Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL054C35935217940.0
KLLA0C14256g36831812661e-175
Kwal_26.768536031512271e-169
Scas_721.13335935011971e-165
YKL114C (APN1)36735311781e-162
CAGL0K11528g35431711701e-161
KLLA0C02453g102870750.31
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL054C
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL054C [538] [Homologous to ScYKL114C (APN1) - SH] (297682..298...   695   0.0  
KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces...   492   e-175
Kwal_26.7685                                                          477   e-169
Scas_721.133                                                          465   e-165
YKL114C (APN1) [3149] chr11 complement(222998..224101) AP endonu...   458   e-162
CAGL0K11528g 1116427..1117491 highly similar to sp|P22936 Saccha...   455   e-161
KLLA0C02453g complement(216740..219826) gi|12656113|gb|AAK00752....    33   0.31 

>ABL054C [538] [Homologous to ScYKL114C (APN1) - SH]
           (297682..298761) [1080 bp, 359 aa]
          Length = 359

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/352 (95%), Positives = 336/352 (95%)

Query: 1   MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKR 60
           MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKR
Sbjct: 1   MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKR 60

Query: 61  FHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHP 120
           FHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHP
Sbjct: 61  FHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHP 120

Query: 121 GSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQK 180
           GSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQK
Sbjct: 121 GSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQK 180

Query: 181 DRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRH 240
           DRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRH
Sbjct: 181 DRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRH 240

Query: 241 ELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQ 300
           ELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQ
Sbjct: 241 ELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQ 300

Query: 301 EYKDKCAELQQRGAKSRQXXXXXXXXXXXXXXXXTGSRKRAAGQADIVSQMG 352
           EYKDKCAELQQRGAKSRQ                TGSRKRAAGQADIVSQMG
Sbjct: 301 EYKDKCAELQQRGAKSRQEFAAKFEKKKAKAEKATGSRKRAAGQADIVSQMG 352

>KLLA0C14256g 1239373..1240479 similar to sp|P22936 Saccharomyces
           cerevisiae YKL114c APN1 AP endonuclease singleton, start
           by similarity
          Length = 368

 Score =  492 bits (1266), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 268/318 (84%), Gaps = 2/318 (0%)

Query: 1   MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKR 60
           M FVR T S++KFGAHVSGAGGISNSV NAH IGCN+FAMFLKSP+QW SK Y   EI +
Sbjct: 14  MSFVRSTTSKFKFGAHVSGAGGISNSVTNAHEIGCNSFAMFLKSPRQWNSKPYPESEITK 73

Query: 61  FHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHP 120
           F++NC +L Y+P+TD+LPHG YFINL NPD EKAEKAY AFLDDL RCEQLGIG YNFHP
Sbjct: 74  FNENCAKLSYDPKTDILPHGSYFINLGNPDHEKAEKAYDAFLDDLVRCEQLGIGHYNFHP 133

Query: 121 GSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQK 180
           GS+L G++D QL+QLA YIN+AI++TKFV IVLENMAGHGN+IGS LEDL+TVID++E K
Sbjct: 134 GSSLDGDHDTQLKQLAGYINKAINDTKFVNIVLENMAGHGNLIGSNLEDLKTVIDMIEDK 193

Query: 181 DRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRH 240
           +RVGVCVDTCHT+AAGYDI ++ AFD FW KF   +G +YL ++H+NDSKAPLAANADRH
Sbjct: 194 NRVGVCVDTCHTYAAGYDISTKNAFDQFWKKFDAIIGFKYLKAIHLNDSKAPLAANADRH 253

Query: 241 ELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQ 300
           E+LGQGFLGLE F++IA S+FLQ IPI+LETPQKED GYGEEIK+LEWLE +D+E    +
Sbjct: 254 EILGQGFLGLEVFKIIAHSEFLQGIPIVLETPQKEDAGYGEEIKLLEWLETIDEEE--NK 311

Query: 301 EYKDKCAELQQRGAKSRQ 318
           +Y +K   L + G KSR+
Sbjct: 312 DYIEKRLALNKLGEKSRK 329

>Kwal_26.7685
          Length = 360

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 216/315 (68%), Positives = 263/315 (83%), Gaps = 1/315 (0%)

