Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL028W72270836810.0
Kwal_26.763569170824660.0
Scas_721.12468463924360.0
KLLA0B12716g71673323610.0
Scas_717.6967464123470.0
CAGL0K03399g70359423420.0
CAGL0K07458g70466419840.0
Kwal_47.167617443679041e-111
Scas_703.57493579031e-110
YHR205W (SCH9)8243699071e-110
ADL389W7113898991e-110
CAGL0F09075g7463899001e-110
KLLA0B03586g7343568881e-108
KLLA0B07205g4552927115e-86
Scas_651.183712956932e-84
YJL164C (TPK1)3972926934e-84
CAGL0M08404g4623046977e-84
Kwal_33.138463752956845e-83
Scas_689.25*4092956832e-82
CAGL0G09020g3613016774e-82
Kwal_56.240593533016712e-81
AFL090W3463016563e-79
Scas_690.133543016502e-78
KLLA0D03190g3723016513e-78
CAGL0M09361g11443356918e-78
AEL115C3862956462e-77
ACR191C11493356873e-77
YBL105C (PKC1)11513356865e-77
KLLA0E06413g11613286857e-77
Scas_715.3411503356812e-76
Kwal_27.1058111543326812e-76
Kwal_23.64588683196081e-67
CAGL0C03509g8953195985e-66
Scas_629.169183025952e-65
YCR091W (KIN82)7203135835e-65
CAGL0J06072g7733495831e-64
Kwal_56.227885153915565e-63
ADR167W8733135702e-62
Scas_720.1038043125631e-61
KLLA0F24618g5563595501e-61
KLLA0C18568g7743025601e-61
YBR028C5253605322e-59
CAGL0B04301g5422915281e-58
AEL083W5363525227e-58
Scas_593.14d4952785048e-56
AFL101C3672684553e-50
CAGL0E05720g3582784465e-49
Kwal_56.240913812794451e-48
KLLA0B02332g3612874352e-47
CAGL0B04147g5663754446e-47
Scas_705.235533794402e-46
YGR092W (DBF2)5723434402e-46
CAGL0G03047g5393784321e-45
Kwal_23.39925713434332e-45
KLLA0D14905g5673534172e-43
YDR466W (PKH3)8983044244e-43
KLLA0C12485g9252914236e-43
ADR033W5773534147e-43
KLLA0E03487g6472774177e-43
YDR490C (PKH1)7662974181e-42
Kwal_56.226939842734211e-42
Scas_660.209572804156e-42
Scas_716.335733794068e-42
CAGL0I07513g10762934112e-41
Scas_627.73492633874e-41
AFR377C7262814021e-40
KLLA0F13552g12672653971e-39
KLLA0D07810g7181583932e-39
CAGL0G04609g9652943962e-39
AFR035W7191563878e-39
AFR335C10332923909e-39
Kwal_33.145547141563871e-38
CAGL0K06479g9913043891e-38
Kwal_47.183076212713831e-38
Scas_654.127371563843e-38
ABL034W14252733839e-38
Scas_502.211162903783e-37
Kwal_26.778812672703749e-37
AAR009W4532513583e-36
YDL101C (DUN1)5133033604e-36
CAGL0L07326g5063023586e-36
CAGL0J11638g7462783657e-36
Scas_693.1710493443677e-36
Scas_644.157262773631e-35
Kwal_26.87098292743622e-35
Scas_616.1014613123633e-35
ACL006W7082463576e-35
CAGL0J03872g6613033512e-34
Kwal_0.964272593414e-34
KLLA0E01584g4153073404e-34
AEL230W6082903475e-34
Kwal_47.182335983183466e-34
Scas_660.286232473441e-33
KLLA0C06138g7082933452e-33
AFR696C11422773463e-33
Kwal_26.87967962713434e-33
YDR477W (SNF1)6332483405e-33
CAGL0M08910g6122613387e-33
KLLA0A03806g6022473387e-33
CAGL0K08514g14892123429e-33
CAGL0M02519g7563143382e-32
Scas_618.84272623282e-32
KLLA0F11319g8432613372e-32
Kwal_33.131125052673302e-32
Scas_564.712103383383e-32
CAGL0K05709g11032743373e-32
CAGL0K10604g4462463264e-32
CAGL0F04741g4422473264e-32
Kwal_56.224766972693335e-32
KLLA0F11143g8132783345e-32
ACR133C8512613345e-32
ACR142W8372833346e-32
Scas_700.348642713329e-32
YFR014C (CMK1)4462473231e-31
KLLA0F19536g11043503331e-31
AGR058W10713153302e-31
Scas_700.546983373273e-31
Scas_613.55173333214e-31
CAGL0B01925g9442743275e-31
KLLA0F23155g4272523167e-31
AFR724C4402653141e-30
CAGL0M11396g11923053241e-30
KLLA0C01650g11122783232e-30
Scas_640.14*7282723193e-30
CAGL0M02233g7672913194e-30
Kwal_23.35904992963117e-30
CAGL0L11550g10723093178e-30
YDR507C (GIN4)11422833178e-30
Scas_493.211172813179e-30
YDR122W (KIN1)10642733152e-29
CAGL0M02299g8932673142e-29
ACR119W9312893142e-29
Scas_700.288962613096e-29
YHR102W (KIC1)10802603081e-28
CAGL0K12562g16821603082e-28
KLLA0F09020g9281553043e-28
KLLA0D07348g9092503025e-28
Scas_201.1*2742302855e-28
AFL188C4722722955e-28
Kwal_47.172528723043009e-28
YFL033C (RIM15)17701553011e-27
ACR218W15691603011e-27
ACL104C9472472991e-27
YCL024W (KCC4)10372822982e-27
Kwal_26.87518482972962e-27
Scas_580.610152622972e-27
YJL128C (PBS2)6683132925e-27
Scas_707.369153262936e-27
CAGL0L05632g6773132909e-27
Kwal_14.115915211552921e-26
Scas_673.20*7582652892e-26
Kwal_56.237178582372873e-26
CAGL0I09504g5282852833e-26
AER223C9022232864e-26
CAGL0L06006g9422902831e-25
Scas_713.79832692831e-25
KLLA0E21780g10162462831e-25
Scas_707.315981662831e-25
KLLA0F09031g6331492782e-25
YGL158W (RCK1)5123062744e-25
Kwal_55.215458652452775e-25
KLLA0C04191g7972592766e-25
Scas_685.245152812736e-25
KLLA0C08525g15512732751e-24
KLLA0C17160g8312982731e-24
Scas_582.16383132712e-24
Scas_573.105693142692e-24
Kwal_27.97638682242722e-24
YGL180W (ATG1)8973102713e-24
Kwal_26.735514462822723e-24
Kwal_0.1555873022674e-24
YDR523C (SPS1)4902462646e-24
ACL054W9723062696e-24
KLLA0E15378g7242772669e-24
CAGL0M03729g8612042661e-23
KLLA0C00979g4832682602e-23
Scas_675.25272762612e-23
AFL217C6912772632e-23
Kwal_27.97734062852562e-23
CAGL0H01639g5212462593e-23
YAR019C (CDC15)9742822633e-23
Kwal_23.632515422802634e-23
AEL205W7932032614e-23
CAGL0C05005g10762412624e-23
CAGL0F00649g5143242584e-23
YHL007C (STE20)9392462614e-23
Kwal_33.140815802772585e-23
Scas_711.2515152662616e-23
AER264C14832522617e-23
CAGL0K02673g9152662599e-23
CAGL0K02167g11623362599e-23
KLLA0A07403g8792042581e-22
Scas_618.156203662542e-22
KLLA0F12188g5463102523e-22
KLLA0F23507g4872252504e-22
YJL095W (BCK1)14782902545e-22
Scas_668.228932422525e-22
CAGL0M10153g8672152525e-22
CAGL0L03520g14472872536e-22
KLLA0F01276g5192792487e-22
Scas_707.349053132517e-22
AFR092W14232812528e-22
Scas_598.67902752509e-22
CAGL0B03509g5972932471e-21
Kwal_23.52908192032491e-21
KLLA0D07304g4652072451e-21
KLLA0F14190g13382872491e-21
ADR379C4922992452e-21
CAGL0M11748g4473382432e-21
Kwal_47.1726311273312473e-21
KLLA0B13607g9892122464e-21
YBR274W (CHK1)5272222416e-21
Kwal_26.78619552052437e-21
ABR014W9712012437e-21
Kwal_55.220013633452331e-20
YCR073C (SSK22)13312622421e-20
ACR117W5242072381e-20
Kwal_56.238414323382361e-20
AER222C4233252333e-20
Kwal_26.87034442052333e-20
Scas_619.5*5102972353e-20
AAL029W5343082353e-20
CAGL0I04422g4222872323e-20
CAGL0D02244g4872552335e-20
AEL185C5152722335e-20
Scas_713.384323382315e-20
CAGL0J00539g4883142326e-20
KLLA0F20053g4443382299e-20
Scas_602.1111863972322e-19
KLLA0B13112g7302742312e-19
YGL179C (TOS3)5602502292e-19
ACL191C3652112242e-19
CAGL0J04290g3573132232e-19
KLLA0A02497g3622282232e-19
Kwal_14.24974181892252e-19
Kwal_33.132221481122093e-19
AGR048C4533382253e-19
Kwal_55.203267502292284e-19
Scas_623.113782512215e-19
Scas_688.144793172245e-19
YHR030C (SLT2)4843172246e-19
Scas_720.9416833602277e-19
AEL284C4792372237e-19
CAGL0J03828g4672012221e-18
Scas_710.283522262181e-18
Scas_683.63773072181e-18
YER129W (PAK1)11423632241e-18
Kwal_23.42765213082211e-18
KLLA0D09328g10463362241e-18
Kwal_23.55765042412212e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL028W
         (708 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...  1422   0.0  
Kwal_26.7635                                                          954   0.0  
Scas_721.124                                                          942   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   914   0.0  
Scas_717.69                                                           908   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   906   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   768   0.0  
Kwal_47.16761                                                         352   e-111
Scas_703.5                                                            352   e-110
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   353   e-110
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   350   e-110
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   351   e-110
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   346   e-108
KLLA0B07205g complement(624606..625973) some similarities with s...   278   5e-86
Scas_651.18                                                           271   2e-84
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   271   4e-84
CAGL0M08404g complement(836791..838179) some similarities with s...   273   7e-84
Kwal_33.13846                                                         268   5e-83
Scas_689.25*                                                          267   2e-82
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   265   4e-82
Kwal_56.24059                                                         263   2e-81
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   257   3e-79
Scas_690.13                                                           254   2e-78
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   255   3e-78
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   270   8e-78
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   253   2e-77
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   269   3e-77
