Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR048W35733016540.0
Kwal_26.81523733216764e-86
KLLA0F25388g4053956002e-74
CAGL0K03267g4873285541e-66
Scas_709.573942404871e-57
YHL020C (OPI1)4041603693e-40
KLLA0B12474g19572710.50
YJR066W (TOR1)247073710.93
CAGL0K00517g2471125691.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR048W
         (350 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH] complement(4...   641   0.0  
Kwal_26.8152                                                          265   4e-86
KLLA0F25388g complement(2362150..2363367) some similarities with...   235   2e-74
CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...   218   1e-66
Scas_709.57                                                           192   1e-57
YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative reg...   146   3e-40
KLLA0B12474g 1091011..1091598 some similarities with sp|Q99278 S...    32   0.50 
YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase invo...    32   0.93 
CAGL0K00517g complement(54918..62333) similar to sp|P32600 Sacch...    31   1.5  

>ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH]
           complement(481129..482202) [1074 bp, 357 aa]
          Length = 357

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/330 (95%), Positives = 314/330 (95%)

Query: 1   MNHTNTEPGEEHELIAIEALSRLCNGTNGETRLEKSXXXXXXXXXXXXXXXXTLLCRMRQ 60
           MNHTNTEPGEEHELIAIEALSRLCNGTNGETRLEKS                TLLCRMRQ
Sbjct: 1   MNHTNTEPGEEHELIAIEALSRLCNGTNGETRLEKSHGAEQGQAQQHQDDGETLLCRMRQ 60

Query: 61  NPIFTNAVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELWAPRDGASKHRLEESCET 120
           NPIFTNAVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELWAPRDGASKHRLEESCET
Sbjct: 61  NPIFTNAVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELWAPRDGASKHRLEESCET 120

Query: 121 GTPLDDEVGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSL 180
           GTPLDDEVGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSL
Sbjct: 121 GTPLDDEVGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSL 180

Query: 181 QDLVQKEREDSGPREPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGS 240
           QDLVQKEREDSGPREPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGS
Sbjct: 181 QDLVQKEREDSGPREPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGS 240

Query: 241 SLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARLSANSKMLILAEESLDMVSNIIQ 300
           SLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARLSANSKMLILAEESLDMVSNIIQ
Sbjct: 241 SLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARLSANSKMLILAEESLDMVSNIIQ 300

Query: 301 VFDMTLGRAEEWVKHKQELKELIKSQYMEA 330
           VFDMTLGRAEEWVKHKQELKELIKSQYMEA
Sbjct: 301 VFDMTLGRAEEWVKHKQELKELIKSQYMEA 330

>Kwal_26.8152
          Length = 373

 Score =  265 bits (676), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 206/321 (64%), Gaps = 46/321 (14%)

Query: 53  TLLCRMRQNPIFTNAVSLYEQTKSHHPNFRRRAELVERSAST-MVRR---TSELWAPRDG 108
           TLL ++R N +  NAV +YEQ+KS +P FR+ AE++ER A   MV+R   TS  W  R G
Sbjct: 40  TLLDKVRSNALINNAVRVYEQSKSQYPKFRKGAEMMERKAFIPMVKRLEKTSHKWKSR-G 98

Query: 109 ASKHRL-------EESCETGTP--------------------LDDEVGPSPRVSKRQKI- 140
              H         ++  E                        LDD +    R SKRQKI 
Sbjct: 99  KRCHDDEDEDEMDQQKAEGSDEEDNDGDDEEEDEDHRESVLLLDDRL-CRKRTSKRQKIS 157

Query: 141 ------KENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSLQDLVQKERE-DSG- 192
                 K NLK Y+L MSIESKK+L+TCLHLLKLAN QLS+ VG LQDLV KE++   G 
Sbjct: 158 NAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQDLVLKEQKLRKGR 217

Query: 193 --PREPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGSSLPEPARSQV 250
              R+ E +D E+Y+DAS+ I  E S  +KME+VGTVKKVYSLIS+F GSSLPEPAR+QV
Sbjct: 218 IRDRQAESDDEEEYYDASDNI-DELSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQV 276

Query: 251 RETLLKMPTNWSLTVNSASRETPTNAR-LSANSKMLILAEESLDMVSNIIQVFDMTLGRA 309
           RE+LLK+P NW+ T+NS +    T+++ +S N K+LILA+ESL MV N++ V D TLG+A
Sbjct: 277 RESLLKLPMNWTSTMNSENLARYTSSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGKA 336

Query: 310 EEWVKHKQELKELIKSQYMEA 330
           EEWVK KQE+KEL+K QY+  
Sbjct: 337 EEWVKQKQEVKELLKKQYLHG 357

>KLLA0F25388g complement(2362150..2363367) some similarities with
           sp|P21957 Saccharomyces cerevisiae YHL020c OPI1 negative
           regulator of phospholipid biosynthesis pathway
           singleton, hypothetical start
          Length = 405

 Score =  235 bits (600), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/395 (40%), Positives = 219/395 (55%), Gaps = 108/395 (27%)

