRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIKE 720

Query: 721  RQVTIQKLLAEGKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEIISR 780
            RQVTIQKLLAEGKEVPA            IRKPHEKEGVAVNNDQLSVLLTLAQIEIISR
Sbjct: 721  RQVTIQKLLAEGKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIISR 780

Query: 781  SIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDIDFAFTKLTREQ 840
            SIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDIDFAFTKLTREQ
Sbjct: 781  SIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDIDFAFTKLTREQ 840

Query: 841  LLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWR 900
            LLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWR
Sbjct: 841  LLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWR 900

Query: 901  QAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATAL 960
            QAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATAL
Sbjct: 901  QAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATAL 960

Query: 961  GLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDS 1020
            GLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDS
Sbjct: 961  GLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDS 1020

Query: 1021 FEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQ 1080
            FEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQ
Sbjct: 1021 FEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQ 1080

Query: 1081 NSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSK 1140
            NSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSK
Sbjct: 1081 NSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSK 1140

Query: 1141 ELGVNHKTTVECNSWITGVENLIESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAELRD 1200
            ELGVNHKTTVECNSWITGVENLIEST                            SAELRD
Sbjct: 1141 ELGVNHKTTVECNSWITGVENLIESTSQSKALAASKAAAAAKQGEKKPAQKQQQSAELRD 1200

Query: 1201 KSIDE 1205
            KSIDE
Sbjct: 1201 KSIDE 1205

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1172 (44%), Positives = 756/1172 (64%), Gaps = 31/1172 (2%)

Query: 17   GKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYEL--LHNGVEVDEQQLISELAGNEQ 74
             K+  +S    + +++Q+++  LA   +SKY TN  L  +    ++ ++  I E+ G + 
Sbjct: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97

Query: 75   TVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAAS 134
             + LQL LKPY+  E ++H +T R++IGF  ++ D ++  A+S  + F  LPL  I   S
Sbjct: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERS 157

Query: 135  GKTEVADDRQKEEFQ-----VSDAEKAVFTKELDSILE--LRPSAQDVLKGGSALSKPCL 187
             + E  +    EE +     V+D EK  F + +  +       S   +L   S +  PC+
Sbjct: 158  KQEEKDEKSDPEEKKNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCV 217

Query: 188  RSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLK-- 245
            RSL  + YNPVP F+R+KGHL YLQ VTLEGE+ +ITA  SGFYVNKS++ KFDP+ K  
Sbjct: 218  RSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKEN 277

Query: 246  TD-----AAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSS 300
            TD     + +  +L++L+   SKKF SH+   E  L A +S +YV+P + FLHK WF SS
Sbjct: 278  TDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSS 337

Query: 301  LPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAA 360
            LP N+ D+   Q  AL+   ERNFNDEFQA+K+ ++  +  R+E E+L ++V+H+F+V A
Sbjct: 338  LPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTA 397

Query: 361  SKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDL 420
            + G+M IFY + VAMNP++P ++ IFLK+NIFYS+VSD+ G+Y+ KGGD AA AASNQDL
Sbjct: 398  ASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDL 457

Query: 421  HIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKN-EKGEEEAIQA 479
              I  L + +M  VR+LL  V+          +PVPG+L T G K +K+   GEE     
Sbjct: 458  KTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDF 517

Query: 480  KNDITVCYGFDEASNKVIADAEFGSSLDD-FAKVFHLKKHEVDGVELKVASTSKGVVGFD 538
             NDI V YG DE   K++ DA+F S L+  F K FHLKKH+V+G EL  +S SKG+VGFD
Sbjct: 518  VNDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFD 577

Query: 539  KRNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEM 598
            KR YILDLA+  PLD+ FA +NFD + +   RYPHRQTLLR ELVEKWW +KV+  G E 
Sbjct: 578  KRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEF 637

