Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL056C29629115510.0
Kwal_26.767929629112011e-168
KLLA0C14300g29629111861e-165
YMR099C29729111541e-161
CAGL0K03289g29729110921e-151
Scas_717.6529629110901e-151
Scas_254.21511466182e-81
Sklu_2179.4782118710.70
YIR028W (DAL4)63598691.0
YDR539W50345681.5
ADL231W36557618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL056C
         (291 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL056C [536] [Homologous to ScYMR099C - SH] (294383..295273) [8...   602   0.0  
Kwal_26.7679                                                          467   e-168
KLLA0C14300g 1242952..1243842 similar to sp|Q03161 Saccharomyces...   461   e-165
YMR099C (YMR099C) [4057] chr13 complement(463933..464826) Member...   449   e-161
CAGL0K03289g 300996..301889 highly similar to sp|Q03161 Saccharo...   425   e-151
Scas_717.65                                                           424   e-151
Scas_254.2                                                            242   2e-81
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         32   0.70 
YIR028W (DAL4) [2692] chr9 (408465..410372) Allantoin permease, ...    31   1.0  
YDR539W (YDR539W) [1348] chr4 (1512080..1513591) Member of the 3...    31   1.5  
ADL231W [1510] [Homologous to ScYNL042W (BOP3) - SH] complement(...    28   8.6  

>ABL056C [536] [Homologous to ScYMR099C - SH] (294383..295273) [891
           bp, 296 aa]
          Length = 296

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI
Sbjct: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW
Sbjct: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT
Sbjct: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP
Sbjct: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL
Sbjct: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291

>Kwal_26.7679
          Length = 296

 Score =  467 bits (1201), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 214/291 (73%), Positives = 245/291 (84%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           MSV+    EVIL HP N KT  KIL YGAT++SWT++GEEQLWLS AAK+DGSKPVRGGI
Sbjct: 1   MSVEETATEVILAHPDNSKTCAKILKYGATVFSWTLNGEEQLWLSSAAKMDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKNTDDE  SKLPQHGLARNSTWEFLGQ   NPP VQFGLGPE AN ELT LW
Sbjct: 61  PLVFPVFGKNTDDELLSKLPQHGLARNSTWEFLGQVSANPPTVQFGLGPEFANPELTKLW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           P DY+LVLTVELG +HLKT IEV NTS+ + L+FNWLFHTYLKIDD+EDTMV+NL   K 
Sbjct: 121 PLDYSLVLTVELGSDHLKTHIEVSNTSSDKELKFNWLFHTYLKIDDIEDTMVANLSGAKL 180

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQ+L+ SYVDRQPVV+FHEE+DRIYQQV  DR++Q++DKGR IH+V R NLPD VVWNP
Sbjct: 181 YDQMLQESYVDRQPVVSFHEELDRIYQQVPGDRLLQVIDKGRQIHTVKRHNLPDAVVWNP 240

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           WI+KS  M DF+PK GY++M+C+EPG+VHDFV LQPG+ W+ YQLL KD L
Sbjct: 241 WIDKSKGMGDFEPKSGYKEMVCVEPGYVHDFVHLQPGQTWTAYQLLYKDEL 291

>KLLA0C14300g 1242952..1243842 similar to sp|Q03161 Saccharomyces
           cerevisiae YMR099c singleton, start by similarity
          Length = 296

 Score =  461 bits (1186), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 207/291 (71%), Positives = 245/291 (84%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           M ++  E E+IL HP+N  T  +IL YGAT++SW + GEEQLWLS AAKLDGSKPVRGGI
Sbjct: 1   MPIEETETEIILTHPNNSSTKARILKYGATVFSWELKGEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKN DDEH SKLPQHGLARNS WEFLGQ K NPP +Q GLGPE ANEELT LW
Sbjct: 61  PLVFPVFGKNHDDEHLSKLPQHGLARNSVWEFLGQVKSNPPTIQLGLGPEFANEELTNLW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           PF+Y+LVL+VELG+E+LKTEIEV+NTST+Q L+FNWLFHTYLKIDD+EDT+VSNL + K 
Sbjct: 121 PFEYSLVLSVELGDEYLKTEIEVLNTSTTQNLKFNWLFHTYLKIDDIEDTLVSNLSSTKL 180

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQLLK SY+DRQPV++ HEE+DRIYQ V +DR+IQ++DKG PIH++ R NLPD VVWNP
Sbjct: 181 YDQLLKESYIDRQPVISVHEELDRIYQNVDEDRIIQVIDKGYPIHTLKRHNLPDTVVWNP 240