Query: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62
           F RC++S+YKFGAH+S AGGISNSV NA  IGCNAFAMFLKSP++WVS  YS EEI++F 
Sbjct: 4   FTRCSSSKYKFGAHISTAGGISNSVTNAFNIGCNAFAMFLKSPRKWVSPDYSQEEIEKFK 63

Query: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122
           +NC+ELGYNP TDVLPHG YFINLANP+ EKAEK+Y +F+DDL+RCEQLG+GLYNFHPGS
Sbjct: 64  ENCKELGYNPLTDVLPHGQYFINLANPEHEKAEKSYASFIDDLRRCEQLGVGLYNFHPGS 123

Query: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182
           +LK ++  QLRQLA YIN+AISET FVKIVLENMAG G ++GS+L DL+ VIDLV+ K R
Sbjct: 124 SLKADHPTQLRQLASYINKAISETSFVKIVLENMAGTGTLVGSELSDLKEVIDLVDDKSR 183

Query: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242
           VGVC+DTCHTFAAGYDI S+ AFD FW  F  T+G +YLA++H+NDSKAPLAAN D HE 
Sbjct: 184 VGVCIDTCHTFAAGYDISSKEAFDKFWQLFDETIGFKYLAAIHLNDSKAPLAANRDLHEK 243

Query: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQEY 302
           LG+GF+GLE F+L+A+SDFL+ IPIILETP  +D+GYG EIK+LEWLE   ++  L  E+
Sbjct: 244 LGEGFIGLEIFKLVAQSDFLKGIPIILETPHTKDEGYGHEIKLLEWLENFKEDTDL-AEF 302

Query: 303 KDKCAELQQRGAKSR 317
           + K  +L  +GAKSR
Sbjct: 303 ESKAQDLLSKGAKSR 317

>Scas_721.133
          Length = 359

 Score =  465 bits (1197), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 216/350 (61%), Positives = 268/350 (76%), Gaps = 3/350 (0%)

Query: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62
           F+R T S+YKFGAH+SGAGGISNSV+NAH  GCNAFAMFLKSP++WVS A++ EEI +F+
Sbjct: 4   FIRSTTSKYKFGAHMSGAGGISNSVLNAHNTGCNAFAMFLKSPRKWVSPAFTKEEIAKFN 63

Query: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122
           DNCE+  YNP TD+LPHG Y INLANPD EK +K+Y +FLDDL+RCE LGIGLYNFHPGS
Sbjct: 64  DNCEKFNYNPLTDILPHGHYLINLANPDLEKVDKSYESFLDDLKRCESLGIGLYNFHPGS 123

Query: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182
            LKG+   QL+QLA ++NRAI ETKFVKI+LENMAG GN++GS L+DL  VI++VE K R
Sbjct: 124 VLKGDRQVQLKQLAQFLNRAIKETKFVKILLENMAGTGNLVGSNLKDLHDVIEMVEDKTR 183

Query: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242
           +GVCVDTCHTFAAGYDI ++ +FD FW  F + +G++YL +MH+NDSKAPL AN D HE 
Sbjct: 184 IGVCVDTCHTFAAGYDISNQESFDKFWKDFDSIIGLKYLHAMHLNDSKAPLGANRDLHEK 243

Query: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQQEY 302
           LG+GFLGLE FR+IA +D L+ IPIILETPQ +++GYG EIK+LEWLE V++     QE 
Sbjct: 244 LGEGFLGLEVFRIIAHADHLRGIPIILETPQPDEEGYGHEIKLLEWLESVENPE--DQEL 301

Query: 303 KDKCAELQQRGAKSRQXXXXXXXXXXXXXXXXTGSRKRAAGQ-ADIVSQM 351
             K  E QQ G+KSR+                   RK A+ + ADI +Q+
Sbjct: 302 ITKSEEKQQLGSKSRKEQLSKWEIKQKKATKVPRKRKTASSEGADIAAQL 351

>YKL114C (APN1) [3149] chr11 complement(222998..224101) AP
           endonuclease, DNA (apurinic or apyrimidinic site) lyase
           (3'-repair diesterase) [1104 bp, 367 aa]
          Length = 367

 Score =  458 bits (1178), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 265/353 (75%), Gaps = 5/353 (1%)