Query: 599  EAAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLV 658
            E AYEE  FSYNPDAY++EGIED  V E+S+YL+KEV+P+++++   G+++ P+NGEHL 
Sbjct: 638  EKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLA 697

Query: 659  DIMHKNGINIRYLGRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLI 718
            D +HKNGIN+RYLG++I                +L+ VE DNKE+ +WE +YL+ IE++I
Sbjct: 698  DTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMI 757

Query: 719  KERQVTIQKLLAEGKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEII 778
            KERQ  I KL+ EGKEVP             I+KP + + V V  D+L  L+ ++++EI+
Sbjct: 758  KERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIV 817

Query: 779  SRSIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAE-----FPTDGSDIDFAF 833
            SRS+KHV +    ++P  ++P+ +A+  N+L G  YN  P  E     +P +      +F
Sbjct: 818  SRSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKC----SF 873

Query: 834  TKLTREQLLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTR 893
             KLTR +LL  +S+QA LRFR+ LP  W   Y   PF L+R +  KFGIQLLNKEYFFTR
Sbjct: 874  AKLTRSELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTR 933

Query: 894  EQYQNWRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDE 953
            EQ ++++Q+ D +IR+K VEP +TFS++DL++   +  +  T+ VS++ WAQGA MIN E
Sbjct: 934  EQLESYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMIN-E 992

Query: 954  DKQATALGLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYE 1013
            DKQ +AL L +Q+I   E+ +  +HP VAE YL+LS I++KL    EA+A CRKAC IYE
Sbjct: 993  DKQ-SALTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYE 1051

Query: 1014 RVCGFDSFEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVV-IP-VNHPATINSYSM 1071
            RV G DSFEM+R+L NLA+LE +N+SPYNA +    +  IL V  +P ++HPA  + ++ 
Sbjct: 1052 RVSGIDSFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNH 1111

Query: 1072 LHSMCSSLQNSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACI 1131
            L  +   +Q++   I+VL +L   +VE++G  SL Y   ESRL NL+A++ ++ R+L  I
Sbjct: 1112 LEQLALGVQDTKLAIEVLGQLSSYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHI 1171

Query: 1132 ESCYELFSKELGVNHKTTVECNSWITGVENLI 1163
                 +F+K+LG+NH  + +   W+ G+ +LI
Sbjct: 1172 TVTQGIFTKQLGMNHTHSAQSRQWVNGLSSLI 1203

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1160 (44%), Positives = 748/1160 (64%), Gaps = 29/1160 (2%)

Query: 28   RRARVQSIMYFLAFNAASKYYTNYELLHNGVEV---DEQQLISELAGNEQTVHLQLRLKP 84
            + +++Q+++ FL+   A+KY+TNY L ++  ++    E++ + EL  ++    + L LKP
Sbjct: 41   KDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKP 100

Query: 85   YNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQ 144
            YN  + ++H +T R++ GF  +++D ++++A+S  +KF +LPL +I   S + E  D   
Sbjct: 101  YNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTEN 160

Query: 145  KE--EFQVSDAEKAVFTKELDSILE-----LRPSAQDVLKGGSALSKPCLRSLIISGYNP 197
            K+     V+D EK  F   +  + E      +   +D++   +++  PCLRS+  S YNP
Sbjct: 161  KKPTSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNP 220

Query: 198  VPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLKTDAA----VCLT 253
            VPAF+RTKGHL YLQ VTLEGE+L +TA  SGFY+NKS+  KFDP+ K +      V  T
Sbjct: 221  VPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYT 280

Query: 254  LYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPSNSIDFTEYQL 313
            LY+LL   SK F +H+S LE      ESV YV+P    L+K W   ++P+N  D+   Q+
Sbjct: 281  LYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI 340

Query: 314  EALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKGSMEIFYGNMV 373
            ++ NF+ ERNFNDEFQ++KE  +  + AR+E E++  ++ H+F + A+KG+M+I YGN  
Sbjct: 341  DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGT 400

