Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABR029W1198117662660.0
KLLA0B06303g1203117454310.0
Kwal_14.14921197117954100.0
YPR010C (RPA135)1203118253160.0
Scas_707.471200118053030.0
CAGL0J01848g1202118152970.0
Scas_70.125923410921e-140
YOR207C (RET1)114910429331e-107
YOR151C (RPB2)122411388521e-95
CAGL0L04246g122311458423e-94
Scas_714.41122411408371e-93
Kwal_26.855311714127025e-76
ADL275C11414117006e-76
Scas_605.1411504116981e-75
KLLA0F01078g11424116935e-75
CAGL0L02849g11334016935e-75
KLLA0B05577g12214386644e-71
Kwal_47.1878312204386611e-70
AFR404C12224386512e-69
KLLA0C09108g20882702.9
YNL230C (ELA1)37954694.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR029W
         (1176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH] complement...  2418   0.0  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...  2096   0.0  
Kwal_14.1492                                                         2088   0.0  
YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA pol...  2052   0.0  
Scas_707.47                                                          2047   0.0  
CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharo...  2045   0.0  
Scas_70.1                                                             425   e-140
YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polym...   363   e-107
YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polym...   332   1e-95
CAGL0L04246g complement(493026..496697) highly similar to sp|P08...   328   3e-94
Scas_714.41                                                           327   1e-93
Kwal_26.8553                                                          275   5e-76
ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..22...   274   6e-76
Scas_605.14                                                           273   1e-75
KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharom...   271   5e-75
CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharo...   271   5e-75
KLLA0B05577g complement(501690..505355) highly similar to sp|P08...   260   4e-71
Kwal_47.18783                                                         259   1e-70
AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH] (1162949..1...   255   2e-69
KLLA0C09108g complement(795433..796059) similar to sp|P25631 Sac...    32   2.9  
YNL230C (ELA1) [4376] chr14 complement(217522..218661) Elongin A...    31   4.9  

>ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH]
            complement(450645..454241) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2418 bits (6266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1161/1176 (98%), Positives = 1161/1176 (98%)

Query: 1    MSVMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLL 60
            MSVMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLL
Sbjct: 1    MSVMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLL 60

Query: 61   NLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEA 120
            NLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEA
Sbjct: 61   NLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEA 120

Query: 121  RKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEE 180
            RKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEE
Sbjct: 121  RKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEE 180

Query: 181  SDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQ 240
            SDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQ
Sbjct: 181  SDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQ 240

Query: 241  TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300
            TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL
Sbjct: 241  TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300

Query: 301  ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDEN 360
            ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDEN
Sbjct: 301  ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDEN 360

Query: 361  TDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKLQ 420
            TDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKLQ
Sbjct: 361  TDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKLQ 420

Query: 421  IQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVV 480
            IQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVV
Sbjct: 421  IQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVV 480

Query: 481  AEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAH 540
            AEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAH
Sbjct: 481  AEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAH 540

Query: 541  KCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADT 600
            KCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADT
Sbjct: 541  KCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADT 600

Query: 601  LRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPF 660
            LRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPF
Sbjct: 601  LRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPF 660

Query: 661  EQVYMDIAVTPEENPLITSILMLNFHQQIILSIXXXXXXXXXXXXXXXKICTNYQMGKQT 720
            EQVYMDIAVTPEENPLITSILMLNFHQQIILSI               KICTNYQMGKQT
Sbjct: 661  EQVYMDIAVTPEENPLITSILMLNFHQQIILSILANLTPFLLTLTNLPKICTNYQMGKQT 720

Query: 721  MGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDD 780
            MGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDD
Sbjct: 721  MGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDD 780

Query: 781  AMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGL 840
            AMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGL
Sbjct: 781  AMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGL 840

Query: 841  PIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKY 900
            PIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKY
Sbjct: 841  PIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKY 900

Query: 901  RIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVE 960
            RIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVE
Sbjct: 901  RIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVE 960

Query: 961  SLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRAD 1020
            SLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRAD
Sbjct: 961  SLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRAD 1020

Query: 1021 IYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTS 1080
            IYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTS
Sbjct: 1021 IYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTS 1080

Query: 1081 FLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQ 1140
            FLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQ
Sbjct: 1081 FLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQ 1140

Query: 1141 DSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
            DSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV
Sbjct: 1141 DSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
            Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
            polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 2096 bits (5431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 985/1174 (83%), Positives = 1073/1174 (91%), Gaps = 15/1174 (1%)

Query: 10   NRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNLGARDIGA 69
            NRTA FRTLERE+RF++PPKDKSAYP L +AV+PH+GSFNALTEGP GGLLNLGA+DIG+
Sbjct: 16   NRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGS 75

Query: 70   KVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEARKRLTTYRG 129
            KV+FDGK SD NPNYLGNKL+LS+ QVS++KP SNDGV++A ER VFP+E+R+RLT+YRG
Sbjct: 76   KVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRG 135

Query: 130  KLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEESDELGGYFI 189
            K+LLKL WSVNDGEETF+EVRDCG LP+MLQSNRCHL+KMSP ELVEH+EESDE GGYFI
Sbjct: 136  KILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFI 195

Query: 190  VNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQTNVLHYLND 249
            VNGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYS YG+QIR VRPDQTSQTNVLHYLND
Sbjct: 196  VNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLND 255

Query: 250  GQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRLELLLRGFKK 309
            GQVTFRFSWRKNEYL+PVV+IL+AL D +DREIFD +VG DTSNSFLTDRLELLLRGFKK
Sbjct: 256  GQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFLTDRLELLLRGFKK 315

Query: 310  RFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDENTDKSNMLMF 369
            R+P L NR+Q LQYLGDKFRVV QASPDM+D  VGQELL RIVLVHLG+ N DK NML+F
Sbjct: 316  RYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHLGENNKDKFNMLLF 375

Query: 370  MIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKLQIQADVNRGM 429
            MIRKLYSLVAGEC PDNPDA QHQE+LLGGFLYGMIVKEKIEEYLQNI+LQIQ D+NRG+
Sbjct: 376  MIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDINRGL 435

Query: 430  PVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF 489
             ++FKD+KYM +VL R+NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF
Sbjct: 436  AINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF 495

Query: 490  ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCKISTTQS 549
            ISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTPDGSPCGLLNH +HKCKIST QS
Sbjct: 496  ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQS 555

Query: 550  DVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADTLRYWKVEGK 609
            DVSKIP++LYSLGV+PAAHV AAGPS+CCVQLDGKI+GWCSHEQG++VADTLR+WKVEGK
Sbjct: 556  DVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQGKVVADTLRFWKVEGK 615

Query: 610  TDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPFEQVYMDIAV 669
            T GLP+DLE+GYVP +  GQYPGL+LFGGHSRMMRPVRYLPLDK+DIVGPFEQVYM+IAV
Sbjct: 616  TPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAV 675

Query: 670  TPEENPLITSILMLNFHQQI------ILSIXXXXXXXXXXXXXXXKICTNYQMGKQTMGT 723
            TPEE       +  N H  +      ILSI                +    QMGKQTMGT
Sbjct: 676  TPEE-------IENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNM-YQCQMGKQTMGT 727

Query: 724  PGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI 783
            PGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI
Sbjct: 728  PGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI 787

Query: 784  INKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGLPII 843
            INKSADERGF YGT+YK EK++LS++R RGDP+TQHFGFGTDEWPKEWLEKLD+DGLP+I
Sbjct: 788  INKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKLDDDGLPLI 847

Query: 844  GSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKYRIR 903
            G+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+KFQELQ ITIKYRIR
Sbjct: 848  GTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIR 907

Query: 904  RVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 963
            R PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA
Sbjct: 908  RTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 967

Query: 964  GKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYI 1023
            GKAGALHGIAQD+TPWTF+E DTPADYFGDQL KAGYNYHGNEPMYSGATGEELRADIYI
Sbjct: 968  GKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYI 1027

Query: 1024 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1083
            GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL
Sbjct: 1028 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1087

Query: 1084 QDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQDS- 1142
            QDRLLN SDYTQ+AVCR+CG+ILTTQSSVPKIGS+ T+RCRRCA+ FDEAK++IT+ +S 
Sbjct: 1088 QDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKRLITKYESG 1147

Query: 1143 EDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
             + + I DS IWEDGQGNKFVGGGNTTTVAIPFV
Sbjct: 1148 SEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFV 1181

>Kwal_14.1492
          Length = 1197

 Score = 2088 bits (5410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 987/1179 (83%), Positives = 1075/1179 (91%), Gaps = 7/1179 (0%)

Query: 1    MSVMEPLSAN-RTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGL 59
            MS +  L AN RTA FRT+ERE RFV+PPKDKSA+PLL EAVEPH+GSFNALTEGP GGL
Sbjct: 1    MSKVVKLPANARTAHFRTVERENRFVNPPKDKSAFPLLREAVEPHIGSFNALTEGPEGGL 60

Query: 60   LNLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAE 119
            LN   +DIG K+VFDG++S+EN NYLGNKL LSV QVS++KP+SNDGVT+A ER ++PAE
Sbjct: 61   LNQAVKDIGGKIVFDGRSSEENSNYLGNKLTLSVEQVSISKPVSNDGVTSAVERKIYPAE 120

Query: 120  ARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKE 179
            +R+RL++YRGKLLLKL WSVNDGEE+F+E++DCG LPVMLQSNRCHL+ +SP ELV++KE
Sbjct: 121  SRQRLSSYRGKLLLKLKWSVNDGEESFTEIKDCGGLPVMLQSNRCHLNNLSPNELVKNKE 180