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   268   5e-77
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   268   7e-77
Scas_715.34                                                           266   2e-76
Kwal_27.10581                                                         266   2e-76
Kwal_23.6458                                                          238   1e-67
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   234   5e-66
Scas_629.16                                                           233   2e-65
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   229   5e-65
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   229   1e-64
Kwal_56.22788                                                         218   5e-63
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   224   2e-62
Scas_720.103                                                          221   1e-61
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   216   1e-61
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   220   1e-61
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   209   2e-59
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   207   1e-58
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   205   7e-58
Scas_593.14d                                                          198   8e-56
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   179   3e-50
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   176   5e-49
Kwal_56.24091                                                         176   1e-48
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   172   2e-47
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   175   6e-47
Scas_705.23                                                           174   2e-46
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   174   2e-46
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   171   1e-45
Kwal_23.3992                                                          171   2e-45
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   165   2e-43
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   167   4e-43
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   167   6e-43
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   164   7e-43
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   165   7e-43
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   165   1e-42
Kwal_56.22693                                                         166   1e-42
Scas_660.20                                                           164   6e-42
Scas_716.33                                                           160   8e-42
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   162   2e-41
Scas_627.7                                                            153   4e-41
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   159   1e-40
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   157   1e-39
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   155   2e-39
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   157   2e-39
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   153   8e-39
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   154   9e-39
Kwal_33.14554                                                         153   1e-38
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   154   1e-38
Kwal_47.18307                                                         152   1e-38
Scas_654.12                                                           152   3e-38
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   152   9e-38
Scas_502.2                                                            150   3e-37
Kwal_26.7788                                                          148   9e-37
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   142   3e-36
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   143   4e-36
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   142   6e-36
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   145   7e-36
Scas_693.17                                                           145   7e-36
Scas_644.15                                                           144   1e-35
Kwal_26.8709                                                          144   2e-35
Scas_616.10                                                           144   3e-35
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   142   6e-35
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   139   2e-34
Kwal_0.96                                                             135   4e-34
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   135   4e-34
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   138   5e-34
Kwal_47.18233                                                         137   6e-34
Scas_660.28                                                           137   1e-33
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   137   2e-33
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   137   3e-33
Kwal_26.8796                                                          136   4e-33
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   135   5e-33
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   134   7e-33
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   134   7e-33
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   136   9e-33
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   134   2e-32
Scas_618.8                                                            130   2e-32
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   134   2e-32
Kwal_33.13112                                                         131   2e-32
Scas_564.7                                                            134   3e-32
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   134   3e-32
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   130   4e-32
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   130   4e-32
Kwal_56.22476                                                         132   5e-32
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   133   5e-32
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   133   5e-32
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   133   6e-32
Scas_700.34                                                           132   9e-32
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   129   1e-31
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   132   1e-31
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   131   2e-31
Scas_700.54                                                           130   3e-31
Scas_613.5                                                            128   4e-31
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   130   5e-31
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   126   7e-31
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   125   1e-30
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   129   1e-30
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   129   2e-30
Scas_640.14*                                                          127   3e-30
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   127   4e-30
Kwal_23.3590                                                          124   7e-30
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   126   8e-30
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   126   8e-30
Scas_493.2                                                            126   9e-30
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   125   2e-29
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   125   2e-29
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   125   2e-29
Scas_700.28                                                           123   6e-29
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   123   1e-28
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   123   2e-28
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   121   3e-28
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   120   5e-28
Scas_201.1*                                                           114   5e-28
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   118   5e-28
Kwal_47.17252                                                         120   9e-28
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   120   1e-27
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   120   1e-27
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   119   1e-27
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   119   2e-27
Kwal_26.8751                                                          118   2e-27
Scas_580.6                                                            119   2e-27
