Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL030W60259130490.0
Sklu_2430.362660910161e-130
Kwal_26.76246026069771e-125
YMR106C (YKU80)6295819791e-125
Scas_717.716256129191e-116
CAGL0K03443g6155947427e-90
KLLA0B12672g6095956772e-80
YER151C (UBP3)91258730.91
KLLA0B02090g1119107702.1
KLLA0C16203g145493674.7
YIL017C (VID28)92157675.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL030W
         (591 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH] complement(...  1179   0.0  
Sklu_2430.3 YMR106C, Contig c2430 3786-5666                           395   e-130
Kwal_26.7624                                                          380   e-125
YMR106C (YKU80) [4063] chr13 complement(478300..480189) Componen...   381   e-125
Scas_717.71                                                           358   e-116
CAGL0K03443g complement(316368..318215) similar to sp|Q04437 Sac...   290   7e-90
KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437 Saccha...   265   2e-80
YER151C (UBP3) [1580] chr5 complement(469681..472419) Ubiquitin-...    33   0.91 
KLLA0B02090g 183718..187077 similar to sp|P53125 Saccharomyces c...    32   2.1  
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    30   4.7  
YIL017C (VID28) [2647] chr9 complement(318198..320963) Protein p...    30   5.5  

>ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH]
           complement(341669..343477) [1809 bp, 602 aa]
          Length = 602

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/591 (96%), Positives = 573/591 (96%)

Query: 1   MSQECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNV 60
           MSQECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNV
Sbjct: 1   MSQECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNV 60

Query: 61  KNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRK 120
           KNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRK
Sbjct: 61  KNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRK 120

Query: 121 MLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDG 180
           MLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDG
Sbjct: 121 MLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDG 180

Query: 181 SRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCINVEGYPAT 240
           SRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCINVEGYPAT
Sbjct: 181 SRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCINVEGYPAT 240

Query: 241 KAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEYHVVPVPKEHVTKAYRYGAD 300
           KAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEYHVVPVPKEHVTKAYRYGAD
Sbjct: 241 KAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEYHVVPVPKEHVTKAYRYGAD 300

Query: 301 YVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMADSREGTAADYVTFAA 360
           YVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMADSREGTAADYVTFAA
Sbjct: 301 YVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMADSREGTAADYVTFAA 360

Query: 361 LVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKKRPADDDAAEAKRALVLCRLP 420
           LVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKKRPADDDAAEAKRALVLCRLP
Sbjct: 361 LVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKKRPADDDAAEAKRALVLCRLP 420

Query: 421 FAEDERSSDFPPLVKQEPADVMLDTTMAAFIXXXXXXXXXXXXXXXXXXNVRSFDSFMKD 480
           FAEDERSSDFPPLVKQEPADVMLDTTMAAFI                  NVRSFDSFMKD
Sbjct: 421 FAEDERSSDFPPLVKQEPADVMLDTTMAAFIDSMDMDAAAPPASWCSSSNVRSFDSFMKD 480

Query: 481 STLPLPDDPSLAEPCSAAACIPAVALHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRS 540
           STLPLPDDPSLAEPCSAAACIPAVALHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRS
Sbjct: 481 STLPLPDDPSLAEPCSAAACIPAVALHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRS 540

Query: 541 KVSPWATAETSELAARIKDTCAVKLVERPPEATAGAYVDEEQDEASEVPPL 591
           KVSPWATAETSELAARIKDTCAVKLVERPPEATAGAYVDEEQDEASEVPPL
Sbjct: 541 KVSPWATAETSELAARIKDTCAVKLVERPPEATAGAYVDEEQDEASEVPPL 591

>Sklu_2430.3 YMR106C, Contig c2430 3786-5666
          Length = 626

 Score =  395 bits (1016), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/609 (39%), Positives = 347/609 (56%), Gaps = 32/609 (5%)