Query: 180  ESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTS 239
            ESDELGGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF+NRG SYS YG+QIR VRPDQTS
Sbjct: 181  ESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFSNRGASYSQYGIQIRSVRPDQTS 240

Query: 240  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDR 299
            QTNVLHYLNDG+VTFRFSWRKNEYL+PVV+ILKAL + +DREIFDGIVG+DTSNSFLTDR
Sbjct: 241  QTNVLHYLNDGEVTFRFSWRKNEYLIPVVMILKALCELNDREIFDGIVGSDTSNSFLTDR 300

Query: 300  LELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDE 359
            LELLLRG KK++ QL NRRQVLQYLGDKFRVVLQASPD +D+ VG+ELL RIVLVHLG  
Sbjct: 301  LELLLRGHKKKYGQLQNRRQVLQYLGDKFRVVLQASPDATDFQVGEELLSRIVLVHLGGN 360

Query: 360  NTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKL 419
            N DKS ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKIEEYLQNI+L
Sbjct: 361  NEDKSRMLLFMIRKLYSLVAGECAPDNPDATQHQEVLLGGFLYGMIIKEKIEEYLQNIRL 420

Query: 420  QIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTV 479
            QIQ+DVNRG+ V+FK+RKYM RVL R+NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTV
Sbjct: 421  QIQSDVNRGLAVNFKERKYMNRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTV 480

Query: 480  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 539
            VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA
Sbjct: 481  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 540

Query: 540  HKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVAD 599
            HKCKISTTQSDVS+IP LLYSLGV+PA+H  AAGP+ CCVQLDGKIVGWCSHEQG+I+AD
Sbjct: 541  HKCKISTTQSDVSRIPALLYSLGVAPASHTVAAGPTACCVQLDGKIVGWCSHEQGKIIAD 600

Query: 600  TLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGP 659
            TLR+WKVEG+T GLPLDLEIGYVP S RGQYPGLYLFGGHSRMMRPV+YLPL K+DIVGP
Sbjct: 601  TLRFWKVEGETAGLPLDLEIGYVPPSSRGQYPGLYLFGGHSRMMRPVKYLPLGKEDIVGP 660

Query: 660  FEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSIXXXXXXXXXXXXXXXKICTNYQMG 717
            FEQVYM+IAVTP+E  N + T +    F    ILSI                +    QMG
Sbjct: 661  FEQVYMNIAVTPQEIQNNIHTHV---EFTPTNILSILANLTPFSDFNQSPRNM-YQCQMG 716

Query: 718  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 777
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYTGYD
Sbjct: 717  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTGYD 776

Query: 778  MDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDE 837
            MDDAMIINKSADERGF YGT+YK EKIDLS++R RGDP+TQHFGFG DEWPK WLEKLD+
Sbjct: 777  MDDAMIINKSADERGFGYGTMYKVEKIDLSMNRSRGDPITQHFGFGDDEWPKGWLEKLDD 836

Query: 838  DGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYIT 897
            DGLPIIG+YVEEGDPICA+FDDTLNKTKIKTYHSSEPAYIEEV LIGDES+KFQELQ I+
Sbjct: 837  DGLPIIGTYVEEGDPICAFFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESSKFQELQTIS 896

Query: 898  IKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 957
            IKYRIRR PQIGDKFSSRHGQKGVCSRKWPTVDMPFSE+G+QPD+IINPHAFPSRMTIGM
Sbjct: 897  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSESGMQPDIIINPHAFPSRMTIGM 956

Query: 958  FVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEEL 1017
            FVESLAGKAGALHG+A DATPWTFSE+DTPA+YFGDQLL AGYNYHGNEPMYSGATGEEL
Sbjct: 957  FVESLAGKAGALHGMAHDATPWTFSEKDTPANYFGDQLLSAGYNYHGNEPMYSGATGEEL 1016

Query: 1018 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1077
            RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1017 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1076

Query: 1078 GTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKII 1137
            GTSFLLQDRLLN SDYTQSAVCRECGS+LTT  SVP+IGS+ T+RCRRCA+ FDEAKKI+
Sbjct: 1077 GTSFLLQDRLLNCSDYTQSAVCRECGSLLTTHYSVPRIGSLATVRCRRCAVKFDEAKKIV 1136

Query: 1138 TQQDSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
             +   ED IFIDDSHIWEDGQGNKFVGGG TTTVAIPFV
Sbjct: 1137 AKYQGEDQIFIDDSHIWEDGQGNKFVGGGQTTTVAIPFV 1175

>YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA
            polymerase I second largest subunit [3612 bp, 1203 aa]
          Length = 1203

 Score = 2052 bits (5316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 974/1182 (82%), Positives = 1067/1182 (90%), Gaps = 12/1182 (1%)

Query: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62
            V++P    RTA FRTLERE+RF++PPKDKSA+PLL EAV+PH+GSFNALTEGP GGLLNL
Sbjct: 4    VIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNL 63

Query: 63   GARDIGAKVVFDGK---ASDE--NPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFP 117
            G +DIG KV+FDGK   + DE  N  YLGNKL++SV QVS+ KPMSNDGV++A ER V+P
Sbjct: 64   GVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYP 123

Query: 118  AEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEH 177
            +E+R+RLT+YRGKLLLKL WSVN+GEE   EVRDCG LPVMLQSNRCHL+KMSP ELV+H
Sbjct: 124  SESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQH 183

Query: 178  KEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQ 237
            KEESDE+GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYSHYG+QIR VRPDQ
Sbjct: 184  KEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQ 243

Query: 238  TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLT 297
            TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVV+ILKAL   SDREIFDGI+G D  +SFLT
Sbjct: 244  TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLT 303

Query: 298  DRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLG 357
            DRLELLLRGFKKR+P L NR QVLQYLGDKFRVV QASPD SD  VGQE+L RIVLVHLG
Sbjct: 304  DRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLG 363

Query: 358  -DENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQN 416
             D + DK  ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQN
Sbjct: 364  KDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQN 423

Query: 417  IKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSG 476
            I  Q++ D+NRGM ++FKD++YM+RVL R+NENIGSK+QYFLSTGNLVSQSGLDLQQVSG
Sbjct: 424  IIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSG 483

Query: 477  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 536
            YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN
Sbjct: 484  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 543

Query: 537  HFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRI 596
            HFAHKC+IST QSDVS+IP++LYSLGV+PA+H  AAGPSLCCVQ+DGKI+GW SHEQG+I
Sbjct: 544  HFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKI 603

Query: 597  VADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDI 656
            +ADTLRYWKVEGKT GLP+DLEIGYVP S RGQYPGLYLFGGHSRM+RPVRYLPLDK+DI
Sbjct: 604  IADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDKEDI 663

Query: 657  VGPFEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSIXXXXXXXXXXXXXXXKICTNY 714
            VGPFEQVYM+IAVTP+E  N + T +    F    ILSI                +    
Sbjct: 664  VGPFEQVYMNIAVTPQEIQNNVHTHV---EFTPTNILSILANLTPFSDFNQSPRNM-YQC 719

Query: 715  QMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYT 774
            QMGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYT
Sbjct: 720  QMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYT 779

Query: 775  GYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEK 834
            GYDMDDAMIINKSADERGF YGT+YKTEK+DL+L+R RGDP+TQHFGFG DEWPKEWLEK
Sbjct: 780  GYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEK 839

Query: 835  LDEDGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQ 894
            LDEDGLP IG+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDESNKFQELQ
Sbjct: 840  LDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQ 899

Query: 895  YITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMT 954
             ++IKYRIRR PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPD+IINPHAFPSRMT
Sbjct: 900  TVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMT 959

Query: 955  IGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATG 1014
            IGMFVESLAGKAGALHGIAQD+TPW F+E+DTPADYFG+QL KAGYNYHGNEPMYSGATG
Sbjct: 960  IGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATG 1019

Query: 1015 EELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL 1074
            EELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL
Sbjct: 1020 EELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL 1079

Query: 1075 IGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAK 1134
            IGHGTSFLLQDRLLNSSDYTQ++VCRECGSILTTQ SVP+IGS+ T+ CRRC++ F++AK
Sbjct: 1080 IGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAK 1139

Query: 1135 KIITQQDSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
            K++T+ +  + IFIDDS IWEDGQGNKFVGG  TTTVAIPFV
Sbjct: 1140 KLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFV 1181

>Scas_707.47
          Length = 1200

 Score = 2047 bits (5303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 972/1180 (82%), Positives = 1059/1180 (89%), Gaps = 10/1180 (0%)

Query: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62
            V++P S  RTA FRTLERE+RF++PPKDKSAYPLL EAVEPHVGSFNALTEGP GGLLN 
Sbjct: 4    VIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGLLNQ 63

Query: 63   GARDIGAKVVFDGKA---SDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAE 119
            G +DIG KV+FDGK         +YLGNKL++SV QVS+ KP SNDGV++A ER VFP+E
Sbjct: 64   GVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVFPSE 123

Query: 120  ARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKE 179
            +R+RL +Y+GKL+LKL WSVNDGEETF+EVRDCG LPVMLQSNRCHL+K+SP ELV+HKE
Sbjct: 124  SRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQHKE 183

Query: 180  ESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTS 239
            ESDELGGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRG +Y+ +G+Q+R VRPDQTS
Sbjct: 184  ESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPDQTS 243

Query: 240  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDR 299
            QTNVLHYLNDGQVTFRFSWRKNEYLVPVV+ILKAL D SDREIFDGI+G+D  +SFLTDR
Sbjct: 244  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFLTDR 303

Query: 300  LELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGD- 358
            LELLLRGFKKR+P L NR QVLQ+LGDKFRVV QASPD SDY VGQE+L RIVLVHLG  
Sbjct: 304  LELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHLGKG 363