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...   117   5e-27
Scas_707.36                                                           117   6e-27
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   116   9e-27
Kwal_14.1159                                                          117   1e-26
Scas_673.20*                                                          115   2e-26
Kwal_56.23717                                                         115   3e-26
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   113   3e-26
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   114   4e-26
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   113   1e-25
Scas_713.7                                                            113   1e-25
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   113   1e-25
Scas_707.3                                                            113   1e-25
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   111   2e-25
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   110   4e-25
Kwal_55.21545                                                         111   5e-25
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   110   6e-25
Scas_685.24                                                           109   6e-25
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   110   1e-24
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   109   1e-24
Scas_582.1                                                            108   2e-24
Scas_573.10                                                           108   2e-24
Kwal_27.9763                                                          109   2e-24
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   108   3e-24
Kwal_26.7355                                                          109   3e-24
Kwal_0.155                                                            107   4e-24
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   106   6e-24
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   108   6e-24
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...   107   9e-24
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...   107   1e-23
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   104   2e-23
Scas_675.2                                                            105   2e-23
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...   105   2e-23
Kwal_27.9773                                                          103   2e-23
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...   104   3e-23
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   105   3e-23
Kwal_23.6325                                                          105   4e-23
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...   105   4e-23
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   105   4e-23
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   103   4e-23
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...   105   4e-23
Kwal_33.14081                                                         103   5e-23
Scas_711.25                                                           105   6e-23
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   105   7e-23
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   104   9e-23
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   104   9e-23
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...   103   1e-22
Scas_618.15                                                           102   2e-22
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...   101   3e-22
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...   100   4e-22
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...   102   5e-22
Scas_668.22                                                           101   5e-22
CAGL0M10153g complement(1010688..1013291) some similarities with...   101   5e-22
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...   102   6e-22
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...   100   7e-22
Scas_707.34                                                           101   7e-22
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...   101   8e-22
Scas_598.6                                                            100   9e-22
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...   100   1e-21
Kwal_23.5290                                                          100   1e-21
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    99   1e-21
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...   100   1e-21
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    99   2e-21
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    98   2e-21
Kwal_47.17263                                                         100   3e-21
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    99   4e-21
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    97   6e-21
Kwal_26.7861                                                           98   7e-21
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    98   7e-21
Kwal_55.22001                                                          94   1e-20
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    98   1e-20
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    96   1e-20
Kwal_56.23841                                                          96   1e-20
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    94   3e-20
Kwal_26.8703                                                           94   3e-20
Scas_619.5*                                                            95   3e-20
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    95   3e-20
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    94   3e-20
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    94   5e-20
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    94   5e-20
Scas_713.38                                                            94   5e-20
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    94   6e-20
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    93   9e-20
Scas_602.11                                                            94   2e-19
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    94   2e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    93   2e-19
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    91   2e-19
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    91   2e-19
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    91   2e-19
Kwal_14.2497                                                           91   2e-19
Kwal_33.13222                                                          85   3e-19
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    91   3e-19
Kwal_55.20326                                                          92   4e-19
Scas_623.11                                                            90   5e-19
Scas_688.14                                                            91   5e-19
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    91   6e-19
Scas_720.94                                                            92   7e-19
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    91   7e-19
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    90   1e-18
Scas_710.28                                                            89   1e-18
Scas_683.6                                                             89   1e-18
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    91   1e-18
Kwal_23.4276                                                           90   1e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    91   1e-18
Kwal_23.5576                                                           90   2e-18
Scas_713.21                                                            90   2e-18
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    91   2e-18
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    90   3e-18
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    88   3e-18
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    87   3e-18
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    90   4e-18
KLLA0E11979g complement(1060048..1061892) some similarities with...    89   4e-18
Scas_680.20                                                            88   4e-18
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    89   4e-18
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    88   4e-18
Kwal_0.307                                                             87   7e-18
Scas_633.29                                                            88   7e-18
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    88   8e-18