Query: 1   MSQECTTFLIDYSASMLES--TAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPN 58
           MS E TTFLID S SM+      K  AYLEY LF K ++ RKTDY   +L NC + KN  
Sbjct: 1   MSSEATTFLIDVSHSMVAGGHVDKALAYLEYTLFQKVKKGRKTDYVSCILVNCPLTKNNQ 60

Query: 59  NVKNMFEVFAPSAPITLSSVVKICERLKA-MRELDPLDTKQS---NVFEALLAIGMQVND 114
           +   ++E    +AP+T  + VK+ + ++  ++ ++  D   S   ++ +++L   + + D
Sbjct: 61  DTDYIYEALEVTAPVTSVTTVKLLKDIRTVLQYIETTDKDHSECLSMIQSVLVSSVILRD 120

Query: 115 KFNKRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQ--FPDNFSKTKWG 172
            F KRK+ K ++V TDD+DGL+ D ++L+++   LD R+ILV+C ++    DN   T WG
Sbjct: 121 FFKKRKITKNLVVFTDDMDGLDCDDDELQIMSNELDCRIILVHCEDEKKLKDN-GDTIWG 179

Query: 173 QLLALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCI 232
           + +    GS  +T+ E+L TI       VKPVR+F G+LRLGA M +      D   +CI
Sbjct: 180 KCVRSVPGSVKYTILELLRTITIPKPPVVKPVRIFQGELRLGASMEDAGSSMDDFKSICI 239

Query: 233 NVEGYPATKAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEYHVVPVPKEHVT 292
            VEG+PATKAV +++RK V K  +  Y P++S+IEYEIH     +  E+  V V K  +T
Sbjct: 240 QVEGFPATKAVSNLNRKVVVKNGENDYSPVKSIIEYEIHNRVNGETSEFDAVAVSKSSIT 299

Query: 293 KAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMADSREGTA 352
           KAYRYG+DYVVLP  LE ER+Y T PGLDIRGF+D     R++L SES +I+ D+R+G+ 
Sbjct: 300 KAYRYGSDYVVLPPTLESERIYETEPGLDIRGFLDRKDFPRYYLNSESTFIVTDTRQGSR 359

Query: 353 ADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKKRPADDDAAEAKR 412
           ADY+  +ALVD++I  EKFAIARYVQ+K+SEVQMCLLCP+L++ +   +       +  R
Sbjct: 360 ADYMALSALVDSLIKLEKFAIARYVQRKNSEVQMCLLCPILIDDTNGMKRKLGREEQHTR 419

Query: 413 ALVLCRLPFAEDERSSDFPPLVKQEPAD--------VMLDTTMAAFIXXXXXXXXXXXXX 464
           AL+L RLPFAEDERS DFP L  Q              LD+ M+ FI             
Sbjct: 420 ALILSRLPFAEDERSPDFPKLSYQRTTSGKTLVEDTTNLDSQMSMFIDSMDLDDNTGSSE 479

Query: 465 XXXXXN---VRSFDSFMKDSTLPLPD-DPSLAEPCSAAA--CIPAVALHHQKHVLLEYFR 518
                N   V +  +    +T+PLP  +    EP +     C+PA++ H Q+  LLEY  
Sbjct: 480 SSWYRNPCFVTADPTNALSTTIPLPSIEQDGKEPKANGNPLCMPAISAHRQQQALLEYMH 539

Query: 519 QRFILRLSGG----FSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKLVERPPEATA 574
           Q++++         F V  + D L SK  P    E  EL+ R+ +   +K    P E   
Sbjct: 540 QKYVMETKKDDKFEFQVPSMPDLLLSKTRPPKLPEI-ELSNRLVEMLDIK----PNENRK 594

Query: 575 GAYVDEEQD 583
               DEE D
Sbjct: 595 RFARDEELD 603

>Kwal_26.7624
          Length = 602

 Score =  380 bits (977), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 243/606 (40%), Positives = 352/606 (58%), Gaps = 28/606 (4%)