Query: 374  AMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDLHIIKTLLQSNMRS 433
            AMNPD+P +E IFLKNNIFYSFV DL+  Y DKGGD AA A++NQDL  +  L + N+ +
Sbjct: 401  AMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNLPN 460

Query: 434  VRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAI-QAKNDITVCYGFDEA 492
            + HLL  ++          +PVPG+L   G+K   NE+ +EE + +  +DI V YG DE 
Sbjct: 461  IHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGLDEN 520

Query: 493  SNKVIADAEFGSSLDD-FAKVFHLKKHEVDGVELKVASTSKGVVGFDKRNYILDLADNNP 551
              KV+ + EF   L+D FAK FHLKKH + G EL  +S SKG+VG DKR+YILDLA+  P
Sbjct: 521  EKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLANTYP 580

Query: 552  LDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAYEEGKFSYNP 611
            LDV FA ENFD V +   +YPHRQTL+R ELVEKWW +K++    E+  AYEE  +SYNP
Sbjct: 581  LDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENLYSYNP 640

Query: 612  DAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMHKNGINIRYL 671
            DAY++ G+EDETVVE+S YL +E++P +V++   G+I +P+NGEHL D  HKNG+N+RYL
Sbjct: 641  DAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYL 700

Query: 672  GRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLIKERQVTIQKLLAE 731
            G+                   L QV  DNKE+ EWE +YL+ IE++IKERQ  I KL+ E
Sbjct: 701  GKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQE 760

Query: 732  GKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEIISRSIKHVFRKHCH 791
            GKEVP             I+KP  ++ V V+ D+L  L+  A++EIISRS+KH+ RK+  
Sbjct: 761  GKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSR 820

Query: 792  ELPAVIIPTFIAFALNLLFGYCYNKAPIAE-----FPTDGSDIDFAFTKLTREQLLSEIS 846
             LP ++IP  I+F  NLLFG  YN AP  E     +P D     + F  LT + LL EI 
Sbjct: 821  SLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVD----QYEFKNLTHDTLLKEIE 876

Query: 847  EQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWRQAQDNQ 906
            ++AV+R+RY L   W + +E  PF L+R ICNKFG+QLLNK+YFF+ EQ + ++Q+ D +
Sbjct: 877  QEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKK 936

Query: 907  IRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATALGLFSQA 966
             R+K V P++TFS++DL+V   I     ++ +S++ W+QGA +IN  + Q   L L +Q+
Sbjct: 937  SRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIIN--ENQKDGLTLLAQS 994

Query: 967  IAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRS 1026
            I F+EE +  +H +VAE YL LSTI++KL   +EA+A CRK+CAIYERVCG DSFE++R+
Sbjct: 995  IGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRA 1054

Query: 1027 LNNLAMLEMANDSPYNAALCLKTIMSILS--VVIPVNHPATINSYSMLHSMCSSLQNSSA 1084
            L NLA LE AN+SPYN AL  + I+  +S   +  ++HP   N ++ L  +   +Q++  
Sbjct: 1055 LTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKL 1114

Query: 1085 MIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSKELGV 1144
             ++VL  LGD +V IDG +SLPYA  +S+L NL A+   +  +L  I+    +F+KELG 
Sbjct: 1115 AVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGT 1174

Query: 1145 NHKTTVECNSWITGVENLIE 1164
            NH +T +   W+ G+ NLI+
Sbjct: 1175 NHGSTAQARQWVDGLTNLIK 1194

>Scas_709.56
          Length = 1281

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1210 (43%), Positives = 749/1210 (61%), Gaps = 39/1210 (3%)

Query: 27   SRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVDEQQLISELAGNE--QTVHLQLRLKP 84
            ++ A+V++I+  LAF   +KY TN +L  N   ++E+  I ++   +    VHL + +KP
Sbjct: 51   NKDAKVETIINVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKP 110