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    88   8e-18
Scas_640.16                                                            87   8e-18
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    87   9e-18
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    86   2e-17
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    85   3e-17
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    85   3e-17
Scas_634.5                                                             86   4e-17
Scas_628.9                                                             86   4e-17
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    85   6e-17
Kwal_33.14167                                                          86   6e-17
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    85   6e-17
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    85   6e-17
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    83   7e-17
Kwal_27.12559                                                          84   7e-17
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    84   7e-17
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    83   7e-17
Scas_643.20                                                            85   8e-17
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    82   9e-17
Scas_721.110                                                           84   9e-17
Scas_544.6                                                             84   9e-17
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    83   1e-16
Scas_477.5                                                             85   1e-16
Kwal_14.1416                                                           83   1e-16
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    83   1e-16
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    82   1e-16
Scas_700.35                                                            83   2e-16
Scas_651.3                                                             84   2e-16
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    82   2e-16
Kwal_26.8347                                                           83   2e-16
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    83   3e-16
Scas_716.73                                                            82   3e-16
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    83   3e-16
Scas_721.132                                                           83   3e-16
Kwal_26.7552                                                           82   3e-16
Scas_548.6                                                             83   5e-16
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    82   6e-16
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    80   7e-16
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    79   7e-16
Scas_568.9*                                                            79   7e-16
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    82   7e-16
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    82   9e-16
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    82   1e-15
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    81   1e-15
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    81   1e-15
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    80   2e-15
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    79   2e-15
Kwal_23.5668                                                           81   2e-15
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    77   2e-15
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    78   3e-15
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    79   3e-15
Scas_667.18                                                            79   3e-15
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    80   3e-15
Scas_635.1                                                             78   4e-15
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    79   4e-15
Kwal_17.2687                                                           78   4e-15
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    80   5e-15
Kwal_26.7154                                                           79   7e-15
Kwal_33.13984                                                          79   7e-15
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    77   1e-14
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    77   1e-14
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    77   1e-14
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    75   2e-14
Kwal_56.24584                                                          77   2e-14
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    77   2e-14
Scas_336.1                                                             77   2e-14
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    77   2e-14
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    75   2e-14
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    77   2e-14
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    76   3e-14
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    76   3e-14
Scas_678.13                                                            76   3e-14
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    77   4e-14
Kwal_47.17868                                                          75   4e-14
Kwal_14.1273                                                           75   4e-14
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    76   4e-14
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    74   5e-14
Scas_721.46                                                            74   5e-14
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    75   6e-14
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    75   6e-14
Kwal_33.13831                                                          75   6e-14
Kwal_27.11803                                                          72   7e-14
Scas_613.13*                                                           73   9e-14
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    74   1e-13
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    75   2e-13
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    72   2e-13
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    73   2e-13
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    72   2e-13
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    74   2e-13
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    74   3e-13
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    73   3e-13
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    72   4e-13
Kwal_26.7682                                                           73   4e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    74   4e-13
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    73   5e-13
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    70   5e-13
Scas_678.24                                                            73   6e-13
KLLA0C16577g complement(1451181..1452695) some similarities with...    71   1e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    72   1e-12
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    70   2e-12
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    69   2e-12
Kwal_33.13681                                                          71   2e-12
Kwal_27.11919                                                          67   2e-12
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    69   3e-12
Scas_684.28                                                            70   3e-12
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    70   4e-12
Scas_649.30                                                            69   5e-12
Kwal_27.10004                                                          69   6e-12
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    66   3e-11
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    67   3e-11
Kwal_23.3471                                                           64   4e-11
KLLA0C03938g complement(358851..360632) some similarities with s...    66   7e-11
KLLA0A06820g complement(615686..618004) some similarities with s...    65   1e-10
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    65   1e-10
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    65   1e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    64   1e-10
Scas_651.19                                                            65   1e-10
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    65   1e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    65   2e-10
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    65   2e-10