Query: 1   MSQECTTFLIDYSASMLE--STAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPN 58
           M  E TTF+ID S SM+E     +  AYLEY LF K+++ RKTD+ +  LANC + +N  
Sbjct: 1   MGSEATTFIIDVSPSMIELGYAEQASAYLEYTLFLKSKKQRKTDWVNCYLANCPLTRNSY 60

Query: 59  NVKNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSN-VFEALLAIGMQVNDKFN 117
              N+FE+   +API+   V++    L+++ +      ++ N + + LL   M + D+F 
Sbjct: 61  ETDNVFELMPFTAPISADRVIETLRELQSVSQKSIASKERINTMIQCLLVTSMNMRDEFK 120

Query: 118 KRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCA--EQFPDNFSKTKWGQLL 175
           KRK+ KQ+MV TDDL+GL++  E+L  ++  L   LILV C   +   ++   T W + +
Sbjct: 121 KRKIRKQIMVFTDDLNGLDLTEEELTTLEQELGCSLILVKCGPKKDSSEDMKLTIWEKCI 180

Query: 176 ALKDGSRMFTLYEVLGTIERITHQP--VKPVRVFHGQLRLGADMRNLAGCQQDPHCLCIN 233
            +  GSR  T+ E+L  I   +H+P  VKP+R+F   LRLGA +    G + +   L + 
Sbjct: 181 QVIPGSRQTTMTELLKEIS--SHRPAVVKPIRIFQANLRLGAQIFQEEGQETNYDSLDVK 238

Query: 234 VEGYPATKAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEYHVVPVPKEHVTK 293
           VEGYPATKAV S++R+ V K  + +Y  ++S+IEY   E  E+D++      V K+ VTK
Sbjct: 239 VEGYPATKAVSSLNRRVVAKIGEQEYEQVKSIIEYSALE--EDDSDSAEAASVSKDFVTK 296

Query: 294 AYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMADSREGTAA 353
           AYRYG+DYVVLP+ +E ER+Y TTPGLD+RGF+D   + RH+L SES +I+A +++G+ A
Sbjct: 297 AYRYGSDYVVLPQTIESERIYKTTPGLDLRGFLDKEDIPRHYLNSESTFIVASTKDGSRA 356

Query: 354 DYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKKRPADDDAAEAKRA 413
           D++ FAALVD+MI   KFA+ARYVQK +SEVQMC+LCPLLV+   KKR   +D+    RA
Sbjct: 357 DFLAFAALVDSMIKLNKFAVARYVQKTNSEVQMCVLCPLLVK---KKRRELEDSEPYYRA 413

Query: 414 LVLCRLPFAEDERSSDFPPLVKQ----EPADVMLDTTMAAFIXXXXXXXXXXXXXXXXXX 469
           LVL RLPFAEDER SD+P L +     E   V  D  M  FI                  
Sbjct: 414 LVLNRLPFAEDERVSDYPKLSRSSGMPEAKIVETDALMDDFI-DSMDLGGGGDSSWCYTS 472

Query: 470 NVRSFDSFMKDSTLPLP--DDPSLAEPCSAAACIPAVALHHQKHVLLEYFRQRFILRLSG 527
             R  DS   D +LPLP  D P   E       +PA+ ++ Q+ +L+EY  QR ++  S 
Sbjct: 473 RYRPIDSATTDPSLPLPASDSPRDDEKPDPMQ-LPAIGVYRQQQLLVEYMHQRVVMG-SD 530

Query: 528 GFSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKLVERPPEATAGAYVDEEQDEAS- 586
            F V +L   L+  +S  +   ++ L  R++D   +K         +    DE+QDE   
Sbjct: 531 TFEVPELPMDLQKSLSSPSKPPSNTL-KRLQDLLEIK--PNTSNTKSNTPTDEQQDEDDL 587