Query: 85   YNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAASG-----KTEV 139
            Y   + ++H +T R++IGF  ++ D ++  A+S  +KF ELPL +I   +      K E 
Sbjct: 111  YTARDSLKHLLTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTAEEEEQKDEA 170

Query: 140  ADDRQ--KEEFQVSDAEKAVFTKELDSILE--LRPSAQDVLKGGSALSKPCLRSLIISGY 195
            A+D++  K  F+VSD EK  F K +  I E   + +   VL   S +  PC+RSL +S Y
Sbjct: 171  AEDKEVKKNVFKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAY 230

Query: 196  NPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLK------TDAA 249
            NPVP F++++GHL YLQ VTLEGET H+TAT SGFY+NKS++ KFDP+ +       ++ 
Sbjct: 231  NPVPVFYKSQGHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESK 290

Query: 250  VCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPSNSIDFT 309
            +  +LY+LL  HSKKF SH+   E  L   ESV+YVKP+S FLHK W  +  P+N  DF 
Sbjct: 291  IFYSLYDLLASHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFF 349

Query: 310  EYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKGSMEIFY 369
              QL++ N   E NFND+FQA+++  +  ++ R+E E+L  ++IH+F+V A KG+M IF 
Sbjct: 350  RLQLDSQNVSVETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFN 409

Query: 370  GNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKG-GDAAAHAASNQDLHIIKTLLQ 428
             N+  +NP++P  E IFL  +IFYSFV+ +    +D G  + AA A SN DL  I  L +
Sbjct: 410  DNLPPLNPESPTNEQIFLSGHIFYSFVTSI----KDNGINEDAARAISNHDLKTINLLNR 465

Query: 429  SNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKN-EKGEEEAIQAKNDITVCY 487
             N+  VR++L  ++          +PVPG+LD+ G +  K+ E GEE      ND+ V Y
Sbjct: 466  VNLNDVRYVLTTIVDFAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKY 525

Query: 488  GFDEASNKVIADAEFGSSL-DDFAKVFHLKKHEV----DG--VELKVASTSKGVVGFDKR 540
            G DE   K++ DA+F ++L  +FAK+FHLKKH+V    DG  V++  +S S+G+VGFDKR
Sbjct: 526  GLDEEEGKILFDADFDAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKR 585

Query: 541  NYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGS-EME 599
             YILDLA+  PLD+ F  EN+D V D K RYPHRQTL+R ELVEKWW ++V+      M+
Sbjct: 586  KYILDLANTYPLDINFVKENYDNVADTK-RYPHRQTLMRPELVEKWWNAQVEKNKDLTMD 644

Query: 600  AAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVD 659
            AAY+   FSYNPDA+ ++G+ED TV E+S YL KEV+P +V +  + ++  P+NGEHLVD
Sbjct: 645  AAYDGNMFSYNPDAFVVDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVD 704

Query: 660  IMHKNGINIRYLGRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLIK 719
             +HKNGIN+RYLG+ I                 L+ V   N E+  WE  YL  IE LI 
Sbjct: 705  TLHKNGINLRYLGKFIELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIA 764

Query: 720  ERQVTIQKLLAEGKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEIIS 779
            ERQ  I KL+ EGKEVP             IRKP +++ + V  D+L+ L+ +A++EII+
Sbjct: 765  ERQAKINKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIIT 824

Query: 780  RSIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDI-DFAFTKLTR 838
            RS+KHV R +  +LP +++P+ IAF LNLLFG  YN +P+AE   +   I  F+F KLTR
Sbjct: 825  RSLKHVLRSYSKDLPVLMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTR 884

Query: 839  EQLLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQN 898
              LL  IS+++ LRFRY LP  W S+Y  +PF  +R +  K GIQL+NK+YFFT E ++ 
Sbjct: 885  TTLLEAISKESYLRFRYELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFET 944