Query: 10  EEHELIAIEALSRLCNGTNGETRLEKSXXXXXXXXXXXXXXXXTLLCRMRQNPIFTNAVS 69
           ++ E IA+EAL +L NG    T                      LL +M+Q+     AV 
Sbjct: 17  KDSEEIAVEALDKLRNGDYSVT----------PSGSESSGKSERLLDKMKQS-----AVD 61

Query: 70  LYEQTKSHHPNFRRRAE-LVERSASTMVRRTSELWAPRDGASKHRLEE------------ 116
           LYEQT+++HP   RRA+ LV++     + +TS +W    GA+K +++E            
Sbjct: 62  LYEQTRTNHPKLIRRADRLVKK-----IEKTSGIWI---GAAKRKIDEVDTQSNGDDDDS 113

Query: 117 --SCETGTPLDDE----------VGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCLH 164
             +C  G  LD E          V    R SKR++IKENLKEY+L MSIESKK+L+TCL 
Sbjct: 114 DDACVHG--LDIEHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMSIESKKRLMTCLG 171

Query: 165 LLKLANRQLSSTVGSLQDLVQKER--------------------------------EDSG 192
           LLKLAN+QLS  V SLQD+V+KE+                                E  G
Sbjct: 172 LLKLANKQLSQRVMSLQDVVKKEQLRRRSPLPISSSIDAEVRPRNHCSVRETTSSAEHPG 231

Query: 193 PREPEEEDGEQYFDASETI--------------------VSERSKEIKMEVVGTVKKVYS 232
               EEED EQ+FDAS  +                    +   + +I++EVVGT+KKVYS
Sbjct: 232 HDRDEEED-EQFFDASSQLNEQAGNRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYS 290

Query: 233 LISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARLSANSKMLILAEESL 292
           ++SRF G+SLPEPARSQVRE+LLK+PT W   +NS   E P + R+S+N + L+LA+E+L
Sbjct: 291 VVSRFTGNSLPEPARSQVRESLLKLPTKW--MINS---EKPNSKRISSNKRALLLAQEAL 345

Query: 293 DMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQY 327
           DMV N++ V D TLG+AEEWVK+KQELK+++  Q+
Sbjct: 346 DMVGNVMNVVDGTLGKAEEWVKNKQELKQMLMEQF 380

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score =  218 bits (554), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/328 (41%), Positives = 185/328 (56%), Gaps = 64/328 (19%)

Query: 55  LCRMRQNPIFTNAVSLYEQTKSH------------HPNFRRRAELVERSASTMVRRTSEL 102
           +CR   N I TN  S +E+  S+            HPN   R     RS ST        
Sbjct: 115 VCR-NSNEILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSIST-------- 165

Query: 103 WAPRDGASKHRLEESCETG---TPLDDEVGPSPRVSKRQKIKE-------NLKEYRLTMS 152
               D  ++ +  +    G   T            SKR+ + E       NL+EY+LTMS
Sbjct: 166 -TGADADTESQGTQGSYNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLTMS 224

Query: 153 IESKKQLITCLHLLKLANRQLSSTVGSLQDLVQKEREDSGPRE--------------PEE 198
           IESKK+LITCLHLLKLAN+QLS  V  LQD V+KE+E +   E              P+ 
Sbjct: 225 IESKKRLITCLHLLKLANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSGPQN 284

Query: 199 EDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMP 258
           +D  +++DASE+ V + S ++ +E+VGTVKKVYSLIS++ GSSLPEPARSQVRE+LL +P
Sbjct: 285 DDDLEFYDASES-VDQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLNLP 343

Query: 259 TNWSLTVNSASRETPTNAR-----------------LSANSKMLILAEESLDMVSNIIQV 301
           +NW+ +V++  +   T                    +S+N K LILA+ESL+MV ++I V
Sbjct: 344 SNWNTSVHNGFKNNGTGIMTASSSTDSLSSYSSILPVSSNGKYLILAKESLNMVQSVIDV 403

Query: 302 FDMTLGRAEEWVKHKQELKELIKSQYME 329
            D TLGRAEEWVK KQELKE+IK +++E
Sbjct: 404 VDSTLGRAEEWVKQKQELKEMIKKKFLE 431

>Scas_709.57
          Length = 394

 Score =  192 bits (487), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/240 (46%), Positives = 156/240 (65%), Gaps = 44/240 (18%)

Query: 134 VSKRQKI-------KENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSLQ----- 181
           VSKR+K+       K+N KEY+L MSIESKK+LITCLHLLKLAN+QLS  V  LQ     
Sbjct: 144 VSKRRKLSEALLKSKDNFKEYKLNMSIESKKRLITCLHLLKLANKQLSDKVTFLQELVEE 203

Query: 182 -------DLVQKEREDSGPREPEEEDGEQ--------------YFDASETI-VSERSKEI 219
                  D    E+++   R  +++  E               +FDA+E++   E+   I
Sbjct: 204 EETVKEEDSHAIEKKEHVVRNKKQQHTEHEDDEDEDEDEDEDEFFDANESVNYDEKCTII 263