Query: 587 -EVPPL 591
            E+P L
Sbjct: 588 LEIPSL 593

>YMR106C (YKU80) [4063] chr13 complement(478300..480189) Component
           of DNA end-joining repair pathway, involved in
           protecting telomeres from homologous recombination, acts
           in a complex with Yku70p [1890 bp, 629 aa]
          Length = 629

 Score =  381 bits (979), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/581 (37%), Positives = 331/581 (56%), Gaps = 46/581 (7%)

Query: 1   MSQECTTFLIDYSASMLEST--AKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPN 58
           MS E TTF++D S SM+++   +K  AYLEY L +K+++SRKTD+    LANC + +N  
Sbjct: 1   MSSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQ 60

Query: 59  NVKNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQ---SNVFEALLAIGMQVNDK 115
            + N+F++ +  AP+T ++ +   +RLK   +    D+      ++ + LL + + +  +
Sbjct: 61  EIPNVFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQ 120

Query: 116 FNKRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLL 175
           F  RK+LKQ++V TD+LD L++  E+++++   L  R+IL+ C +   +   K+ W +L+
Sbjct: 121 FQARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSNWLKLV 180

Query: 176 ALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADM-----RNLAGCQQDPHCL 230
                SR++ + E+L  I       VKPVRVF G+LRLGAD+      N +G  QD +CL
Sbjct: 181 EAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSGSMQDENCL 240

Query: 231 CINVEGYPATKAVVSMSRKQVQKTEDG----KYLPLQSVIEYEIHEPTEEDN-------- 278
           CI VE +PATKAV  ++RK   + ED     +Y+ ++S+IEYEIH    + N        
Sbjct: 241 CIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVSEDDQSG 300

Query: 279 EEYHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCS 338
             Y  V + K+ VTKAYRYGADYVVLP +L  + +Y + PGLD+RGF++   + R+ L S
Sbjct: 301 SSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPRYFLTS 360

Query: 339 ESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPST 398
           ES +I AD+R G  +D + F+ALVD M+   K A+ARYV KKDSEV MC LCP+L+E S 
Sbjct: 361 ESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSN 420

Query: 399 KKRPADDDAAEAK--RALVLCRLPFAEDERSSDFPPL----------VKQEPADVMLDTT 446
                    +E K  ++L LCRLPFAEDER +DFP L          +K+E     +D  
Sbjct: 421 IN-------SEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETDGHQIDEL 473

Query: 447 MAAFIXXXXXXXXXXXXXXXXXXNVRSFDSFMKDSTLPLPD-DPSLAEPCSAAACIPAVA 505
           M  F+                    +       D+TLPLP  +    E       IP V 
Sbjct: 474 MEQFVDSMDTDELPEIPLGNY---YQPIGEVTTDTTLPLPSLNKDQEENKKDPLRIPTVF 530

Query: 506 LHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRSKVSPWA 546
           ++ Q+ VLLE+  Q  ++  S  F + +L DSL++K+SP+ 
Sbjct: 531 VYRQQQVLLEWIHQ-LMINDSREFEIPELPDSLKNKISPYT 570

>Scas_717.71
          Length = 625

 Score =  358 bits (919), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 226/612 (36%), Positives = 337/612 (55%), Gaps = 39/612 (6%)

Query: 1   MSQECTTFLIDYSASML--ESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPN 58
           MS E TTF++D S +M+  ++ +K  AY+E+ L +K ++ RKTD+T +  AN     N  
Sbjct: 1   MSAESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQ 60

Query: 59  NVKNMFEVFAPSAPITLSSVVKICERLKAMREL-DPLDTKQSNVFEALLAIGMQVNDKFN 117
            V N+ ++    AP+T   V     RL+   E+ +  D  +S++ + LL   + + ++F 
Sbjct: 61  EVPNVSQLSPFIAPVTSDDVAATMRRLQKQCEVKNEADDMESSMVQCLLVASLDIREQFG 120