Query: 899  WRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQAT 958
            ++Q+QD +IR+KLV P++TFS+ DL++   +  +  ++ V  D W QG   I +  K   
Sbjct: 945  FKQSQDKKIRNKLVAPLNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKD-- 1002

Query: 959  ALGLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGF 1018
            AL LF+QAI   EE S  +HP+VAE YL++ST++++L   SEAVA CRKAC IYERVCG 
Sbjct: 1003 ALTLFAQAITVMEEVSSILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGV 1062

Query: 1019 DSFEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSV--VIPVNHPATINSYSMLHSMC 1076
            DSFEM+R+L NLAMLE +N SPYNAA+  K ++  L    +  ++HP+  + YS +  + 
Sbjct: 1063 DSFEMLRALTNLAMLETSNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLS 1122

Query: 1077 SSLQNSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYE 1136
              ++N    + VL  L D+IV  +G +SL YA  ESRL NLY +V +++ +L  I     
Sbjct: 1123 LGVENIKLSMAVLKHLCDLIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEP 1182

Query: 1137 LFSKELGVNHKTTVECNSWITGVENLIESTXXXXXXXXXXXXXXXXXXXXX-XXXXXXXS 1195
            +FSKELG NH TT +   WI G+ N++                                +
Sbjct: 1183 IFSKELGTNHVTTAQSRQWINGLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPN 1242

Query: 1196 AELRDKSIDE 1205
            AEL DKS+DE
Sbjct: 1243 AELADKSVDE 1252

>Kwal_26.8161
          Length = 1229

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1165 (43%), Positives = 735/1165 (63%), Gaps = 11/1165 (0%)

Query: 5    LDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVDEQQ 64
            +D + VSI++P  + + +  +  + + VQ +   L F+ +++  TN E  H G ++  ++
Sbjct: 6    VDAILVSIKLP-NQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKLSGEE 64

Query: 65   LISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRE 124
             + +LA +E  V L ++   Y   + +RH    R+ IGF  ++ D I+  A+S   +F +
Sbjct: 65   SLLDLA-SEDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCD 123

Query: 125  LPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDVLKGGSALSK 184
            +PL  +  A+ + E  D      F++S+ EK  F + +   L    +  +VLK  S +  
Sbjct: 124  MPLRPVEHAAPQEE--DKTASTAFKISEDEKNDFQRTVKDTLNQGKTVNEVLKTRSGIIT 181

Query: 185  PCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTL 244
            PCLR+L +SGYNPVP F+RTKGHLLYLQA +LEGE  HITAT  GFYVNKS+A KFDP+ 
Sbjct: 182  PCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSP 241

Query: 245  KTDA-AVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPS 303
            + DA A  ++L +LL+ HSKKF  HL  LE  + + ++V + +P + FL K W  S++P+
Sbjct: 242  RDDAGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPT 301

Query: 304  NSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKG 363
            +S D+   QL  ++F TERNFNDEFQA+K+ +S D  + ++ EKL  +V  +F   A + 
Sbjct: 302  SSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRD 361

Query: 364  SMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDLHII 423
            +M IFY ++VAMNP+AP QE IFLKNNIFYSFV D++G+Y   GGDAAA AASNQDL  +
Sbjct: 362  AMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTV 421

Query: 424  KTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEK-GEEEAIQAKND 482
            K L + ++  + +LL  ++          +PVPG+L   G    ++ K GE       +D
Sbjct: 422  KLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSD 481

Query: 483  ITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDKRNY 542
            + + YG DEAS  V+ + EF  +L+ F+KVFHL+KH+   VE+K +S SKG++G DKR Y
Sbjct: 482  VNIVYGQDEASGDVLYNQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKY 541

Query: 543  ILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAY 602
            ILDLA++ PLDV FA  N+D V  E  RYPHRQTL+R ELV+KWW +K+D +  +   A+
Sbjct: 542  ILDLANSQPLDVEFATGNYDGVP-ESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAF 600