Scas_683.12                                                            63   2e-10
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    64   2e-10
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    64   2e-10
Scas_648.17                                                            63   3e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    62   4e-10
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    63   4e-10
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    63   5e-10
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    62   6e-10
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    62   6e-10
Scas_689.24                                                            63   7e-10
Kwal_33.14434                                                          63   7e-10
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    62   7e-10
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    62   8e-10
Kwal_26.7276                                                           62   9e-10
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    62   1e-09
Kwal_27.11830                                                          62   1e-09
Scas_718.90                                                            62   1e-09
Scas_704.50                                                            60   2e-09
Kwal_47.18098                                                          60   2e-09
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    60   2e-09
Scas_677.18                                                            61   2e-09
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    61   2e-09
Scas_653.25                                                            61   2e-09
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    61   2e-09
Kwal_27.11777                                                          60   3e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    60   3e-09
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    60   3e-09
Scas_711.15                                                            60   3e-09
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    60   3e-09
Scas_671.16                                                            60   3e-09
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    60   4e-09
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    60   5e-09
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    59   5e-09
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    60   5e-09
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    60   5e-09
Scas_568.13                                                            59   7e-09
Scas_22.1                                                              57   7e-09
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    58   8e-09
KLLA0F22297g complement(2083448..2085547) some similarities with...    59   1e-08
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    58   1e-08
CAGL0K11990g complement(1155395..1158370) some similarities with...    59   1e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    59   1e-08
Scas_654.17                                                            58   1e-08
Scas_673.34*                                                           59   1e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    58   1e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    59   2e-08
Scas_698.37                                                            57   2e-08
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    58   2e-08
Kwal_55.21709                                                          57   2e-08
Kwal_33.14192                                                          57   2e-08
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    57   3e-08
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    56   3e-08
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    57   5e-08
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    56   6e-08
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    56   6e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    57   6e-08
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    56   6e-08
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    56   6e-08
KLLA0B06501g complement(576636..579089) some similarities with s...    56   7e-08
Scas_697.12                                                            56   8e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    56   9e-08
Scas_610.7                                                             56   9e-08
Kwal_27.11542                                                          56   9e-08
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    55   1e-07
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    55   1e-07
Scas_655.2                                                             55   1e-07
Kwal_55.20189                                                          55   1e-07
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    55   2e-07
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    55   2e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    55   2e-07
Scas_695.33                                                            55   2e-07
CAGL0K01661g complement(146952..148400) some similarities with t...    54   2e-07
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    54   2e-07
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    53   2e-07
Scas_601.6                                                             54   2e-07
Kwal_55.20221                                                          55   3e-07
Kwal_33.14596                                                          54   3e-07
Scas_584.11                                                            54   3e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    54   3e-07
Scas_689.22                                                            54   3e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    54   3e-07
Scas_707.7                                                             53   4e-07
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    54   4e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    54   4e-07
Kwal_27.10945                                                          54   4e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    54   4e-07
CAGL0M08360g complement(833220..835520) some similarities with s...    54   5e-07
Kwal_26.8941                                                           53   6e-07
Scas_661.27                                                            54   6e-07
Kwal_14.1249                                                           52   6e-07
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    52   8e-07
Kwal_47.17345                                                          53   8e-07
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    53   9e-07
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    52   9e-07
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    52   1e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    52   1e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    52   1e-06
Scas_584.8                                                             52   1e-06
Kwal_55.21900                                                          52   2e-06
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    51   3e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    50   4e-06
Scas_703.47                                                            50   4e-06
KLLA0D12100g complement(1031728..1033161) some similarities with...    50   5e-06
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    50   6e-06
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    49   6e-06
AGR315C [4626] [Homologous to ScYGR188C (BUB1) - SH; ScYJL013C (...    50   8e-06
Scas_692.24                                                            49   8e-06
Scas_458.1                                                             49   1e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    49   1e-05
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    49   1e-05
Kwal_33.15381                                                          49   1e-05
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    49   2e-05
Kwal_14.2554                                                           48   2e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    48   2e-05
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    48   2e-05
Scas_721.61                                                            47   4e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    47   5e-05
CAGL0I08899g complement(863636..866431) similar to sp|P41695 Sac...    45   2e-04