Query: 118 KRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTK------W 171
            +KML+Q+MV TDDL+GLN + E+++V+   +D R+ILV C E   D   + K      W
Sbjct: 121 AKKMLRQIMVFTDDLNGLNFNDEEIDVLVGEIDSRIILVDCQEDSEDGEEEGKKNVDKAW 180

Query: 172 GQLLALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADM-RNLAGCQQDPHCL 230
            +L+    GS +  + ++L  I       VKPVRVF+G+LRLGA++  N      D +CL
Sbjct: 181 LKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDMNCL 240

Query: 231 CINVEGYPATKAVVSMSRKQVQKTEDG-----KYLPLQSVIEYEIHEPTE-----EDNEE 280
            + VEGYPATK++ S++R+   KT  G     KY+P++SVIEYE+  P E     +D  +
Sbjct: 241 SMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEVINPKESSQDADDKND 300

Query: 281 YHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSES 340
              V V ++ +TKAYRYGADYVVLP  L+ + +Y T PGLDIRGF+D   + R++L SES
Sbjct: 301 ARPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLDIRGFMDMELLPRYYLNSES 360

Query: 341 VYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTKK 400
            +I+AD+R G  AD VTF  LVD ++   K A+ARYV K +SEVQMC+L PL V    + 
Sbjct: 361 TFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQS 420

Query: 401 RPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQE-------PADVM----LDTTMAA 449
              + +     R LVL RLPFAEDER SDFP L  +        P D      LD  M  
Sbjct: 421 FSGEGEENFV-RTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPEDKNEIDELDVLMEE 479

Query: 450 FIXXXXXXXXXXXXXXXXXXNVRSFDSFMKDSTLPLP-DDPSLAEPCSAAACIPAVALHH 508
           F+                    +      +D+TL LP  +    E       IPA+ +H 
Sbjct: 480 FVDSMDTDNLLNVPDPEY---YKPISQVTQDTTLRLPTKEVKELENEQDPLRIPAIGVHR 536

Query: 509 QKHVLLEYFRQRFILRLSGGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKLVER 568
           Q+ VLLE+  Q+ I+  S  F + D+ D LR +++P    +     +++ D   +K VE+
Sbjct: 537 QQQVLLEWIHQKVIMG-SDAFDIPDIPDKLREQIAPHVNKKVD--LSKLLDLLQIKKVEK 593

Query: 569 PPEATAGAYVDE 580
             E     +++E
Sbjct: 594 SAEHGKSEHIEE 605

>CAGL0K03443g complement(316368..318215) similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c, start by similarity
          Length = 615

 Score =  290 bits (742), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 208/594 (35%), Positives = 304/594 (51%), Gaps = 79/594 (13%)

Query: 4   ECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNVKNM 63
           E T+ LID     L   AK  AYLEY L DKA+R RKTDY    L N    +N  +V ++
Sbjct: 3   EATSVLIDVDVEPL-IIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVPHV 61

Query: 64  FEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRKMLK 123
             +    AP T  ++  + +     RE      +  N+ +ALL   +   D F KRK+ K
Sbjct: 62  VRLCDFLAPTTEGAIALLRQLALVRREY-----RGDNILQALLLASIDGRDYFGKRKVAK 116

Query: 124 QVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDGSRM 183
           Q+M+ TD +  L++ +E+L+ +   LD R+ILV C+     N   ++W  L+    GS  
Sbjct: 117 QLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQWDALVRTVKGSMS 176

Query: 184 FTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQ------------------- 224
           F + E+L  I +   + VKPV VF GQLRLGA + N+   +                   
Sbjct: 177 FHIDELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEPHRRDEAAAADNPKKRQFP 236

Query: 225 ---------QDPHCLCINVEGYPATKAVVSMSRKQVQK-TEDGKYLPLQSVIEYEIHEPT 274
                     D HCLCI V+GYPATK   S+ +K V K      ++P++SVI+YE+    
Sbjct: 237 FGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGFVPVKSVIDYELR--- 293

Query: 275 EEDNEEYHV-----------VPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIR 323
             DNE               + V +E +TKAYRYG DYVVLP  LE + +Y T  GLDIR
Sbjct: 294 --DNEVEGEGKGKGEGDAPPITVARESITKAYRYGTDYVVLPSSLEDQLVYQTYAGLDIR 351

Query: 324 GFIDTGKVLRHHLCSESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSE 383
           GF++   + RH L SESV++++ S   ++AD +TF+AL+DAMI  +K AI RYV K +S+
Sbjct: 352 GFMNMSDMHRHFLTSESVFVVSSS---SSADQITFSALIDAMIQIDKIAIGRYVPKNNSD 408

Query: 384 VQMCLLCPLLVEPSTKKRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLV----KQEPA 439
           VQMC+L P+++E          +     R L+L RLPF EDER + FP L     K+   
Sbjct: 409 VQMCMLYPMILE---------KENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSEK 459

Query: 440 DVMLDTTMAAFIXXXXXXXXXXXXXXXXXXNVRSFDSFMKDSTLPLP----DDPSLAEPC 495
           D  +D  MA F+                      ++  ++D+TL LP    D+    +P 
Sbjct: 460 DETIDQLMAGFVESRSMDDLPRVEEKKY---YEFYEDSVRDTTLVLPMKSKDETRERDPL 516

Query: 496 SAAACIPAVALHHQKHVLLEYFRQRFILRLSGGFSVADLRDSLRSKVSPWATAE 549
                +PA+ LH Q  V+LEY  Q  ++  S  F   +L+D L++K++P   ++
Sbjct: 517 ----MVPAMGLHRQLQVMLEYLHQ-VVINKSEKFDPPELQDHLKAKITPHIVSD 565

>KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c HDF2 component of DNA
           end-joining repair pathway singleton, start by
           similarity
          Length = 609

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 196/595 (32%), Positives = 298/595 (50%), Gaps = 59/595 (9%)

Query: 4   ECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAM--EKNPNNVK 61
           E T F++D  +   +   K   Y+EY L +K Q  RKTDY  + L N +   E  P N  
Sbjct: 3   ELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVNNM 62

Query: 62  NMFEVFAPSAPITLSSVVKICERLKAMRE---LDPLDTKQSNVFEALLAIGMQVNDKFNK 118
            M  V  P API++S V     +    R     +  D     +F  LL   +++ +   K
Sbjct: 63  AMLPVL-PRAPISISDVRSWLGQWYDERNNTTGNGEDDDDDMLFNGLLISVLKLKEFVGK 121

Query: 119 RKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQLLALK 178
           RKM K  +VV    D  NV  E+L          L++  C ++      ++K G  L L 
Sbjct: 122 RKM-KVKIVVFSSQDLQNVTDEELSTFADQCPFDLVIADCNDK--QGHQESKHGNWLKL- 177

Query: 179 DGSRM-FTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCINVEGY 237
            G+ + + + E++ ++     +  +P+R F GQLRLG    ++         LCIN+EG 
Sbjct: 178 -GTPLVYGIDELIQSVADPKLKLTRPIRTFQGQLRLG----DVNASDLGIPSLCINLEGV 232

Query: 238 PATKAVVSMSRKQVQK--TEDGK--YLPLQSVIEYEIHE--------PTEE--------- 276
           P TK+V S+SRK ++K  + +G+  Y  ++SVIEY+I +        P +E         
Sbjct: 233 PGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETTRKDDDGD 292

Query: 277 --DNEEYHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRH 334
             +N    ++ V K+ + KAYRYGADYV LP  L+ ER  +  PGLDIRGF+D  K+ RH
Sbjct: 293 SGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMDIDKLPRH 352

Query: 335 HLCSESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLV 394
           +LCSES+Y++ DS+ G+  D++ F  LVD++I  ++  IAR+V K  +EVQMC L P+ V
Sbjct: 353 YLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMCSLFPVRV 412