Query: 603  EEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMH 662
            EE KF+ NPDAY +EG+ED  V+++S YL  +V+P++V E A G++T P++G+HL + +H
Sbjct: 601  EENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLH 660

Query: 663  KNGINIRYLGRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLIKERQ 722
            KNGIN+RYLG++I                 L  V A N++  +WE  YL  +E  IKERQ
Sbjct: 661  KNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQ 720

Query: 723  VTIQKLLAEGKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEIISRSI 782
              I KL+ EGKE+P             IRKP + E V VN DQ+  L+ ++Q+EI++RS+
Sbjct: 721  EKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSL 780

Query: 783  KHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTD-GSDIDFAFTKLTREQL 841
            KH+ R +   LP  ++P+ +A+  NLLFG  YN +P  E   +     +F+F  L+R  L
Sbjct: 781  KHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDL 840

Query: 842  LSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWRQ 901
            L  I  QA  RF Y L +         PFAL+R +  +FGIQLLNKEYFF  E+Y+ ++Q
Sbjct: 841  LKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQ 900

Query: 902  AQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATALG 961
            +QD + RSKL +P+STFS ND++V   I      +   D+ W QGA ++N  +K+A  L 
Sbjct: 901  SQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILN--EKEADGLV 958

Query: 962  LFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSF 1021
            L SQA+  +EE +G VH +VAESY+A+STI+  L++  EA+  CR+AC IYER CG DSF
Sbjct: 959  LLSQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSF 1018

Query: 1022 EMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQN 1081
            E++R L NLA+LE++N SP NAA+ L+ I+  ++ +    HPATINSY+ML     + ++
Sbjct: 1019 EVLRCLTNLAVLELSNKSPSNAAVVLQRILCTMNALCVTIHPATINSYTMLQQASLACKD 1078

Query: 1082 SSAMIKVLNKLGDIIVEI-DGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSK 1140
            +   I+VL KL   I+EI DG  SL Y  N+SR+ +LY ++ +Y  SL  I     +F++
Sbjct: 1079 ARLAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTR 1138

Query: 1141 ELGVNHKTTVECNSWITGVENLIES 1165
            ELGVN +TT +C  W+  +E L++S
Sbjct: 1139 ELGVNDETTAQCRQWVQALEGLLQS 1163

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1212 (39%), Positives = 722/1212 (59%), Gaps = 67/1212 (5%)

Query: 6    DTVEVSIR-VP-FGKSKR--LSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVD 61
            D +EV ++  P + KSK   +     + + V  +  FL+F  ++K+YT+Y+L+ N   VD
Sbjct: 4    DNIEVIVKGTPSYTKSKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVD 63

Query: 62   EQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAK 121
            ++ ++ +LAGN  ++  Q + K YN    ++H V  RE +GF  + +D I+  A+S+ ++
Sbjct: 64   DEDVLGDLAGNGSSLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQ 123

Query: 122  FRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDV--LKGG 179
            F+++ L   +  S  +E           +SD EK  F +  + +LE   +  ++  LK G
Sbjct: 124  FQDMSLEPNSEKSNGSETT---------ISDQEKVKFLQTCNELLESTNTDFNIASLKTG 174

Query: 180  SALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIK 239
            + L  P L+SL  S YNPVPAF++ KGHLLYLQA TLE ET HIT ++SGFYVNKSS++K
Sbjct: 175  NLLVTPVLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVK 234

Query: 240  FDPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPS 299
            FDP+ K +      L +LLT+ SKKF  H++ L   L + +S  YVKP S FL K W  S
Sbjct: 235  FDPSPKDEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVS 294

Query: 300  SLPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVA 359
             LPSN+ DF   QLE  N   ERNF DEFQA+K+        RL+ EK+   +IH+FN  
Sbjct: 295  QLPSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSE 354