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           W+EKS  M DF+PK+G++ M+C+EPGHVHDFV L PGE W   Q+L KD L
Sbjct: 241 WVEKSKGMADFEPKDGFKNMVCVEPGHVHDFVVLAPGENWVASQILYKDEL 291

>YMR099C (YMR099C) [4057] chr13 complement(463933..464826) Member of
           the aldose 1-epimerase family, which interconvert
           aldoses between their alpha- and beta-forms, has high
           similarity to uncharacterized C. albicans Orf6.1972p
           [894 bp, 297 aa]
          Length = 297

 Score =  449 bits (1154), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 207/291 (71%), Positives = 240/291 (82%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           M +   +KEV+L HP++E T+V IL YGAT+YSW +  EEQLWLS AAKLDGSKPVRGGI
Sbjct: 1   MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKN+ DEH SKLPQHGLARNSTWEFLGQTKENPP VQFGL PE+AN ELT LW
Sbjct: 61  PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           P DY L+LTVELG ++LKT IEV NTS+S+ L+FNWLFHTY +I+D+E TMVSNL   K 
Sbjct: 121 PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL 180

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQLLK SYVD+ PVV F++E D IYQ V+ +R IQIVDKG  IH++ R NLPD VVWNP
Sbjct: 181 YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP 240

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           WIEKS  M DF+PK GYQ+MICIEPGHVHDF++L PG+KW+ YQLL K+ L
Sbjct: 241 WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEEL 291

>CAGL0K03289g 300996..301889 highly similar to sp|Q03161
           Saccharomyces cerevisiae YMR099c, start by similarity
          Length = 297

 Score =  425 bits (1092), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 192/291 (65%), Positives = 233/291 (80%), Gaps = 1/291 (0%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           MS++  + +V++ HPSN  T+V IL YGAT+ SW ++GEEQLWLS AAKLDGSKPVRGGI
Sbjct: 1   MSIEETDSQVVITHPSNSNTSVTILKYGATVTSWKLNGEEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKN  DE  SKLPQHG ARNSTWEFLGQ K NPP VQFGL P++AN+EL  LW
Sbjct: 61  PLVFPVFGKNQSDELLSKLPQHGFARNSTWEFLGQVKSNPPTVQFGLNPKIANQELVKLW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           P D+ L+LT+ELGE+ LKT IEV N S  + ++FNWLFHTYL I+D+EDTMVSNL   K 
Sbjct: 121 PLDFNLILTIELGEDFLKTAIEVENAS-EENMKFNWLFHTYLHIEDIEDTMVSNLVGMKV 179

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQLLK S++D+ PVV FH+E D IYQ V  DR+IQ+V KG+P+H+V R NLPD VVWNP
Sbjct: 180 YDQLLKESFIDKHPVVTFHQETDSIYQNVDSDRLIQVVGKGKPLHTVKRENLPDAVVWNP 239

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           W++KSA M DF+PK+G++ M+C+EPGHV DFV L PG+KWS  Q+LSK  L
Sbjct: 240 WVDKSAGMGDFEPKDGFKNMVCVEPGHVSDFVVLPPGQKWSAAQILSKQEL 290

>Scas_717.65
          Length = 296

 Score =  424 bits (1090), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (79%)

Query: 1   MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI 60
           M +  ++ EVIL HP N +++V IL YGAT+YSW I+G EQLWLS AAKLDGSKPVRGGI
Sbjct: 1   MPIQNNDSEVILTHPKNSQSSVTILKYGATVYSWKINGVEQLWLSTAAKLDGSKPVRGGI 60

Query: 61  PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW 120
           PLVFPVFGKN  D   SKLPQHGLARNSTWEFLGQ KE+PP +QFGL  E+AN ELT LW
Sbjct: 61  PLVFPVFGKNETDPLLSKLPQHGLARNSTWEFLGQVKEDPPTIQFGLNKEIANPELTKLW 120

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
           P D+ LVLTVELG + LKT IEV NTS S+ L+FNWLFHTYL+I+D+EDTMVSNL     
Sbjct: 121 PQDFQLVLTVELGVDFLKTSIEVDNTSNSEELKFNWLFHTYLRIEDIEDTMVSNLAGMNF 180

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP 240
           YDQL+K S VD+ PVV FH+E D IY+ V  DRVIQ+V++G+PIH++ R NLPD VVWNP
Sbjct: 181 YDQLIKESMVDKHPVVTFHQETDVIYKNVNADRVIQVVNRGKPIHTLKRENLPDAVVWNP 240