Query: 359  ENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIK 418
             N DK  ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQNI 
Sbjct: 364  NNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQNII 423

Query: 419  LQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT 478
             QI+ D NRG+ ++FKDRKYM+RVL R+NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT
Sbjct: 424  QQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT 483

Query: 479  VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF 538
            VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF
Sbjct: 484  VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF 543

Query: 539  AHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVA 598
            AHKCKIST QSDVS+IP LLY LGVSPA+H  AAGPS CCVQ+DGKI+GW SHEQG+I+A
Sbjct: 544  AHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGKIIA 603

Query: 599  DTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVG 658
            DTLR+WKVEGK  GLPLDLEIGYVP S RGQYPGLY+FGGHSRMMRPVRYLPLDK+DIVG
Sbjct: 604  DTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVG 663

Query: 659  PFEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSIXXXXXXXXXXXXXXXKICTNYQM 716
            PFEQVYM++AVTP+E  N + T +    F    ILSI                +    QM
Sbjct: 664  PFEQVYMNVAVTPQEIENNVHTHV---EFTPTNILSILANLTPFSDFNQSPRNM-YQCQM 719

Query: 717  GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 776
            GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY
Sbjct: 720  GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 779

Query: 777  DMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLD 836
            DMDDAMIINKSADERGF YGT+YK EK+DLSL+R RGDP+TQHFGFG DEWPKEWL+KLD
Sbjct: 780  DMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLD 839

Query: 837  EDGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYI 896
            +DGLP IG+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDESNKFQELQ +
Sbjct: 840  DDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTV 899

Query: 897  TIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG 956
            +IKYRIRR PQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG
Sbjct: 900  SIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG 959

Query: 957  MFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEE 1016
            MFVESLAGK+GALHG+AQDATPW F+E+DTPADYFGDQL+KAGYNYHGNEPMYSGATGEE
Sbjct: 960  MFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEE 1019

Query: 1017 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1076
            LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG
Sbjct: 1020 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1079

Query: 1077 HGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKI 1136
            HGTSFLLQDRLLN SDYTQ++VCRECGSILTTQ SVP+IGS+ T+ CRRCA+ FDEAK +
Sbjct: 1080 HGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSM 1139

Query: 1137 ITQQDSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
            + + +   ++FIDDS IWEDGQGNKFVGG +TTTVAIPFV
Sbjct: 1140 LAKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFV 1179

>CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharomyces
            cerevisiae YPR010c RPA135, start by similarity
          Length = 1202

 Score = 2045 bits (5297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 969/1181 (82%), Positives = 1064/1181 (90%), Gaps = 11/1181 (0%)

Query: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62
            V++P S  RTA FRTLERE RF +PPKDKSAYPLL EAV+PHVGSFNALTEGP GGLL  
Sbjct: 4    VIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGLLQR 63

Query: 63   GARDIGAKVVFDGKA--SDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEA 120
               DIG KV+FDGK+  SDE  +YLGNKL++SV QVS+ KP +NDGV  AAER V+P+EA
Sbjct: 64   AVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAERPVYPSEA 123

Query: 121  RKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEE 180
            R+RLT+YRGK+LLKL WSVNDGE  FSEVRDCG LP+MLQSNRCHL+KMSP ELV+HKEE
Sbjct: 124  RQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQHKEE 183

Query: 181  SDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQ 240
            SDELGGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYS YG+QIR VRPDQTSQ
Sbjct: 184  SDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQ 243

Query: 241  TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300
            TNVLHYLNDGQVTFRFSWRKNEYL+PVV+I+KAL D SDREIFDGI+G++T+NSFLTDRL
Sbjct: 244  TNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFLTDRL 303

Query: 301  ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDE- 359
            ELLLRGFKKR+PQL NR QVLQYLGDKFR+V QASPD SDY VGQE+L RIVLVHLG   
Sbjct: 304  ELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHLGSNG 363

Query: 360  NTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKL 419
            N DK  ML+FM+RKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQ I  
Sbjct: 364  NMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQGIVA 423

Query: 420  QIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTV 479
            Q++ D+NRG+ ++F ++KYM+RVL R+N+NIGSK+QYFLSTGNLVSQSGLDLQQVSGYTV
Sbjct: 424  QVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVSGYTV 483

Query: 480  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 539
            VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA
Sbjct: 484  VAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFA 543

Query: 540  HKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVAD 599
            HKC+ISTTQSDVSK+P LLYSLGV+PA+H  AAGPSLCCVQLDGKI+GW SHEQGR++AD
Sbjct: 544  HKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRVIAD 603

Query: 600  TLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGP 659
            TLR+WKVEG+T GLP DLEIGYVP S +GQYPGLY+FGGHSRMMRPVRYLPLDK+DIVGP
Sbjct: 604  TLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGP 663

Query: 660  FEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSIXXXXXXXXXXXXXXXKICTNYQMG 717
            FEQVYM+IAVTP+E  N + T +    F    ILSI                +    QMG
Sbjct: 664  FEQVYMNIAVTPQEIQNNIHTHV---EFSPTNILSILANLTPFSDFNQSPRNM-YQCQMG 719

Query: 718  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 777
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD
Sbjct: 720  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 779

Query: 778  MDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDE 837
            MDDAMIINKSADERGF YGT+YK EK+DLSL+R RGDPVTQHFGFGTDEWPKEWL+KLDE
Sbjct: 780  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDE 839

Query: 838  DGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYIT 897
            DGLP IG+YVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEV LIGDESNKFQELQ ++
Sbjct: 840  DGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 899

Query: 898  IKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 957
            IKYRIRR PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGM
Sbjct: 900  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGM 959

Query: 958  FVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEEL 1017
            FVESLAGKAGALHGIAQD+TPW F+E+DTPADYFG+QLLKAGYNYHGNEPMYSGATGEEL
Sbjct: 960  FVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEEL 1019

Query: 1018 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1077
            R DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1020 RCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1079

Query: 1078 GTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKII 1137
            GTSFLLQDRLLNSSDYTQ+A+CRECGSILTTQ +VP+IG++ ++ CRRCA+ F++AKK +
Sbjct: 1080 GTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTL 1139

Query: 1138 TQQD--SEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFV 1176
             + +  +E+ IFIDDS IWEDGQG KFVGG +TTTVAIPFV
Sbjct: 1140 FEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFV 1180

>Scas_70.1
          Length = 259

 Score =  425 bits (1092), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 220/234 (94%)

Query: 290 DTSNSFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLR 349
           DTSNSFLTDRLELLLRGFKK++PQL NRRQVLQYLGDKFRVV QASPDM+DY VG+E+LR
Sbjct: 12  DTSNSFLTDRLELLLRGFKKKYPQLQNRRQVLQYLGDKFRVVFQASPDMTDYQVGEEVLR 71

Query: 350 RIVLVHLGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEK 409
           RIVLVHLG++  DK +ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMIVKEK
Sbjct: 72  RIVLVHLGEDGKDKFHMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIVKEK 131

Query: 410 IEEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGL 469
           IEEYLQNI+LQIQADVNRG+ V+FKDRKYMTRVL R+NENIGSKLQYFLSTGNLVSQSGL
Sbjct: 132 IEEYLQNIRLQIQADVNRGLAVNFKDRKYMTRVLMRVNENIGSKLQYFLSTGNLVSQSGL 191

Query: 470 DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCP 523
           DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPE  G   P
Sbjct: 192 DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPEILGVPMP 245

>YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polymerase
            III, second-largest subunit (C128) [3450 bp, 1149 aa]
          Length = 1149

 Score =  363 bits (933), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 309/1042 (29%), Positives = 477/1042 (45%), Gaps = 112/1042 (10%)

Query: 117  PAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVE 176
            P E R R  TY   + + + ++         +V + G +P+ML+SN+C L+     ++ +
Sbjct: 115  PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDV-EIGRMPIMLRSNKCILYDADESKMAK 173

Query: 177  HKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPD 236
              E   + GGYFIVNG EK+I   +VQ +     II  +   +G       VQ       
Sbjct: 174  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGI------VQASVTSST 224

Query: 237  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFL 296
               ++       +G++  + +    E  +P+ ++LKA    SD EI   + G D+S    
Sbjct: 225  HERKSKTYVITKNGKIYLKHNSIAEE--IPIAIVLKACGILSDLEIMQLVCGNDSS---Y 279

Query: 297  TDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHL 356
             D   + L    K    +  ++Q L+Y+G K + + +    ++    G E +   V+ HL
Sbjct: 280  QDIFAVNLEESSKL--DIYTQQQALEYIGAKVKTMRRQK--LTILQEGIEAIATTVIAHL 335

Query: 357  GDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEY 413
              E  D   K+  +  M R++   +      D+ D   ++ + L G L  ++ ++  +++
Sbjct: 336  TVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKF 395

Query: 414  LQNIKLQIQADV---NRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFLSTGNLVSQS 467
              + KL I   +   NR M  D          L  IN    NI S L   +STGN  S  
Sbjct: 396  NNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-SLK 445

Query: 468  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVH 525
               +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   
Sbjct: 446  RFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTAD 501

Query: 526  TPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCC-VQLDGK 584
            TP+G  CGL+ + A    I TT  +   I  L Y LGV     + +A   L   V L+G 
Sbjct: 502  TPEGEACGLVKNLALMTHI-TTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGT 560

Query: 585  IVGWCSHEQGRIVADTLRYWKVEGKTDGL------PLDLEIGYVPASKRGQYPGLYLFGG 638
            ++G        +     R+ +  GK             + +       R   P + +  G
Sbjct: 561  LIGSIRFPTKFVTQ--FRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDG 618