Query: 360  ASKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQD 419
            A KG+M IF   +  ++P    +  ++   ++ +SFV+D+ G Y   GG+ AA+A +NQD
Sbjct: 355  AVKGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQD 414

Query: 420  LHIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAIQA 479
            L II +L +  ++ +RH L A++          SPVPG+L   G+  I +E+ +E A   
Sbjct: 415  LQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPM 474

Query: 480  KNDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDK 539
            +  I+V YG+D+    +  D +F   + +F+K F+LK+H+V+ V+L+++S SKG+ G D+
Sbjct: 475  ETLISVNYGYDDFVATLKFDEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQ 534

Query: 540  RNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEME 599
            R YILDLA+ NP+D+ F   ++D V + K  YPHRQ LLRRELVE+W   K+  +G  ++
Sbjct: 535  RAYILDLANTNPVDIEFVKAHYDDVKENK--YPHRQVLLRRELVERWRAEKIAASGKTLQ 592

Query: 600  AAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVD 659
             A E+  F YNPDAY I+G+EDE V ++S +L   V+   ++++ +G+   P++G+HL D
Sbjct: 593  EASEDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTD 652

Query: 660  IMHKNGINIRYLGRVIXXXXXXXXXXXXXXXXHLQQVEADNKEFTEWEANYLKHIESLIK 719
            + H NG+N+RYLG+ I                +L ++E +NKE+ +WE  YL  +E LIK
Sbjct: 653  LFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIK 712

Query: 720  ERQVTIQKLLAEGKEVPAXXXXXXXXXXXXIRKPHEKEGVAVNNDQLSVLLTLAQIEIIS 779
            ERQ  I K + +GKEVP+            +++P   EG  V  DQ   L+ + ++E+I+
Sbjct: 713  ERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIA 772

Query: 780  RSIKHVFRKHCHELPA-VIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDI-DFAFTKLT 837
            RSIKH+FR+   +L +  ++P  +AF LNLLFG  YN++   E      DI +  F + T
Sbjct: 773  RSIKHIFRQQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYT 832

Query: 838  REQLLSEISEQAVLRFRYTLPDGW----ESRYEHTPFALLRPICNKFGIQLLNKEYFFTR 893
            REQL+ E+  QA LRFRY L   W    E R+  + +AL+R I  KFGIQL+NKEYFFT+
Sbjct: 833  REQLIEEVRVQAKLRFRYDLTSEWFDINEKRF--SKYALIRAIAQKFGIQLINKEYFFTK 890

Query: 894  EQYQNWRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMIN-- 951
            EQY+ W+QAQD ++RSK+V+P  TFSIND S+R +I  A   + ++++ W QGA ++N  
Sbjct: 891  EQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAV 950

Query: 952  -------------------------------DEDKQAT--------ALGLFSQAIAFREE 972
                                            E++QA         AL L  Q+IAFRE+
Sbjct: 951  SVEEEEAEKKKEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFRED 1010

Query: 973  TSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRSLNNLAM 1032
              G VHP++  SYL LS ++S+L + S+AV  C KA  + ER  G DSFE +R L+NLA 
Sbjct: 1011 IFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAY 1070

Query: 1033 LEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQNSSAMIKVLNKL 1092
            LE    S YN+AL LK +  +L ++ P  H   +N +++L  + +S ++    IK+LNKL
Sbjct: 1071 LEYGQGSIYNSALVLKKVHELLKLLAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKL 1130

Query: 1093 GDIIVEIDG-HKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSKELGVNHKTTVE 1151
             +++++I G  ++LPY  NESR+ANLY S+ +   +L+ IE    +FSKELG+N +TT+ 
Sbjct: 1131 SELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLT 1190

Query: 1152 CNSWITGVENLI 1163
               W   ++ +I
Sbjct: 1191 SKQWSETIKGII 1202