Query: 220 KMEVVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNS---------ASR 270
            ME+VGT+KKVYSL+S++ G+SLPEPAR+QVRE LL +PTNW+++VN+         A+ 
Sbjct: 264 NMEIVGTIKKVYSLVSKYGGTSLPEPARTQVREALLNLPTNWTISVNNSFFSSSTAPAAT 323

Query: 271 ETPTN-ARLSANSKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQYME 329
           E P +   L+ N K+LILA+ESL++V NI+ V D +LG+AEEWVK KQELKE+I+ Q+++
Sbjct: 324 EPPKDEPLLTTNGKVLILAKESLNVVRNIMDVVDSSLGKAEEWVKQKQELKEMIREQFLQ 383

>YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative
           regulator of phospholipid biosynthesis pathway [1215 bp,
           404 aa]
          Length = 404

 Score =  146 bits (369), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 25/160 (15%)

Query: 135 SKRQKI-------KENLKEYRLTMSIESKKQLITCLHLLKLANRQLSSTVGSLQDLVQKE 187
           +KRQK+       K+NLKEY+L MSIESKK+L+TCLHLLKLAN+QLS  +  LQDLV+KE
Sbjct: 108 NKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKE 167

Query: 188 ------REDSGPR-----------EPEEEDGEQYFDASETI-VSERSKEIKMEVVGTVKK 229
                 ++D   R             E++D E++FDASE +  SE+S  +KMEVVGTVKK
Sbjct: 168 QVHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDASEQVNASEQSIVVKMEVVGTVKK 227

Query: 230 VYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSAS 269
           VYSLIS+F  +SLPEPARSQVRE+LL +PTNW  +V+S S
Sbjct: 228 VYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTS 267

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 44/51 (86%)

Query: 278 LSANSKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQYM 328
           ++AN K+LILA+ESL+MV N++ V D TLG+AEEWVK KQE+KE+I+ +++
Sbjct: 326 VTANGKVLILAKESLEMVRNVMGVVDSTLGKAEEWVKQKQEVKEMIRERFL 376

>KLLA0B12474g 1091011..1091598 some similarities with sp|Q99278
           Saccharomyces cerevisiae YMR112c MED11 mediator complex
           subunit singleton, hypothetical start
          Length = 195

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 12/72 (16%)

Query: 157 KQLITCLHLLKLANRQLSSTVGSLQDLVQKEREDSGPREPEEEDGEQYFDASETIVSERS 216
           KQL+  LH       + S TV SL DL +K  E+S P+   +++ ++++D  E+   +  
Sbjct: 98  KQLVDVLH-------RASLTVSSLIDL-KKRNEESKPQF--QQNAQEFYDDLESATVQLR 147

Query: 217 KEIKM--EVVGT 226
           KEIK+  E VGT
Sbjct: 148 KEIKLLDENVGT 159

>YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase involved
            in regulation of cell growth and sensitivity to the
            immunosuppressant rapamycin, has a region of similarity
            to the catalytic domain of phosphatidylinositol kinases
            [7413 bp, 2470 aa]
          Length = 2470

 Score = 32.0 bits (71), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 6/73 (8%)

Query: 67   AVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELW------APRDGASKHRLEESCET 120
            A+S+ E+ + H P    +AELV      +     ELW      A R    +H +E+   T
Sbjct: 1928 ALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASRQFFVEHNIEKMFST 1987

Query: 121  GTPLDDEVGPSPR 133
              PL   +G  P+
Sbjct: 1988 LEPLHKHLGNEPQ 2000

>CAGL0K00517g complement(54918..62333) similar to sp|P32600
            Saccharomyces cerevisiae YKL203c, Phosphatidylinositol
            3-kinase, hypothetical start
          Length = 2471

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 18/125 (14%)

Query: 67   AVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELWA-PRDGASKHRLEES-----CET 120
            A+S+ +  +SH P    +AEL+ R    +V   +E+W    + AS+H   E+      ET
Sbjct: 1929 AISIIDNVRSHSPVLVDQAELLSRELIRVVALWNEMWYEGLEDASRHFFGENDNTKMLET 1988

Query: 121  GTPLDDEVGPSPRVSKRQKIK-----------ENLKEYRLTMSIESKKQLITCLH-LLKL 168
              PL + +   P   +    K           E +K+Y+ T  + +  Q     + + K 
Sbjct: 1989 LEPLYELLNKGPETIREISFKYAFGKDLTYAYEWVKKYKETGEVSNLNQAWDIYYSIFKK 2048

Query: 169  ANRQL 173
             N+QL
Sbjct: 2049 INKQL 2053

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.126    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,681,861
Number of extensions: 365072
Number of successful extensions: 1466
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1446
Number of HSP's successfully gapped: 49
Length of query: 350
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 247
Effective length of database: 13,030,455
Effective search space: 3218522385
Effective search space used: 3218522385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)