Query: 639  HSRM----MRPVRYLPLDKQDIVGPFEQVYMDIA------VTPEENPLITSILMLNFHQQ 688
             SR+    +R +    LD  D +      Y+D+       +   E  ++ S+  L     
Sbjct: 619  QSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEIEPF 678

Query: 689  IILSIXXXXXXXXXXXXXXXKICTNYQ--MGKQTMGTPGVALCHRSDNKLYRLQSGQTPI 746
             IL                      YQ  MGKQ +G        R D  LY +   Q P+
Sbjct: 679  TILGAVAGLIPYPHHNQSPR---NTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPM 735

Query: 747  VKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFSYGTVYKTEKIDL 806
            VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGF  G      K   
Sbjct: 736  VKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGF--GRCETRRKTTT 793

Query: 807  SLSR---------------GRGDPVTQHFGFGTDEWPKEWLEKLDEDGLPIIGS--YVEE 849
             L R                 GDP+ QH   G D         L E G+ +     Y+ +
Sbjct: 794  VLKRYANHTQDIIGGMRVDENGDPIWQHQSLGPD--------GLGEVGMKVQSGQIYINK 845

Query: 850  GDPICAYFDDTLNKTKIKT--------YHSSEPAYIEEVTLIGDESNKFQELQYITIKYR 901
              P  +      N   ++T        Y   EP++I++V +   ++++      I +  R
Sbjct: 846  SVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQ----ALIKVLLR 901

Query: 902  IRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVES 961
              R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E 
Sbjct: 902  QNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIEL 961

Query: 962  LAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADI 1021
            ++GKAG L+G  +  T +  S+ +  +    DQ    G+NY G + +YSG TGE L+A I
Sbjct: 962  ISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQ----GFNYSGKDMLYSGITGECLQAYI 1017

Query: 1022 YIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSF 1081
            + G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S 
Sbjct: 1018 FFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQ 1077

Query: 1082 LLQDRLLNSSDYTQSAVCRECG 1103
            LL +RL+ SSD  +  VC +CG
Sbjct: 1078 LLLERLMISSDAFEVDVCDKCG 1099

>YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polymerase
            II, second-largest subunit [3675 bp, 1224 aa]
          Length = 1224

 Score =  332 bits (852), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 317/1138 (27%), Positives = 487/1138 (42%), Gaps = 173/1138 (15%)

Query: 85   LGNKLALSVTQVSLTKPMSN--DGVTAAAERNVFPAEARKRLTTYRGKLLLKLNWSVNDG 142
            +  K  +S  ++ +TKPM N  DGVT A    ++P EAR R  TY   L + +     + 
Sbjct: 84   ISRKYEISFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVKKRTYEA 139

Query: 143  ----------EETFSEVRD--------CGPLPVMLQSNRCHLHKMSPQELVEHKEESDEL 184
                      E    E  D         G LP+ML+S  C+L + +  +L + KE   ++
Sbjct: 140  IDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDM 199

Query: 185  GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCV-----RPDQTS 239
            GGYFI+NG EK+   LI Q R+     I   F     S   +  +IR       R   T 
Sbjct: 200  GGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTL 254

Query: 240  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDR 299
            Q  +         T + +    +  +P+V+I +AL    D EI + I   D ++  +   
Sbjct: 255  QVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDWQM--- 310

Query: 300  LELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH---L 356
            LE+L    +  F  + +R   L ++G +   +         Y   +++L++  L H   L
Sbjct: 311  LEMLKPCVEDGFV-IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHITQL 367

Query: 357  GDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQN 416
                + K+  L +MI +L          D+ D    + + L G L   + K   ++  ++
Sbjct: 368  EGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKD 427

Query: 417  IKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSG 476
            I   +Q  V      + K        L    + I S L+Y L+TGN   Q    +   +G
Sbjct: 428  IFRYMQRTVEEAHDFNMK--------LAINAKTITSGLKYALATGNWGEQKKA-MSSRAG 478

Query: 477  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 536
             + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL+ 
Sbjct: 479  VSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVK 537

Query: 537  HFAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWCSHEQGR 595
            + +    IS   +D   I T L   G+ P   +V    P    V ++G  V    H    
Sbjct: 538  NLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNG--VWHGVHRNPA 594

Query: 596  IVADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV--------- 646
             + +TLR  + +G      ++ E+  +   +  +   L +F    R+ RP+         
Sbjct: 595  RLMETLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRVYRPLFIVEDDESL 646

Query: 647  -------------RYLPLDKQDIVGPFEQV---------------YMD--------IAVT 670
                         + +  + QDI G FE V               Y+D        IA+ 
Sbjct: 647  GHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQ 706

Query: 671  PE---------ENPL-------------ITSILMLNFHQQIILSIXXXXXXXXXXXXXXX 708
            PE         EN L              T+      H  +IL +               
Sbjct: 707  PEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPR 766

Query: 709  KICTNYQ--MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNA 766
                 YQ  MGKQ MG        R D     L   Q P+      +       P G NA
Sbjct: 767  ---NTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNA 823

Query: 767  VVAVISYTGYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFG----F 822
            +VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  +T+ F      
Sbjct: 824  IVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMSITETFEKPQRT 880

Query: 823  GTDEWPKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKTYHS---- 871
             T        +KLD+DGL   G  V   D       PI    ++   +T    YHS    
Sbjct: 881  NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRT---AYHSKRDA 937

Query: 872  ------SEPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRK 925
                  +E   +++V +  ++      L+++ ++ R  ++PQIGDKF+SRHGQKG     
Sbjct: 938  STPLRSTENGIVDQVLVTTNQDG----LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGIT 993

Query: 926  WPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEED 985
            +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+T    D
Sbjct: 994  YRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----D 1049

Query: 986  TPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTG 1045
               +     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ G
Sbjct: 1050 ITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARG 1109

Query: 1046 PVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
            P+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG
Sbjct: 1110 PMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICG 1167

>CAGL0L04246g complement(493026..496697) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, hypothetical start
          Length = 1223

 Score =  328 bits (842), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 318/1145 (27%), Positives = 487/1145 (42%), Gaps = 186/1145 (16%)

Query: 85   LGNKLALSVTQVSLTKPMSN--DGVTAAAERNVFPAEARKRLTTYRGKLLLKLNWSVNDG 142
            +  K  +S  ++ +TKPM N  DGVT A    ++P EAR R  TY   L + +       
Sbjct: 82   ISRKYEISFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVT------ 131

Query: 143  EETFSEV----RD--------------------CGPLPVMLQSNRCHLHKMSPQELVEHK 178
            + T+  V    RD                     G LP+ML+S  C+L   +  +L + K
Sbjct: 132  KRTYEAVDVPGRDLNYQLIAEESEEDSESGKVFIGRLPIMLRSKNCYLSDATESDLYKLK 191

Query: 179  EESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCV----- 233
            E   ++GGYFI+NG EK+   LI Q R+     I   F     S   +  +IR       
Sbjct: 192  ECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGS 246

Query: 234  RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSN 293
            R   T Q  +    +    T + +    +  +P+V+I +AL    D EI + I   D ++
Sbjct: 247  RFISTLQVKLYGRESSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVND 305

Query: 294  SFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVL 353
              +   LE+L    +  F  + +R   L ++G +   +         Y   +++L++  L
Sbjct: 306  WQM---LEMLKPCVEDGFV-IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFL 359

Query: 354  VH---LGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKI 410
             H   L    + K+  L +MI +L          D+ D    + + L G L   + K   
Sbjct: 360  PHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLF 419

Query: 411  EEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLD 470
             +  ++I   +Q  V      + K        L    + I S L+Y L+TGN   Q    
Sbjct: 420  RKLTKDIFRYMQRTVEEANDFNMK--------LAINAKTITSGLKYALATGNWGEQKKA- 470

Query: 471  LQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGS 530
            +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G 
Sbjct: 471  MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQ 529

Query: 531  PCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWC 589
             CGL+ + +    IS   +D   I T L   G+ P   +V    P    V ++G  V   
Sbjct: 530  ACGLVKNLSLMSCISVG-ADPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNG--VWHG 586

Query: 590  SHEQGRIVADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV--- 646
             H     + +TLR  + +G      ++ E+  +   +  +   L +F    R+ RP+   
Sbjct: 587  VHRNPARLMETLRTLRRKGD-----INPEVSMIRDIREQE---LKIFTDAGRVYRPLFIV 638

Query: 647  -------------------RYLPLDKQDIVGPFEQV---------------YMD------ 666
                               + +  + QDI G FE                 Y+D      
Sbjct: 639  EDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSLLNEGLVEYIDAEEEES 698

Query: 667  --IAVTPE-------------ENPLI----------TSILMLNFHQQIILSIXXXXXXXX 701
              IA+ PE             EN  +          T+      H  +IL +        
Sbjct: 699  ILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHCEIHPSMILGVAASIIPFP 758

Query: 702  XXXXXXXKICTNYQ--MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDN 759
                        YQ  MGKQ MG        R D     L   Q P+      +      
Sbjct: 759  DHNQSPR---NTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPLGTTRAMEYLKFRE 815

Query: 760  FPNGTNAVVAVISYTGYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQH 819
             P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  +T+ 
Sbjct: 816  LPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMSITET 872

Query: 820  FG----FGTDEWPKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKT 868
            F       T        +KLDEDGL   G  V   D       PI    ++   +T    
Sbjct: 873  FEKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKTTPIAPDEEELGQRT---A 929

Query: 869  YHS----------SEPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQ 918
            YHS          +E   +++V +  ++      L+++ ++ R  +VPQIGDKF+SRHGQ
Sbjct: 930  YHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIGDKFASRHGQ 985