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 1422 bits (3681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/708 (97%), Positives = 691/708 (97%)

Query: 1   MTMYGWKLTNKLKFGXXXXXXXXXXXXXXXXXHNSGSKHGVFGHLSKRLSSTEEQVRCRT 60
           MTMYGWKLTNKLKFG                 HNSGSKHGVFGHLSKRLSSTEEQVRCRT
Sbjct: 1   MTMYGWKLTNKLKFGRSKEEKDKDREKERDSRHNSGSKHGVFGHLSKRLSSTEEQVRCRT 60

Query: 61  EEANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSE 120
           EEANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSE
Sbjct: 61  EEANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSE 120

Query: 121 TTDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFA 180
           TTDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFA
Sbjct: 121 TTDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFA 180

Query: 181 LTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSEDEDKLLPGDAATNYIPATI 240
           LTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSEDEDKLLPGDAATNYIPATI
Sbjct: 181 LTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSEDEDKLLPGDAATNYIPATI 240

Query: 241 KLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRI 300
           KLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRI
Sbjct: 241 KLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRI 300

Query: 301 PSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQW 360
           PSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQW
Sbjct: 301 PSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQW 360

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI
Sbjct: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480
           RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK
Sbjct: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480

Query: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540
           EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD
Sbjct: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540

Query: 541 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600
           QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL
Sbjct: 541 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600

Query: 601 QEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP 660
           QEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP
Sbjct: 601 QEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP 660

Query: 661 YKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708
           YKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS
Sbjct: 661 YKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708

>Kwal_26.7635
          Length = 691

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/708 (67%), Positives = 564/708 (79%), Gaps = 33/708 (4%)

Query: 3   MYGWKLTNKLKFGXXXXXXXXXXXXXXXXXHNSGSKHGVFGHLSKRLSSTEEQVRCRTEE 62
           MY WK+ +K +FG                      KHG+F H S +  S+  +       
Sbjct: 1   MYSWKIASKFRFGRSKEEKEKEKEKDKTK---EKEKHGLFHHKSHKSDSSYME------- 50

Query: 63  ANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSETT 122
                  PR S DRKETIVA+++SIAPVRLS++V    +P     SSV S+ RD+ S T+
Sbjct: 51  ------PPRESVDRKETIVASSSSIAPVRLSSEVNK--FP--ATDSSV-STVRDSVS-TS 98

Query: 123 DVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFALT 182
              D    G  S SV+ E  + ++++  E        N +GIMTIKVY G   +LPF +T
Sbjct: 99  GEYDGMYDGNGSSSVMDEAFDSNNSTTDEP-------NFSGIMTIKVYGGEVLRLPFPIT 151

Query: 183 SNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSE--DEDKLLPGDAATNYIPATI 240
           SN QIL KLL SGV     T  +S DEL+SS+ Q+ LS+  DE+ L+ G+ AT YIPATI
Sbjct: 152 SNVQILKKLLHSGV-INQDTDEASADELVSSLSQLHLSDGGDEENLIDGNTATRYIPATI 210

Query: 241 KLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRI 300
            LP+S DLNPL+Y T+EFDNTVATIEPE G + +  FNKISTFDVTRKL +LK++VF RI
Sbjct: 211 TLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARI 270

Query: 301 PSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQW 360
           PSILLPSK+WQQ+ ++ DP L+D+L ++N N D+ +DS+ LPL L F++A+S RLYNHQW
Sbjct: 271 PSILLPSKSWQQLNSS-DPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQW 329

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           + + +G G++N+++DYKP+ N+ LS+DDF+LLKVIGKGSFGKVMQV+KKDTNK+YALKAI
Sbjct: 330 IGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI 389

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480
           RKSYIVSKSEV HTLAERTVLARV+NPFIVPLKF+FQSP+KLY+VLAFINGGELF+HLQ+
Sbjct: 390 RKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR 449

Query: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540
           EGRF LSRAR YTAELLCALETLH+L+VIYRDLKPENILLD+QGHIALCDFGLCKLNMK 
Sbjct: 450 EGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKG 509

Query: 541 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600
           QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM+TGLPPYYDEDVPKMYKKIL
Sbjct: 510 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL 569