Query: 241 WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTL 291
           W++KS  M DF+PK GY+ M+C+EPGHVHDFV L PG+KW+  QLL KD L
Sbjct: 241 WVKKSEGMGDFEPKSGYKNMVCVEPGHVHDFVVLAPGKKWNASQLLYKDAL 291

>Scas_254.2
          Length = 151

 Score =  242 bits (618), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 125/146 (85%)

Query: 146 TSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKTYDQLLKTSYVDRQPVVAFHEEVDRI 205
           TS SQ L+FNWLFHTYLKIDD+EDTMVSNL   K YDQ+LK +YVD+QPVV+FHEE+DRI
Sbjct: 1   TSNSQQLKFNWLFHTYLKIDDIEDTMVSNLVGSKLYDQMLKETYVDKQPVVSFHEELDRI 60

Query: 206 YQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNPWIEKSANMQDFQPKEGYQKMICIEP 265
           YQQV DDR++Q+VDKG P+H+V R NLPD VVWNPW+EKS  M DF+PK GY+ M+C+EP
Sbjct: 61  YQQVEDDRLVQVVDKGHPVHTVKRHNLPDAVVWNPWVEKSKGMGDFEPKSGYKNMVCVEP 120

Query: 266 GHVHDFVTLQPGEKWSGYQLLSKDTL 291
           GHVHDFV LQPGEKW+ YQLL KD L
Sbjct: 121 GHVHDFVVLQPGEKWNAYQLLYKDEL 146

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 9/118 (7%)

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT 180
            F  TL   +EL  +HL T+   + T+ S   RF  +    L  D V     S +  F  
Sbjct: 374 KFRDTLNNFLELFTQHLSTKFHAIVTNRSGKTRF--IERLELARDSVTKEFSSTVSEFSK 431

Query: 181 YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVW 238
            + L   S VD++  +AF+E VDRI ++  D  +  I+ +     +     L D V++
Sbjct: 432 LEVL---SSVDKE-TLAFNEIVDRISREQRDKELKSIISRSNKFIT---SQLKDDVIY 482

>YIR028W (DAL4) [2692] chr9 (408465..410372) Allantoin permease,
           member of the uracil/allantoin permease family of
           membrane transporters [1908 bp, 635 aa]
          Length = 635

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 9/98 (9%)

Query: 66  VFGKNTDDEHFSKLPQH-GLARNSTWEFLGQTKENPPAVQFGL-GPELANEELT---ALW 120
           +FGKN +D    ++P H G   ++T+EF+        ++ F L  P       T   AL 
Sbjct: 223 IFGKNLED----RIPNHFGSPNSTTFEFMCFFIFWVVSIPFVLVAPHKIRHLFTVKAALI 278

Query: 121 PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLF 158
           PF     L   L + H K E+  +N  +     F+W+F
Sbjct: 279 PFAAFGFLIWALKKSHGKIELGTLNDYSPHGSEFSWIF 316

>YDR539W (YDR539W) [1348] chr4 (1512080..1513591) Member of the
           3-octaprenyl-4-hydroxybenzoate carboxy-lyase family,
           which are involved in ubiquinone biosynthesis, has high
           similarity to uncharacterized C. albicans Orf6.4909p
           [1512 bp, 503 aa]
          Length = 503

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 68  GKNTDDEHFSKL---PQHGLARNSTWEFLGQTKENPPAVQFGLGP 109
           G   DD+H + L   PQH      +W  +G+  E P A+ FG+ P
Sbjct: 176 GMVVDDKHITGLVIKPQHIRQIADSWAAIGKANEIPFALCFGVPP 220

>ADL231W [1510] [Homologous to ScYNL042W (BOP3) - SH]
           complement(298760..299857) [1098 bp, 365 aa]
          Length = 365

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 12/57 (21%)

Query: 97  KENPPAVQFGLGPELANEELTALWPFDYT-LVLTVELGEEHLKT-----EIEVVNTS 147
           KE  PA+   LGP++AN      WP+  T L+  +EL  E  KT     ++E VN S
Sbjct: 27  KEAVPAISSLLGPQVAN------WPYSETSLIHALELKVEQEKTKQQYYKLENVNRS 77

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,444,213
Number of extensions: 460498
Number of successful extensions: 1143
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1142
Number of HSP's successfully gapped: 19
Length of query: 291
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 190
Effective length of database: 13,099,691
Effective search space: 2488941290
Effective search space used: 2488941290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)