Query: 919  KGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATP 978
            KG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   DA+P
Sbjct: 986  KGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASP 1045

Query: 979  WTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDK 1038
            +T    D   +     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK
Sbjct: 1046 FT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDK 1101

Query: 1039 FQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAV 1098
               R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +
Sbjct: 1102 IHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHI 1161

Query: 1099 CRECG 1103
            C  CG
Sbjct: 1162 CGICG 1166

>Scas_714.41
          Length = 1224

 Score =  327 bits (837), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 318/1140 (27%), Positives = 487/1140 (42%), Gaps = 177/1140 (15%)

Query: 85   LGNKLALSVTQVSLTKPMSN--DGVTAAAERNVFPAEARKRLTTYRGKLLL---KLNWSV 139
            +  K  +   ++ +TKPM N  DGVT A    ++P EAR R  TY   L +   K  +  
Sbjct: 84   VSRKYEIGFGKIYVTKPMVNESDGVTHA----LYPQEARLRNLTYSSGLFVDVKKRTYEA 139

Query: 140  ND--GEETFSEVRD-------------CGPLPVMLQSNRCHLHKMSPQELVEHKEESDEL 184
             D  G E   E+                G LP+ML+S  C+L   +  +L + KE   ++
Sbjct: 140  VDVPGRELKYELIAEESEEESESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKECPFDM 199

Query: 185  GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQT---SQT 241
            GGYFI+NG EK+   LI Q R+     I   F     S   +  +IR      +   S  
Sbjct: 200  GGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTL 254

Query: 242  NVLHYLNDGQ----VTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLT 297
             V  Y  +G     +     + K +  +P+V+I +AL    D EI + I   D ++  + 
Sbjct: 255  QVKLYGREGSDARTINATLPYIKQD--IPIVIIFRALGIIPDGEILEHIC-YDVNDWQM- 310

Query: 298  DRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH-- 355
              LE+L    +  F  + +R   L ++G +   +         Y   +++L++  L H  
Sbjct: 311  --LEMLKPCVEDGFV-IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHIT 365

Query: 356  -LGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYL 414
             L    + K+  L +MI +L          D+ D    + + L G L   + K    +  
Sbjct: 366  QLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLASLFKTLFRKLT 425

Query: 415  QNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQV 474
            ++I   +Q  V      + K        L    + I S L+Y L+TGN   Q    +   
Sbjct: 426  KDIFRYMQRTVEEAHDFNMK--------LAINAKTITSGLKYALATGNWGEQKKA-MSSR 476

Query: 475  SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGL 534
            +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL
Sbjct: 477  AGVSQVLNRYTYSSTLSHLRRTNT-PIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGL 535

Query: 535  LNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWCSHEQ 593
            + + +    IS   +D   I T L   G+ P   +V    P    V ++G  V    H  
Sbjct: 536  VKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNG--VWHGVHRN 592

Query: 594  GRIVADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV------- 646
               + DTLR  + +G      ++ E+  +   +  +   L +F    R+ RP+       
Sbjct: 593  PARLMDTLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRVYRPLFIVEDDE 644

Query: 647  ---------------RYLPLDKQDIVGPFEQV---------------YMD--------IA 668
                           + +  + QDI G FE                 Y+D        I+
Sbjct: 645  TLGHKELKVRKGHIAKLMATEYQDIEGGFEDAEEYTWTSLLNEGLVEYIDAEEEETILIS 704

Query: 669  VTPE--ENPL--------------------ITSILMLNFHQQIILSIXXXXXXXXXXXXX 706
            + PE  E P+                     T+      H  +IL +             
Sbjct: 705  MQPEDLEPPMENEEVIDDMDPAKRIRATQHATTFTHCEIHPSMILGVAASIIPFPDHNQS 764

Query: 707  XXKICTNYQ--MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGT 764
                   YQ  MGKQ MG        R D     L   Q P+      +       P G 
Sbjct: 765  PR---NTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRSMEYLKFRELPAGQ 821

Query: 765  NAVVAVISYTGYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFG--- 821
            NA+VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  +T+ F    
Sbjct: 822  NAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMSITETFEKPQ 878

Query: 822  -FGTDEWPKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKTYHS-- 871
               T        +KLD+DGL   G  V   D       PI    ++   +T    YHS  
Sbjct: 879  RTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTTPISPDEEELGQRT---AYHSKR 935

Query: 872  --------SEPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCS 923
                    +E   +++V +  ++      L+++ ++ R  +VPQIGDKF+SRHGQKG   
Sbjct: 936  DASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIGDKFASRHGQKGTIG 991

Query: 924  RKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSE 983
              +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+T   
Sbjct: 992  ITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT--- 1048

Query: 984  EDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRS 1043
             D   +     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+
Sbjct: 1049 -DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARA 1107

Query: 1044 TGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
             GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG
Sbjct: 1108 RGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGNCG 1167

>Kwal_26.8553
          Length = 1171

 Score =  275 bits (702), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 162/412 (39%), Positives = 230/412 (55%), Gaps = 44/412 (10%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+SY+G
Sbjct: 730  MGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKIPAGQNATVAVMSYSG 789

Query: 776  YDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSR---------------GRGDPVTQHF 820
            YD++DA+++NK++ +RGF  G      K+   L R                 G+P+ QH 
Sbjct: 790  YDIEDALVLNKASIDRGF--GRCETRRKLTTVLKRYPNHTQDMVGGMRVDENGEPIWQHK 847

Query: 821  GFGTDEWPKEWLEKLDEDGLPIIGS--YVEEGDPICAYFDDTLNKTKIK------TYHSS 872
              G D         L E G+ +     YV +  P  A  D  L +T+ +       Y + 
Sbjct: 848  ALGPD--------GLGEVGMKVESGQIYVNKSVPTNAS-DSVLTQTQAQYRETPVVYRAP 898

Query: 873  EPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMP 932
            EP++I++V +   E+++      I +  R  R P++GDKFSSRHGQKGVC       D+P
Sbjct: 899  EPSHIDQVMMSVSENDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVNQEDLP 954

Query: 933  FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSE-EDTPADYF 991
            F++ G+ PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  S+ ED      
Sbjct: 955  FNDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSKLED-----M 1009

Query: 992  GDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLT 1051
               L+  G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT
Sbjct: 1010 SQILMNNGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLT 1069

Query: 1052 MQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
             QP +GR R GG+R+GEMERD +I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1070 RQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1121

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 221/492 (44%), Gaps = 60/492 (12%)

Query: 115 VFPAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQEL 174
           V P E R R  TY   + + + ++         +V + G +P+ML+SN+C L+  S +++
Sbjct: 138 VPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHRDV-EIGRMPIMLRSNKCILNGASEKDM 196

Query: 175 VEHKEESDELGGYFIVNGIEKLI-------RMLIVQRRNHPMAIIRPSFANRGTSYSHYG 227
               E   + GGYFIVNG EK+I       +  I+   +   AI++ S     TS +H  
Sbjct: 197 ARINECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASV----TSSTH-- 250

Query: 228 VQIRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIV 287
                   ++ S+T V+    +G++  + +    E  VP+VL+LKA    SD EI   + 
Sbjct: 251 --------ERKSKTYVI--TKNGKIYLKHNSIAEE--VPIVLVLKASGIVSDLEIMQLVC 298

Query: 288 GADTSNSFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQEL 347
           G D+S     D   +      K   ++  ++Q L+Y+G K + V +    ++    G E 
Sbjct: 299 GNDSS---YQDIFAVNFEEVAKM--KIYTQQQALEYIGSKVKTVRRQK--LTTLQEGIEA 351

Query: 348 LRRIVLVHLGDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGM 404
           +   V+ HL  E  D   K+  +  M R++   +      D+ D   ++ + L G L  +
Sbjct: 352 IATTVIAHLTVEALDFREKALYIAVMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQLMSL 411

Query: 405 IVKEKIEEYLQNIKLQIQADV---NRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFL 458
           + ++  +++  + K  I   +   NR M  D          L  IN    NI S L   +
Sbjct: 412 LFEDLFKKFNNDFKANIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAI 462

Query: 459 STGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPE 516
           STGN  S     +++ +G T V  +++   +IS   M+ R S  F    K +  R L P 
Sbjct: 463 STGNW-SLKRFKMER-AGVTHVLSRLS---YISALGMMTRISSQFEKSRKVSGPRALQPS 517

Query: 517 SWGFLCPVHTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSL 576
            +G LC   TP+G  CGL+ + A    I TT  +   I  L Y LGV     V +     
Sbjct: 518 QFGMLCTSDTPEGEACGLVKNLALMTHI-TTDDEEEPIKKLCYLLGVEDITVVDSDSLHF 576

Query: 577 -CCVQLDGKIVG 587
             CV L+G IVG
Sbjct: 577 NYCVYLNGTIVG 588

>ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..222530)
            [3426 bp, 1141 aa]
          Length = 1141

 Score =  274 bits (700), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 162/411 (39%), Positives = 231/411 (56%), Gaps = 42/411 (10%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ +G        R D  LY +   Q P+VK+   +    D  P G NA VAV+SY+G
Sbjct: 700  MGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKSKTIELIDYDKLPAGQNATVAVMSYSG 759

Query: 776  YDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSR---------------GRGDPVTQHF 820
            YD++DA++INKS+ +RGF  G     +K    L R                 G+P+ QH 
Sbjct: 760  YDIEDALVINKSSIDRGF--GRCETRKKTTTILKRYPNHTQDIIGGMRVDENGEPIWQHQ 817

