Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL103W31731111351e-157
Kwal_56.230803141604596e-55
KLLA0F18722g2701604522e-54
YBR057C (MUM2)3661644252e-49
CAGL0H10164g4841653885e-43
Scas_718.502361602636e-27
Scas_661.252251602495e-25
CAGL0F05709g34839672.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL103W
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   441   e-157
Kwal_56.23080                                                         181   6e-55
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   178   2e-54
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   168   2e-49
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   154   5e-43
Scas_718.50                                                           105   6e-27
Scas_661.25                                                           100   5e-25
CAGL0F05709g 573128..574174 some similarities with tr|Q04005 Sac...    30   2.0  

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  441 bits (1135), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 226/311 (72%), Positives = 226/311 (72%)

Query: 1   MGGNGHPGNSVVSAPSPMASYAQQREPQREQKQTPKQQREQKQVAXXXXXXXXXXXXXXX 60
           MGGNGHPGNSVVSAPSPMASYAQQREPQREQKQTPKQQREQKQVA               
Sbjct: 1   MGGNGHPGNSVVSAPSPMASYAQQREPQREQKQTPKQQREQKQVAKHFHGHHHQHSKGST 60

Query: 61  XXLEQAMGGGTSYWNTDSSATSSIVSIDPXXXXXXXXXXXXXXXSIMDGHXXXXXXXXXX 120
             LEQAMGGGTSYWNTDSSATSSIVSIDP               SIMDGH          
Sbjct: 61  SSLEQAMGGGTSYWNTDSSATSSIVSIDPGVAAGGSTAGTLTTASIMDGHTAKSSSGFST 120

Query: 121 XXXXXXXXXXNPSHGXXXXXXXXXXXXXXKETQIESLEDEITKLKSIFNXXXXXXXXXXX 180
                     NPSHG              KETQIESLEDEITKLKSIFN           
Sbjct: 121 TFATTSSQQSNPSHGSLESMESLRLELQLKETQIESLEDEITKLKSIFNQGLTFKQQEQQ 180

Query: 181 XXXXXXXXHALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNP 240
                   HALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNP
Sbjct: 181 LQKRKLHQHALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNP 240

Query: 241 SNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQ 300
           SNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQ
Sbjct: 241 SNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQ 300

Query: 301 RKVEQLEKQLA 311
           RKVEQLEKQLA
Sbjct: 301 RKVEQLEKQLA 311

>Kwal_56.23080
          Length = 314

 Score =  181 bits (459), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 6/160 (3%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMPVEIPANLEIIFN 209
           KETQIESLE EI  LK IFN                   +A       VE+PA+LE IF 
Sbjct: 157 KETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPAINA------SVEVPASLEAIFQ 210

Query: 210 KLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKE 269
           KL+++L  KD+EL++T+KRLESI+TA+ALNPSN+VT+ GRYDEEALAHKM+VRLE LTKE
Sbjct: 211 KLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETLTKE 270

Query: 270 NQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQ 309
           NQ+MAK+L YGRSKE HIE+ELLKK N++L++K+ QLE++
Sbjct: 271 NQDMAKMLGYGRSKENHIEIELLKKENQELKKKLSQLERK 310

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  178 bits (452), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 94/160 (58%), Positives = 119/160 (74%), Gaps = 4/160 (2%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMPVEIPANLEIIFN 209
           KETQIESLE EI KLK +FN                    AL  D   ++IPA+LEIIF 
Sbjct: 114 KETQIESLEIEIKKLKEVFNQGLTFKQQEEQKMKKSK---ALTFDS-EIQIPASLEIIFC 169

Query: 210 KLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKE 269
           KL+ SLKRKD+EL++T++RLE I+TA+ALNPSNS T+FGRYDEEALAHKM+ RLE L KE
Sbjct: 170 KLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKE 229