Query: 601 QEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP 660
           QEPLRFPDGFD++AK+LLI LL RDPKRRLG+NGADEIK HPFFSQLSWKRLWMKGYIPP
Sbjct: 570 QEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPP 629

Query: 661 YKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708
           YKPPVM++LDTSNFDQEFT+E PVDSVVNDFLSESVQQQFGGWTYVGS
Sbjct: 630 YKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGS 677

>Scas_721.124
          Length = 684

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/639 (73%), Positives = 537/639 (84%), Gaps = 20/639 (3%)

Query: 73  SKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSETTDVGDEERAGT 132
           S DRKETI+ + N++AP+R S              SS  S+F D GS T+   DE     
Sbjct: 49  SSDRKETIINSPNTMAPMRSSY-----------EASSSTSTF-DNGSHTS--SDENSNNI 94

Query: 133 SSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFALTSNPQILGKLL 192
           S  S V  Q +  +AS ++   + + ++S+GIMTIK+YNG++F LPF +TSN QIL KLL
Sbjct: 95  SHESSV-SQISQDTAS-NDPHPQNTHISSSGIMTIKIYNGDAFTLPFPITSNQQILSKLL 152

Query: 193 SSGVNAISRTGRSSVDELISSVEQVTLSED---EDKLLPGDAATNYIPATIKLPDSEDLN 249
            SG++  S T    VD L+S + +V L      E+ LL  D ++ +IPATIKLP S  LN
Sbjct: 153 GSGISPPS-TATPDVDTLVSQLSRVQLQNQGPAEENLLASDVSSKFIPATIKLPGSSVLN 211

Query: 250 PLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRIPSILLPSKA 309
           PL+Y TIEFDNTVATIEPE G +  PVFNKISTFDVTRKLP+LK++VF RIPSILLPSK 
Sbjct: 212 PLLYFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLPFLKIDVFARIPSILLPSKM 271

Query: 310 WQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQWLNMEKGLGR 369
           WQQ  +A D +L+++L+K+NSN DV LDSFQLP+NL+F++A++IRLYNH W+++E GLGR
Sbjct: 272 WQQEMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTASNIRLYNHHWVSLENGLGR 331

Query: 370 VNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS 429
           +NI+IDYKPS+NKPLSIDDFDLLKVIGKGSFGKVMQV+KKDT KIYALKAIRK+YIVSKS
Sbjct: 332 INISIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKS 391

Query: 430 EVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA 489
           EVTHTLAERTVLAR+D PFIVPLKFSFQSP+KLYLVLA INGGELF+HLQKEGRFDLSR+
Sbjct: 392 EVTHTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRS 451

Query: 490 RFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCG 549
           RFY AELLCALETLH+LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD DKT+TFCG
Sbjct: 452 RFYAAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCG 511

Query: 550 TPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG 609
           TPEYLAPELLLGQGY+KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ+PLRFPDG
Sbjct: 512 TPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDG 571

Query: 610 FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL 669
           FDR+AK+LLI LL RDP RRLG NGADEIK HPFFSQLSWKRL MKGYIPPYKPPV SA+
Sbjct: 572 FDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAI 631

Query: 670 DTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708
           DTSNFDQEFTREKPVDSVV++FLSESVQ+QFGGWTYVGS
Sbjct: 632 DTSNFDQEFTREKPVDSVVDEFLSESVQKQFGGWTYVGS 670

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/733 (61%), Positives = 543/733 (74%), Gaps = 59/733 (8%)

Query: 3   MYGWKLTNKLKFGXXXXXXXXXXXXXXXXXHNSGSKHGVFGHLSKRLSSTEEQVRCRTEE 62
           MY WKL++K +FG                                R    +E+     +E
Sbjct: 1   MYSWKLSSKFRFG--------------------------------RSKDKDEKHHKHMDE 28

Query: 63  ANTGAGTPRTSKDRKETIVATANSIAPVR-LSTDVAAPGWPNEGVQSSVPSSFRDAGSET 121
            +      R+S DRK TIV  + ++   R  +            V SS        GS +
Sbjct: 29  VDIDGNDNRSSVDRKATIVPGSATVVQSRASTDTRTTSDDTGHSVHSSGFKGTITEGSMS 88

Query: 122 TDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMV---------------------- 159
           TD+  E+ + T+       +    S + S    +                          
Sbjct: 89  TDISGEDISMTNGRDRDSTEVQSKSNNNSSNFKQQQQQLLAQQQQIQYQQQQSQQQPVEN 148

Query: 160 ----NSTGIMTIKVYNGNSFKLPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVE 215
               +S GI+T+KVY+G+SFKLP  +T N Q+L KLLSSGV+  S T + S++ELI S+ 
Sbjct: 149 ENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSMH 208

Query: 216 QVTLSEDEDKLLPGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSP 275
            ++L  +EDKLL G+ A+++IPA++ LP S++LN L+Y TIEFDNT+ATIEPE G L  P
Sbjct: 209 GLSLLREEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRP 268

Query: 276 VFNKISTFDVTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQ 335
           +FNKISTFDVTR+LP+LK++VF RIPSILLPS+ WQ+   + +  L D +KK+ +N D+ 
Sbjct: 269 IFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIH 328