>CAGL0E05500g 538976..543907 highly similar to sp|P10964
           Saccharomyces cerevisiae YOR341w RPA190 DNA-directed RNA
           polymerase I, start by similarity
          Length = 1643

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 12/64 (18%)

Query: 881 GIQLLNKEYFFTREQYQNW-----RQAQDNQIRSKLV-------EPVSTFSINDLSVRTI 928
           G+ L NK+ FFTREQYQ +     R    +  R+KLV       +P+  ++   +    +
Sbjct: 663 GVWLTNKDSFFTREQYQQYIYGCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVL 722

Query: 929 INVA 932
           +NV 
Sbjct: 723 LNVT 726

>ADR374C [2115] [Homologous to ScYOR341W (RPA190) - SH]
           (1372612..1377534) [4923 bp, 1640 aa]
          Length = 1640

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 881 GIQLLNKEYFFTREQYQNW-----RQAQDNQIRSKLV 912
           G+ L NK+ FFTREQYQ +     R    +  RSK++
Sbjct: 657 GVWLTNKDSFFTREQYQQYIYGCIRPEDGHASRSKII 693

>Scas_492.1
          Length = 1850

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 881 GIQLLNKEYFFTREQYQNW-----RQAQDNQIRSKLV 912
           G+ L +K+ FFTREQYQ +     R    +  RSKL+
Sbjct: 86  GVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRSKLI 122

>Kwal_47.16954
          Length = 536

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 16/81 (19%)

Query: 522 GVELKVASTSKGVVGFDKRNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRE 581
           G ELK+ + ++GVV  D                GF+ E+F  V ++  R  + Q   R  
Sbjct: 63  GYELKINTKNQGVVQLD----------------GFSQEDFSLVKNDFKRRFNVQVEQREH 106

Query: 582 LVEKWWFSKVDGTGSEMEAAY 602
            +  W + K D   +EM  AY
Sbjct: 107 SMRGWNWGKADMARNEMVFAY 127

>CAGL0I06875g 666380..667057 similar to sp|P40084 Saccharomyces
           cerevisiae YER139c, start by similarity
          Length = 225

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 13/78 (16%)

Query: 865 YEHTPFALLRPICNKFGIQL-------LNKEYFFTR------EQYQNWRQAQDNQIRSKL 911
           +E+ P+A L   CNKF  +        L++E  F R      E  Q  RQ QD++    L
Sbjct: 99  WENNPYAYLSKYCNKFHFRCSQFFQVQLSEEAIFARTGVHLLEDTQEMRQTQDDKFNVTL 158

Query: 912 VEPVSTFSINDLSVRTII 929
            E +     ++  +++++
Sbjct: 159 FEELLREKASEEDIKSLV 176

>CAGL0J05104g complement(483260..484495) similar to sp|P47040
           Saccharomyces cerevisiae YJL059w YHC3 may function as a
           chaperone, start by similarity
          Length = 411

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 36/88 (40%), Gaps = 11/88 (12%)

Query: 777 IISRSIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKA--PIAEFPTDGSDI----- 829
           I   SI H F+  C  L A+++P  +  +   LF Y  N+A  P   FP D   +     
Sbjct: 217 IFVSSIDH-FKSTCVNLKALVVPYMLPLSSVYLFEYLINQAVSPTLLFPLDSRGLPPFFN 275

Query: 830 ---DFAFTKLTREQLLSEISEQAVLRFR 854
              D   T  T  QL   IS     +FR
Sbjct: 276 KYRDMYVTYGTLYQLGVFISRSLAHKFR 303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,654,730
Number of extensions: 1558631
Number of successful extensions: 5003
Number of sequences better than 10.0: 25
Number of HSP's gapped: 5111
Number of HSP's successfully gapped: 25
Length of query: 1205
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1092
Effective length of database: 12,684,275
Effective search space: 13851228300
Effective search space used: 13851228300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)