Query: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62
           FVR   S+YKFGAH+SGAGGISNSV NA   GCN+FAMFLKSP++WVS  Y+ EEI +F 
Sbjct: 7   FVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKFK 66

Query: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122
            NC    YNP TDVLPHG YFINLANPDREKAEK+Y +F+DDL RCEQLGIGLYN HPGS
Sbjct: 67  KNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPGS 126

Query: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182
            LKG++  QL+QLA Y+N+AI ETKFVKIVLENMAG GN++GS L DL+ VI ++E K R
Sbjct: 127 TLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKSR 186

Query: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242
           +GVC+DTCHTFAAGYDI +   F++FW +F   +G +YL+++H+NDSKAPL AN D HE 
Sbjct: 187 IGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHER 246

Query: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDDEAALQ-QE 301
           LGQG+LG++ FR+IA S++LQ IPI+LETP + D+GYG EIK++EWLE   +   L+ +E
Sbjct: 247 LGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESELLEDKE 306

Query: 302 YKDKCAELQQRGAKSRQXXXXXXXXXXXXXXXXTGSRKRAAGQA---DIVSQM 351
           YK+K   LQ+ GAKSR+                T  RK+A  +    DI+SQM
Sbjct: 307 YKEKNDTLQKLGAKSRKEQLDKFEVKQKKRAGGT-KRKKATAEPSDNDILSQM 358

>CAGL0K11528g 1116427..1117491 highly similar to sp|P22936
           Saccharomyces cerevisiae YKL114c APN1 AP endonuclease,
           hypothetical start
          Length = 354

 Score =  455 bits (1170), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 256/317 (80%), Gaps = 1/317 (0%)

Query: 3   FVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSPKQWVSKAYSAEEIKRFH 62
           F R T S+YKFGAH+SGAGGISNSV NA   GCN+FAMFLKSP++WVS A++ EEI +F 
Sbjct: 4   FARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLKSPRKWVSPAFTQEEIAKFK 63

Query: 63  DNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDDLQRCEQLGIGLYNFHPGS 122
           +NCE+ GYNP TD+LPHG YFINLANPD EKAEK+Y +F+DDL RCEQLG+GLYNFHPGS
Sbjct: 64  ENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESFIDDLTRCEQLGVGLYNFHPGS 123

Query: 123 ALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNIIGSKLEDLRTVIDLVEQKDR 182
            LKG++D QL+QLA YIN+A+ ETKFVKIVLENMAG GN++GS L DLR VID+V  K R
Sbjct: 124 TLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGTGNLVGSDLTDLRKVIDMVTDKSR 183

Query: 183 VGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLASMHINDSKAPLAANADRHEL 242
           +GVC+DTCHTFAAGYDI+S+ AFD FW  F   +G +YLAS+H+NDSKAPL AN D HE 
Sbjct: 184 IGVCIDTCHTFAAGYDIQSKDAFDKFWKDFDDIIGYKYLASVHLNDSKAPLGANRDLHEK 243

Query: 243 LGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGEEIKMLEWLEGVDD-EAALQQE 301
           LG+G+LGL+ FR +A  D L+ IPI+LETPQ +D GY +E+K+LEWLE ++D +    +E
Sbjct: 244 LGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPDDAGYAKEVKLLEWLETIEDGDTDKLKE 303

Query: 302 YKDKCAELQQRGAKSRQ 318
            + K  ELQ+ G KSR+
Sbjct: 304 MEAKNEELQKLGEKSRK 320

>KLLA0C02453g complement(216740..219826)
           gi|12656113|gb|AAK00752.1|AF229182_1 Kluyveromyces
           lactis transcription factor Tfc4p, start by similarity
          Length = 1028

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 12  KFGAHVSGAGGISNSVVNAHRIGCN----AFAMFLKSPKQWVSKAYSAEEIKRFHDNCEE 67
           +FG HV+G   I+N V N  R  C      +AM L S K ++    + + +KR      E
Sbjct: 854 RFGQHVNGQASITNKVSNPERKICTYLNYIYAMLLYSSKGFMP---ALQYLKRIE---LE 907

Query: 68  LGYNPRTDVL 77
           +G +P  D++
Sbjct: 908 VGDDPMLDLI 917

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,624,257
Number of extensions: 446442
Number of successful extensions: 1059
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1068
Number of HSP's successfully gapped: 10
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)