Query: 821  GFGTDEWPKEWLEKLDEDGLPIIGS--YVEEGDPICAYFDDTLNKTKIK------TYHSS 872
              G D         L E G+ +     Y+ +  P  A  D  LN+ + +       Y + 
Sbjct: 818  SLGPD--------GLGEVGMKVTSGQIYINKSIPTNAS-DSVLNQVQSQYREAPIIYRAP 868

Query: 873  EPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMP 932
            EP++I++V +   ++++      I +  R  R P++GDKFSSRHGQKGVC       DMP
Sbjct: 869  EPSHIDQVMMSVSDNDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQEDMP 924

Query: 933  FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFG 992
            F++ GI PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  S+    AD   
Sbjct: 925  FNDQGICPDIIMNPHGFPSRMTVGKMLELVSGKAGVLNGTLEYGTCFGGSQ---LAD-MS 980

Query: 993  DQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTM 1052
            + L+  G+NY G + +Y G TGE L+A ++ G +YYQ+L+HMV DK   R+ GP   LT 
Sbjct: 981  EILVNNGFNYSGKDMLYFGITGECLQAYVFFGPIYYQKLKHMVLDKMHARARGPRAVLTR 1040

Query: 1053 QPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
            QP +GR R GG+R+GEMERD +I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1041 QPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVCNKCG 1091

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 221/488 (45%), Gaps = 56/488 (11%)

Query: 117 PAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVE 176
           P E R R  TY   + + + ++         +V + G +P+ML+SN+C L+  S + + +
Sbjct: 110 PHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDV-EIGKMPIMLRSNKCILNGASEEVMAK 168

Query: 177 HKEESDELGGYFIVNGIEKLI-------RMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQ 229
             E   + GGYFIVNG EK+I       +  I+   +   AI++ S     TS +H    
Sbjct: 169 LNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASV----TSSTH---- 220

Query: 230 IRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGA 289
                 ++ S+T V+    + ++  + +    E  VP+V++LKA    SD EI   + G 
Sbjct: 221 ------ERKSKTYVV--TKNDKIYLKHNSIAEE--VPIVIVLKACGIVSDLEIMQLVCGN 270

Query: 290 DTSNSFLTDRLELLLRGFKKRFP-QLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELL 348
           D+S        ++    F++     +  ++Q L+Y+G K + + +    ++    G E +
Sbjct: 271 DSSYQ------DIFAINFEEASKMNIYTQQQALEYIGTKVKTIRRQK--LTVLQEGIEAI 322

Query: 349 RRIVLVHLGDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMI 405
              V+ HL  E  D   K+  +  M R++   +      D+ D   ++ + L G L  ++
Sbjct: 323 ATTVIAHLTVEALDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLL 382

Query: 406 VKEKIEEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFLSTGN 462
            ++  +++  + K  I   + +       +R  M   L  IN    NI S L   +STGN
Sbjct: 383 FEDLFKKFNNDFKASIDKVLKK------PNRAEMYDALLSINVHSNNITSGLNRAISTGN 436

Query: 463 LVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGF 520
             S     +++ +G T V  +++   +IS   M+ R S  F    K +  R L P  +G 
Sbjct: 437 W-SLKRFKMER-AGVTHVLSRLS---YISALGMMTRISSQFEKSRKVSGPRALQPSQFGM 491

Query: 521 LCPVHTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCC-V 579
           LC   TP+G  CGL+ + A    I TT  +   I  L Y LGV     + +A   L   V
Sbjct: 492 LCTSDTPEGEACGLVKNLALMTHI-TTDDEEEPIKNLCYLLGVEDITLLDSASIHLNYGV 550

Query: 580 QLDGKIVG 587
            L+G I+G
Sbjct: 551 YLNGTIIG 558

>Scas_605.14
          Length = 1150

 Score =  273 bits (698), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 159/411 (38%), Positives = 226/411 (54%), Gaps = 41/411 (9%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+SY+G
Sbjct: 707  MGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSG 766

Query: 776  YDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSR---------------GRGDPVTQHF 820
            YD++DA+++NK++ +RGF  G      K    L R                 G+P+ QH 
Sbjct: 767  YDIEDALVLNKASIDRGF--GRCETRRKTTTVLKRYPNHTQDIIGGMRVDENGEPIWQHK 824

Query: 821  GFGTDEWPKEWLEKLDEDGLPIIGS--YVEEGDPICAYFDDTLNKTKIK------TYHSS 872
              G D         L E G+ +     Y+ +  P     D T    + +       Y + 
Sbjct: 825  ALGAD--------GLGEVGMKVESGQIYINKSVPTNQSNDMTTQAQQAQYRETPVIYRAP 876

Query: 873  EPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMP 932
            EP++I++V +   ++++      I +  R  R P++GDKFSSRHGQKGVC       DMP
Sbjct: 877  EPSHIDQVMMSVSDNDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMP 932

Query: 933  FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFG 992
            F++ GI PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  S+ +  +    
Sbjct: 933  FNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCFGGSKLEDMSKILV 992

Query: 993  DQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTM 1052
            DQ    G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT 
Sbjct: 993  DQ----GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTR 1048

Query: 1053 QPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
            QP +GR R GG+R+GEMERD +I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1049 QPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1099

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 127/484 (26%), Positives = 214/484 (44%), Gaps = 48/484 (9%)

Query: 117 PAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVE 176
           P E R R  TY   + + + ++         +V + G +P+ML+SN+C L+ +  +E+ +
Sbjct: 117 PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDV-ELGRMPIMLRSNKCTLYGIDEKEMAK 175

Query: 177 HKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPD 236
             E   + GGYFIVNG EK+I   +VQ +     II  +   +G       VQ       
Sbjct: 176 LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGI------VQASVTSST 226

Query: 237 QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTS-NSF 295
              ++       + ++  + +    E  +P+V++LKA    SD EI   + G D+S    
Sbjct: 227 HERRSKTYVITKNDKIYLKHNSITEE--IPIVIVLKACGVVSDLEIMQLVCGNDSSYQDI 284

Query: 296 LTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH 355
               LE   R        +  ++Q L+++G K + + +    +S    G E +   V+ H
Sbjct: 285 FAVNLEEASR------LNIYTQQQALEFIGTKVKTMRRQK--LSVLQEGIEAIATTVVAH 336

Query: 356 LGDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEE 412
           L  E  D   K+  +  M R++   +      D+ D   ++ + L G L  ++ ++  ++
Sbjct: 337 LTVEALDFREKALYMAMMTRRVVMAIQNPKMVDDRDYVGNKRLELAGQLISLLFEDLFKK 396

Query: 413 YLQNIKLQIQADV---NRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFLSTGNLVSQ 466
           +  + K  I   +   NR M  D          L  IN    NI S L   +STGN  S 
Sbjct: 397 FNSDFKATIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-SL 446

Query: 467 SGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPV 524
               +++ +G T V  +++   +IS   M+ R S  F    K +  R L P  +G LC  
Sbjct: 447 KRFKMER-AGVTHVLSRLS---YISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTA 502

Query: 525 HTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCC-VQLDG 583
            TP+G  CGL+ + A    I TT  +   I  L Y LGV   + + +A   L   V L+G
Sbjct: 503 DTPEGEACGLVKNLALMTHI-TTDDEEEPIKRLCYILGVEDVSLIDSASLHLNFGVYLNG 561

Query: 584 KIVG 587
            ++G
Sbjct: 562 TLIG 565

>KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, 130 KD subunit, hypothetical start
          Length = 1142

 Score =  271 bits (693), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 159/411 (38%), Positives = 228/411 (55%), Gaps = 42/411 (10%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+SY+G
Sbjct: 701  MGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSG 760

Query: 776  YDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSR---------------GRGDPVTQHF 820
            YD++DA+++NK++ +RGF  G      K    L R                 G+P+ QH 
Sbjct: 761  YDIEDALVLNKASIDRGF--GRCETRRKNTTVLKRYPNHTQDIIGGMRVDENGEPIWQHQ 818

Query: 821  GFGTDEWPKEWLEKLDEDGLPIIGS--YVEEGDPICAYFDDTLNKTKIK------TYHSS 872
              G D         L E G+ +     YV +  P  A  D  L +T+ +       Y + 
Sbjct: 819  ALGPD--------GLGEVGMKVESGQIYVNKSVPTNAS-DSILTQTQAQYKETPVVYRAP 869

Query: 873  EPAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMP 932
            EP++I++V +   ++++      I +  R  R P++GDKFSSRHGQKGVC       D+P
Sbjct: 870  EPSHIDQVMMSVSDNDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDLP 925

Query: 933  FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFG 992
            F++ G+ PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  S+ +  +    
Sbjct: 926  FNDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSKLEDMSKILV 985

Query: 993  DQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTM 1052
            D     G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT 
Sbjct: 986  DN----GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTR 1041

Query: 1053 QPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
            QP +GR R GG+R+GEMERD +I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1042 QPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVCEKCG 1092

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 122/481 (25%), Positives = 212/481 (44%), Gaps = 42/481 (8%)

Query: 117 PAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVE 176
           P E R R  TY   + + + ++         +V + G +P+ML+SN+C L   +  ++ +
Sbjct: 111 PHECRLRDMTYSTPIFVDIEYTRGRSIVLHRDV-EIGRMPIMLRSNKCILDGAAENDMAK 169

Query: 177 HKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPD 236
             E   + GGYFIVNG EK+I   +VQ +     II  +   +        VQ       
Sbjct: 170 LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKNI------VQASVTSST 220

Query: 237 QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTS-NSF 295
              ++       + ++  + +    E  VP+V++LKA    SD EI   + G D+S    
Sbjct: 221 HERKSKTYVVTKNDKIYLKHNSIAEE--VPIVVVLKACGVVSDLEIMQLVCGNDSSYQDI 278