Query: 270 NQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQ 309
           N+EMAK+LSYGR KET IELELL+K N++L+ ++  L+++
Sbjct: 230 NEEMAKMLSYGRVKETSIELELLRKENQELKERLRILQQE 269

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  168 bits (425), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 117/164 (71%), Gaps = 10/164 (6%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMP--VEIPANLEII 207
           KE+QIESLE+EI +LK IFN                         H+P   E+PA+LE+I
Sbjct: 200 KESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENC--------HIPQTFELPASLEVI 251

Query: 208 FNKLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLT 267
           F KL++SL  K++EL +T++ LESI+TA+ALNP+NSVT++GRYD E++AHKM+VRLE LT
Sbjct: 252 FRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLENLT 311

Query: 268 KENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQLA 311
            EN+EMAK+L+YGRSKET IEL+L KK N +L+ K+  LE  LA
Sbjct: 312 NENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASLEAHLA 355

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  154 bits (388), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (70%), Gaps = 10/165 (6%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMP---VEIPANLEI 206
           K+ Q++SL+ E+T+LKS  +                        +H+    +++P +L+I
Sbjct: 323 KDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKE-------EHITTKEIDVPNSLDI 375

Query: 207 IFNKLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEML 266
           IF KL+++L+++++EL++T+  LES++ A+ALNPSNS T+FGRYD E LAHK +VRLE L
Sbjct: 376 IFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRLETL 435

Query: 267 TKENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQLA 311
           TKENQEMA++LS+GR+KE HI LELLKK N+DL+ ++ QL+++L 
Sbjct: 436 TKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQIIQLKEKLG 480

>Scas_718.50
          Length = 236

 Score =  105 bits (263), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 93/160 (58%), Gaps = 19/160 (11%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMPVEIPANLEIIFN 209
           K+ QIESLE+EI  LK I                        D D    +I  +   IF 
Sbjct: 91  KDIQIESLENEIQNLKKILQLNPNGTRKG-------------DDD----KISKHYGPIFT 133

Query: 210 KLATSLKRKDEELEDTRKRLESIMTAIALN--PSNSVTRFGRYDEEALAHKMIVRLEMLT 267
            L +SL  ++EE E  ++  E +   +A+N   SNS+T+ GRYD E +AHKM++R EMLT
Sbjct: 134 NLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFEMLT 193

Query: 268 KENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLE 307
           KEN  MAK+LSYGR  ET IEL+L++  N++L+ +++QLE
Sbjct: 194 KENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLE 233

>Scas_661.25
          Length = 225

 Score =  100 bits (249), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 98/160 (61%), Gaps = 11/160 (6%)

Query: 150 KETQIESLEDEITKLKSIFNXXXXXXXXXXXXXXXXXXXHALDLDHMPVEIPANLEIIFN 209
           KETQ+ SL+ E+  LKSI                        D +   +    N E++F 
Sbjct: 72  KETQLSSLQIEMDHLKSILKERVQEQQKSVD-----------DPNSHELLNVTNHELLFT 120

Query: 210 KLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKE 269
           +L + L+ K+ E++D R + ES++TA+AL+P+N +  +G+ D E ++ KM+ +LE LTKE
Sbjct: 121 RLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKE 180

Query: 270 NQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQ 309
           NQEM+KLL++  SK  +IEL L++K N +L++++ QLE++
Sbjct: 181 NQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLERE 220

>CAGL0F05709g 573128..574174 some similarities with tr|Q04005
           Saccharomyces cerevisiae YDR184c BAT1, hypothetical
           start
          Length = 348

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 202 ANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNP 240
           ++ + +FN+   S KRKD +++  +  ++SIMT   L+P
Sbjct: 114 SDTDTLFNEQTDSKKRKDSDMDSCKNAIDSIMTEQILSP 152

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,989,728
Number of extensions: 241187
Number of successful extensions: 3967
Number of sequences better than 10.0: 86
Number of HSP's gapped: 3797
Number of HSP's successfully gapped: 95
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)