Query: 395 EPSTKKRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQ---EPADVMLDTTMAAFI 451
                    D D  E  R LVL RLP +EDER+S FP + +    EP     D  M  F+
Sbjct: 413 H--------DKDRNEV-RLLVLNRLPMSEDERNSAFPKMCESTELEPE----DEAMGQFV 459

Query: 452 XXXXXXXXXXXXXXXXXXNVRSF-DSFMKDSTLPLPDDPSLAEPCSAAACIPAVALHHQK 510
                              ++ + D  ++ S+LPLP            + IPA++LH Q+
Sbjct: 460 DSMNLDNDAQDLPWYESDQIQKYTDVALEQSSLPLPQREMFRATARNPSAIPAISLHRQQ 519

Query: 511 HVLLEYFRQRFIL--RLSGGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAV 563
            V+LE   Q+FI+  R     ++  +   +  K++P   A+ S L+ RIK+   V
Sbjct: 520 QVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPKYNADVS-LSNRIKEQFNV 573

>YER151C (UBP3) [1580] chr5 complement(469681..472419)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2739 bp, 912 aa]
          Length = 912

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%)

Query: 289 EHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSESVYIMAD 346
           E + K  +YG + ++  E +    L   T G+D R +  TG +  H + S+  +  AD
Sbjct: 808 EKIRKKIKYGHELIIPEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTAD 865

>KLLA0B02090g 183718..187077 similar to sp|P53125 Saccharomyces
           cerevisiae YGL133w ITC1 subunit of ISW2 chromatin
           remodelling complex, start by similarity
          Length = 1119

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 47/107 (43%), Gaps = 15/107 (14%)

Query: 130 DDLDGLNVDSEDLEVVQ---ANLDLRLILVYCAEQFPDNFSKTKWGQLLALKDGSRMFTL 186
           +D D  + ++EDLE+ +    + DL  +L  C      N+ K KW   L+ +  +  F L
Sbjct: 511 EDTDENSSENEDLEMEENDEVSADLESLLEKCL-----NYRKVKWTDRLSKRQFNNGFWL 565

Query: 187 YEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCIN 233
             +LG ++   H P+    +          ++NL   +  P  + +N
Sbjct: 566 IVLLGVLQDFMHLPMYKSTI-------QGFIKNLVPSEHTPSNISLN 605

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 23  FEAYLEYALFDKAQRSRKTDYTHVVLANCAMEKNPNNVKNMFEVFAPSAPITLSSVVKIC 82
           F+++ E    D+ + SRK    H+ L N   +K+ +   N F++   ++ ++ S +    
Sbjct: 638 FQSFQETNFLDQHKTSRKRSINHMFLKNLVQDKHNSYTPNDFQI--STSELSASHI---- 691

Query: 83  ERLKAMRELDPLDTKQSNVFEALLAIGMQVNDK 115
              K +++      K   V+   ++ G Q+++K
Sbjct: 692 RYFKVIQDPKTFIMKYPQVYSTSISSGFQISEK 724

>YIL017C (VID28) [2647] chr9 complement(318198..320963) Protein
           possibly required for full induction of IME1 during
           early meiosis [2766 bp, 921 aa]
          Length = 921

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 86  KAMRELDPLDTKQSNVFEALLAIGMQVNDKFNKRKMLKQVMVVTDDLDGLNVDSEDL 142
           K MR L+PLDT+Q    E +L I + +    N+ K  KQ+++  D++  LN+ SE L
Sbjct: 697 KKMRLLNPLDTQQKKAMEGILYIIVNL-AAVNENK--KQLVIEQDEI--LNIMSEIL 748

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,010,128
Number of extensions: 748525
Number of successful extensions: 2038
Number of sequences better than 10.0: 14
Number of HSP's gapped: 2049
Number of HSP's successfully gapped: 15
Length of query: 591
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 484
Effective length of database: 12,891,983
Effective search space: 6239719772
Effective search space used: 6239719772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)