Query: 296 LTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH 355
               LE      +    ++  ++Q L+++G K + V +    +S    G E +   V+ H
Sbjct: 279 FAVNLE------EAAELKIYTQQQALEFIGTKVKTVRRQK--LSILQEGIEAIATTVIAH 330

Query: 356 LGDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEE 412
           L  E  D   K+  +  M R++   +      D+ D   ++ + L G L  ++ ++  ++
Sbjct: 331 LTVEALDFREKALYIAMMTRRVVMAIDNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKK 390

Query: 413 YLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFLSTGNLVSQSGL 469
           +  + K  I   + +       +R  M   L  IN    NI + +   +STGN  S    
Sbjct: 391 FNNDFKANIDKVLKK------PNRAEMYDALLTINVHSNNITTGMNRAISTGNW-SLKRF 443

Query: 470 DLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVHTP 527
            +++ +G T V  +++   +IS   M+ R S  F    K +  R L P  +G LC   TP
Sbjct: 444 KMER-AGVTHVLSRLS---YISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTP 499

Query: 528 DGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCC-VQLDGKIV 586
           +G  CGL+ + A    I TT  +   I  + Y LGV   + + +A   L   V L+G I+
Sbjct: 500 EGEACGLVKNLALMTHI-TTDDEEEPIKRICYLLGVEDISLIDSASIHLNYGVYLNGTII 558

Query: 587 G 587
           G
Sbjct: 559 G 559

>CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, hypothetical start
          Length = 1133

 Score =  271 bits (693), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 162/401 (40%), Positives = 226/401 (56%), Gaps = 23/401 (5%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+SY+G
Sbjct: 693  MGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSG 752

Query: 776  YDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDE-----WPKE 830
            YD++DA+++NKS+ +RGF  G      K    L +          G   DE     W  E
Sbjct: 753  YDIEDALVLNKSSIDRGF--GRCETRRKTTTVLKKYPNHTKDALCGMRVDENGEAIWQHE 810

Query: 831  WL--EKLDEDGLPIIGS--YVEEGDPICAYFDDTLNKTKIK----TYHSSEPAYIEEVTL 882
             L  + L E GL I     Y+ +  P+ +     +N+ + +     Y + E + I++V +
Sbjct: 811  SLGPDGLGEVGLKIRSGQIYINKSVPVQSSDAMAVNQAQYRETPVIYRAPELSIIDQVMM 870

Query: 883  IGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDV 942
                S+  Q+L  I +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+
Sbjct: 871  --STSDNDQDL--IKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDI 926

Query: 943  IINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNY 1002
            I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  S+ +  +    DQ    G+NY
Sbjct: 927  IMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCFGGSKLEDMSKILVDQ----GFNY 982

Query: 1003 HGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHG 1062
             G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R G
Sbjct: 983  SGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDG 1042

Query: 1063 GIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECG 1103
            G+R+GEMERD +I +G S LL +RL+ SSD  +  VC  CG
Sbjct: 1043 GLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCSNCG 1083

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 130/485 (26%), Positives = 214/485 (44%), Gaps = 46/485 (9%)

Query: 115 VFPAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQEL 174
           V P E R R  TY   + + + ++          V + G +P+ML+SN+C LH    + +
Sbjct: 101 VPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKNV-EIGRMPIMLRSNKCILHGADEKMM 159

Query: 175 VEHKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVR 234
               E   + GGYFIVNG EK+I   +VQ +     II  +   +        VQ     
Sbjct: 160 ARLSECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKDI------VQASVTS 210

Query: 235 PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNS 294
                ++       +G++  + +    E  VP+V++LKA    SD EI   + G D+S  
Sbjct: 211 STHERKSKTYVVTKNGKIYLKHNSIAEE--VPIVIVLKAAGIISDLEIMQLVCGNDSS-- 266

Query: 295 FLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLV 354
              D   + L    K    +  ++Q L+Y+G K + + +    ++    G E +   ++ 
Sbjct: 267 -YQDIFSVNLEEAAKL--NICTQQQALEYIGAKVKTMRRQK--LTILQEGIEAIATTIIA 321

Query: 355 HLGDENTD---KSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIE 411
           HL  E  D   K+  +  M R++   +      D+ D   ++ + L G L  ++ ++  +
Sbjct: 322 HLTVEALDFREKALYIATMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLISLLFEDLFK 381

Query: 412 EYLQNIKLQIQADV---NRGMPVDFKDRKYMTRVLTRIN---ENIGSKLQYFLSTGNLVS 465
           ++  + KL I   +   NR M  D          L  IN    NI S L   +STGN  S
Sbjct: 382 KFNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-S 431

Query: 466 QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCP 523
                +++ +G T V  +++   +IS   M+ R S  F    K +  R L P  +G LC 
Sbjct: 432 LKRFKMER-AGVTHVLSRLS---YISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCT 487

Query: 524 VHTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCC-VQLD 582
             TP+G  CGL+ + A    I TT  +   I  L Y LGV P + + +A   L   V L+
Sbjct: 488 ADTPEGEACGLVKNLALMTHI-TTDDEEEPIRKLCYVLGVEPISLLDSASLHLNYGVYLN 546

Query: 583 GKIVG 587
           G ++G
Sbjct: 547 GTLIG 551

>KLLA0B05577g complement(501690..505355) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, 140 kDa chain, start by similarity
          Length = 1221

 Score =  260 bits (664), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 158/438 (36%), Positives = 227/438 (51%), Gaps = 42/438 (9%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ MG        R D     L   Q P+      +       P G NA+VA+  Y+G
Sbjct: 770  MGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSG 829

Query: 776  YDMDDAMIINKSADERGFSYGTVYKT-----EKIDLSLSRGRGDP---VTQHFGFGTDEW 827
            Y+ +D+MI+N+S+ +RG      +++     ++I +S++     P    T     GT   
Sbjct: 830  YNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTNTLRMKHGT--- 886

Query: 828  PKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKT-------YHSSE 873
                 +KLD+DGL   G  V   D       PI    ++   +T   +         S+E
Sbjct: 887  ----YDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRDASTPLRSTE 942

Query: 874  PAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPF 933
               +++V +  ++      L+++ ++ R  ++PQIGDKF+SRHGQKG     + T DMPF
Sbjct: 943  NGIVDQVLITTNQEG----LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRTEDMPF 998

Query: 934  SETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGD 993
            +  G+ PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+T    D   D    
Sbjct: 999  TAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGISR 1054

Query: 994  QLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQ 1053
             L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GP+  LT Q
Sbjct: 1055 LLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQ 1114

Query: 1054 PVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVP 1113
            PV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG +    S V 
Sbjct: 1115 PVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICGLM----SVVA 1170

Query: 1114 KIGSMVTIRCRRCAISFD 1131
            K+       CR C    D
Sbjct: 1171 KLKHN-QFECRSCKNKID 1187

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 144/597 (24%), Positives = 242/597 (40%), Gaps = 78/597 (13%)

Query: 85  LGNKLALSVTQVSLTKP--MSNDGVTAAAERNVFPAEARKRLTTYRGKLLLKLNWSVNDG 142
           +  K  +S  ++ L KP    +DGV+ A    ++P EAR R  TY   L +++       
Sbjct: 78  ISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIQ------ 127

Query: 143 EETFSEV----RD--------------------CGPLPVMLQSNRCHLHKMSPQELVEHK 178
           + T+  +    RD                     G +P+ML+S  C L  ++  +L   K
Sbjct: 128 KRTYQAIDIPGRDLKYEIITEESEENEENNKIFIGRVPIMLRSKYCLLDDLTESDLYRLK 187

Query: 179 EESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQT 238
           E   ++GGYFI+NG EK+   LI Q R+     I   F     S   +  +IR      +
Sbjct: 188 ECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGS 242

Query: 239 ---SQTNVLHYLNDGQV--TFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSN 293
              S   V  Y  +G    T + +    +  +P+V+I +AL    D EI + I   D ++
Sbjct: 243 RFISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVND 301

Query: 294 SFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVL 353
             +   LE+L    ++ F  + +R   L ++G +   +         Y   +++L++  L
Sbjct: 302 WQM---LEMLKPCVEEGF-VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFL 355

Query: 354 VH---LGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKI 410
            H   L    + K+  L +MI +L          D+ D    + + L G L   + K   
Sbjct: 356 PHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLF 415

Query: 411 EEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLD 470
            +  ++I   +Q  V      + K        L      I + L+Y L+TGN   Q    
Sbjct: 416 RKLTRDILRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALATGNWGEQKK-S 466

Query: 471 LQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGS 530
           +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G 
Sbjct: 467 MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQ 525

Query: 531 PCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWC 589
            CGL+ + +    IS   +D   I T L   G+ P   ++    P    V ++G   G  
Sbjct: 526 ACGLVKNLSLMSCISVG-TDPLPIITFLNEWGMEPLEDYIPHQSPDATRVFVNGVWHGI- 583

Query: 590 SHEQGRIVADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV 646
            H     + DT+R  K+  K D  P   E+  V   +  +   L +F    R+ RP+
Sbjct: 584 -HRNPAKLVDTIR--KLRRKGDITP---EVSIVRDIREKE---LKIFTDAGRVYRPL 631

>Kwal_47.18783
          Length = 1220

 Score =  259 bits (661), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 159/438 (36%), Positives = 226/438 (51%), Gaps = 42/438 (9%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ MG        R D     L   Q P+      +       P G NA+VA+  Y+G
Sbjct: 769  MGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRELPAGQNAIVAIACYSG 828

Query: 776  YDMDDAMIINKSADERGFSYGTVYKT-----EKIDLSLSRGRGDPV---TQHFGFGTDEW 827
            Y+ +D+MI+N+S+ +RG      +++     ++I +S++     P    T     GT   
Sbjct: 829  YNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPQRTNTLRMKHGT--- 885

Query: 828  PKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKT-------YHSSE 873
                 +KLD+DGL   G  V   D       PI    ++   +T   +         S+E
Sbjct: 886  ----YDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRDASTPLRSTE 941

Query: 874  PAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPF 933
               +++V +  ++      L+++ ++ R  +VPQIGDKF+SRHGQKG     +   DMPF
Sbjct: 942  NGIVDQVLITTNQEG----LKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDMPF 997

Query: 934  SETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGD 993
            +  GI PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+T    D   D    
Sbjct: 998  TAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGISR 1053

Query: 994  QLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQ 1053
             L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GPV  LT Q
Sbjct: 1054 LLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQ 1113

Query: 1054 PVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVP 1113
            PV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG +    + V 
Sbjct: 1114 PVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGVCGLM----TVVA 1169

Query: 1114 KIGSMVTIRCRRCAISFD 1131
            K+       CR C    D
Sbjct: 1170 KLKHN-QFECRGCKNKID 1186

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 147/590 (24%), Positives = 243/590 (41%), Gaps = 65/590 (11%)

Query: 85  LGNKLALSVTQVSLTKP--MSNDGVTAAAERNVFPAEARKRLTTYRGKLLLK-------- 134
           +  K  +S  ++ L KP    +DGV+ A    ++P EAR R  TY   L ++        
Sbjct: 80  ISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIRKRTYEA 135

Query: 135 -------LNWSVNDGEETFSEVRDC--GPLPVMLQSNRCHLHKMSPQELVEHKEESDELG 185
                  L + V D E   S+      G +P+ML+S  C L +++  +L + KE   ++G
Sbjct: 136 VDIPGRDLKYEVIDEESEMSDENKIFIGRVPIMLRSKYCLLDELTESDLYKLKECPFDMG 195

Query: 186 GYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCV-----RPDQTSQ 240
           GYFI+NG EK+   LI Q R+     I   F     S   +  +IR       R   T Q
Sbjct: 196 GYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFISTLQ 250

Query: 241 TNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300
             +     +   T + +    +  +P+V+I +AL    D EI + I   D ++  +   L
Sbjct: 251 VKLYGREGNTNRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDWQM---L 306

Query: 301 ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH---LG 357
           ELL    ++ F  + +R   L ++G +   +         Y   +++L++  L H   L 
Sbjct: 307 ELLKPCVEEGFV-IQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHITQLE 363

Query: 358 DENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNI 417
              + K+  L +MI +L          D+ D    + + L G L   + K    +  ++I
Sbjct: 364 GFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTRDI 423

Query: 418 KLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGY 477
              +Q  V      + K        L      I + L+Y L+TGN   Q    +   +G 
Sbjct: 424 LRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALATGNWGEQKKA-MTSRAGV 474

Query: 478 TVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNH 537
           + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL+ +
Sbjct: 475 SQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKN 533

Query: 538 FAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWCSHEQGRI 596
            +    IS   +D   I T L   G+ P   +V    P    V ++G   G   H     
Sbjct: 534 LSLMSCISVG-TDPLPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRNPAK 590

Query: 597 VADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV 646
           + DT+R  K+  K D  P   E+  V   +  +   L +F    R+ RP+
Sbjct: 591 LVDTIR--KLRRKGDVTP---EVSIVRDIREKE---LKIFTDAGRVYRPL 632

>AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH]
            (1162949..1166617) [3669 bp, 1222 aa]
          Length = 1222

 Score =  255 bits (651), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/438 (35%), Positives = 225/438 (51%), Gaps = 42/438 (9%)

Query: 716  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 775
            MGKQ MG        R D     L   Q P+      +       P G NA+VA+  Y+G
Sbjct: 771  MGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSG 830

Query: 776  YDMDDAMIINKSADERGFSYGTVYKT-----EKIDLSLSRGRGDP---VTQHFGFGTDEW 827
            Y+ +D+MI+N+S+ + G      +++     ++I +S++     P    T     GT   
Sbjct: 831  YNQEDSMIMNQSSIDSGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTNTLRMKHGT--- 887

Query: 828  PKEWLEKLDEDGLPIIGSYVEEGD-------PICAYFDDTLNKTKIKT-------YHSSE 873
                 EKLD+DGL   G  V   D       PI    ++   +T   +         S+E
Sbjct: 888  ----YEKLDDDGLIAPGVRVSGDDIIIGKTTPIPPDAEELGQRTAFHSKRDASTPLRSTE 943

Query: 874  PAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPF 933
               +++V +  ++      L+++ ++ R  +VPQIGDKF+SRHGQKG     +   DMPF
Sbjct: 944  NGIVDQVLITTNQEG----LKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDMPF 999

Query: 934  SETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGD 993
            +  G+ PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+T    D   D    
Sbjct: 1000 TAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGISK 1055

Query: 994  QLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQ 1053
             L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GP+  LT Q
Sbjct: 1056 LLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQ 1115

Query: 1054 PVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVP 1113
            PV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG +    + V 
Sbjct: 1116 PVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICGLM----TVVA 1171

Query: 1114 KIGSMVTIRCRRCAISFD 1131
            K+       CR C    D
Sbjct: 1172 KLKHN-QFECRGCKNKID 1188

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 142/590 (24%), Positives = 231/590 (39%), Gaps = 65/590 (11%)

Query: 85  LGNKLALSVTQVSLTKP--MSNDGVTAAAERNVFPAEARKRLTTYRGKLL---------- 132
           +  K  +S  ++ L KP    +DGV+ A    ++P EAR R  TY   L           
Sbjct: 80  ISRKYEISFGKIYLAKPSMTESDGVSHA----MYPQEARLRNLTYASGLFVEIKKRTYEA 135

Query: 133 -------LKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEESDELG 185
                  LK      + E+T       G +P+ML+S  C L  +S  +L   KE   ++G
Sbjct: 136 VDIPGRDLKYEIIQEESEDTEEGKIFIGRVPIMLRSKYCLLDDLSESDLYRLKECPFDMG 195

Query: 186 GYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQT---SQTN 242
           GYFI+NG EK+   LI Q R+     I   F     S   +  +IR      +   S   
Sbjct: 196 GYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFISTLQ 250

Query: 243 VLHYLNDGQV--TFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRL 300
           V  Y  +G    T + +    +  +P+V+I +AL    D EI + I         L    
Sbjct: 251 VKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDQNDWQMLEMLK 310

Query: 301 ELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVH---LG 357
             +  GF      + +R   L ++G +   +         Y   +++L++  L H   L 
Sbjct: 311 PCVEEGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKEFLPHITQLE 363

Query: 358 DENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNI 417
              + K+  L +MI +L          D+ D    + + L G L   + K    +  ++I
Sbjct: 364 GFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTRDI 423

Query: 418 KLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGY 477
              +Q  V      + K        L      I + L+Y L+TGN   Q    +   +G 
Sbjct: 424 LRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALATGNWGEQKKA-MSSRAGV 474

Query: 478 TVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNH 537
           + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL+ +
Sbjct: 475 SQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKN 533

Query: 538 FAHKCKISTTQSDVSKIPTLLYSLGVSPAA-HVTAAGPSLCCVQLDGKIVGWCSHEQGRI 596
            +    IS   +D   I T L   G+ P   +V    P    V ++G   G   H     
Sbjct: 534 LSLMSCISVG-TDPVPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRNPAR 590

Query: 597 VADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPV 646
           + DT+R  + +G      +  E+  V   +  +   L +F    R+ RP+
Sbjct: 591 LVDTIRKLRRKGD-----ITAEVSIVRDIREKE---LKIFTDAGRVYRPL 632

>KLLA0C09108g complement(795433..796059) similar to sp|P25631
           Saccharomyces cerevisiae YCR051w singleton, start by
           similarity
          Length = 208

 Score = 31.6 bits (70), Expect = 2.9,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 381 ECCPDNPDATQHQEVLLGGFLYGM---IVKEKIEEYLQNIKLQIQAD-VNRGMPVDFKDR 436
           E C DN D  ++ E +LG  ++     I KE++ ++  NI+  ++ D V+   P   + R
Sbjct: 106 ETCDDNLDLLRYAEEVLGETIFNTSLGIDKEQLNQFKDNIRYTLENDPVDETDPESLERR 165

Query: 437 KYMTRVLTRINENIGSKLQYFL 458
           K +  ++    EN   +L+ ++
Sbjct: 166 KKLESIIQ--GENAEEELEKYI 185

>YNL230C (ELA1) [4376] chr14 complement(217522..218661) Elongin A
           transcription elongation factor, contains an F-box
           domain [1140 bp, 379 aa]
          Length = 379

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 822 FGTDEWPKEWLEKLDEDGLP--IIGSYVEEGDPICAYFDDTLNKTKIKTYHSSE 873
           F  DE    WLE L +D  P  +   +V + D IC Y+ D + +  I+ YHS++
Sbjct: 54  FDDDEL---WLEFLRQD-FPTNVHEQFVSKRDIICKYYFDFVKENDIELYHSNQ 103

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 39,101,918
Number of extensions: 1774266
Number of successful extensions: 3790
Number of sequences better than 10.0: 24
Number of HSP's gapped: 3831
Number of HSP's successfully gapped: 37
Length of query: 1176
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1063
Effective length of database: 12,684,275
Effective search space: 13483384325
Effective search space used: 13483384325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)