Query: 336 LDSFQLPLNLQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVI 395
           LDSF LPLNL+ +SA++IRLYNH W+ +E  +G++N+++DYKPS +K LSIDDFDLLKVI
Sbjct: 329 LDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVI 388

Query: 396 GKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS 455
           GKGSFGKVMQV+K+DTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS
Sbjct: 389 GKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS 448

Query: 456 FQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKP 515
           FQS EKLYLVLAFINGGELF+HLQ+EGRFDLSR+RFYTAELLCALE LH  ++IYRDLKP
Sbjct: 449 FQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKP 508

Query: 516 ENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGV 575
           ENILLDYQGHIALCDFGLCKLNMKDQ+KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGV
Sbjct: 509 ENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGV 568

Query: 576 LLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGA 635
           LLYEMLTGLPPYYDEDVPKMYKKILQ+PLRFPD FD++AK+LLI LLCRDPKRRLGY+G+
Sbjct: 569 LLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGS 628

Query: 636 DEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSES 695
           DEIK HPFF+QLSWKRL MKGYIPPYKPPVM A+DTSNFDQEFTRE+PVDSVVNDFLSES
Sbjct: 629 DEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSES 688

Query: 696 VQQQFGGWTYVGS 708
           VQQQFGGWTYVGS
Sbjct: 689 VQQQFGGWTYVGS 701

>Scas_717.69
          Length = 674

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/641 (70%), Positives = 517/641 (80%), Gaps = 28/641 (4%)

Query: 72  TSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSETTDVGDEERAG 131
           T  DRK+TIV + +S+APVRLS+             +S  S+F + G +    G +  + 
Sbjct: 48  TFSDRKKTIVRSPSSVAPVRLSS-----------EAASSSSTFLN-GDDDVSTGRDVHSR 95

Query: 132 TSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFALTSNPQILGKL 191
           T S +   E +N              +  + GIMTIKVYNG  F LP ++TSN  IL +L
Sbjct: 96  TMSTTSATEMSN------------KDIDGTAGIMTIKVYNGEGFILPVSITSNETILSRL 143

Query: 192 LSSGVNAISRTGRSSVDELISSVEQVTLSE----DEDKLLPGDAATNYIPATIKLPDSED 247
           LSSG+N+      + VD LIS + ++ L       E+KL+ G+  T YIPAT+KLP S  
Sbjct: 144 LSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGSNR 203

Query: 248 LNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRIPSILLPS 307
           LNPL+Y TIEFDNTVATIEPE G +  PVFNKISTFDVTRKLPYLK++VF RIPSILLPS
Sbjct: 204 LNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPS 263

Query: 308 KAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQWLNMEKGL 367
           K WQQ  +  D  ++ +L K+NSN DV LDS Q+P+NL+F+SA +IRLYNH W+ +E  L
Sbjct: 264 KLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTL 323

Query: 368 GRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVS 427
           GR+NI++DYKPSKNK L+IDDFDLLKVIGKGSFGKVMQV+K+DT KIYALKAIRKSYIVS
Sbjct: 324 GRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVS 383

Query: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487
           KSEVTHTLAERTVLARV+ PFIVPLKFSFQSPEKLYLVLA INGGELF+HLQKEGRF+LS
Sbjct: 384 KSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELS 443

Query: 488 RARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTF 547
           RARFYTAELLCALETLH+L+VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT+TF
Sbjct: 444 RARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTF 503

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP 607
           CGTPEYLAPELLL QGYSKVVDWWTLG+LLYEMLTGLPPYYDEDVPKMY+KILQ+PLRFP
Sbjct: 504 CGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFP 563

Query: 608 DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMS 667
           +GFDR+AK+LLI LL RDP RRLG NGA EIK HPFFSQLSWKRLW KGYIPPYKPPV  
Sbjct: 564 EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSD 623

Query: 668 ALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708
           A DT NFDQEFT+EKP+DSVV+++LSESVQ+QFGGWTYVGS
Sbjct: 624 AADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGS 664

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/594 (73%), Positives = 503/594 (84%), Gaps = 7/594 (1%)

Query: 118 GSETTDVGDEERAGTSS-GSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFK 176
           GS ++ + D    G +   S   +Q +  SA+ +++    +   STG+MTIKVYNG+ F+
Sbjct: 100 GSSSSTIKDVPLGGENERSSSHIDQVSQKSATSTKK----TSTPSTGVMTIKVYNGDGFR 155

Query: 177 LPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTL--SEDEDKLLPGDAATN 234
           LPF +TSN +IL +LL SG+ + +      V+ ++  + ++ L  S   + LLPGD AT 
Sbjct: 156 LPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRLELTNSNSNENLLPGDIATQ 215

Query: 235 YIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKV 294
            IP+TIKLP+S  LNPL+Y TIEFDNTVATIEPE G +  P+FNKISTFDVTRKLP L +
Sbjct: 216 SIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNI 275

Query: 295 NVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIR 354
           +VFVRIPSILLP K WQQ   AQD +LQ LL K+N+N DV LDSFQLP+NL  +SA +IR
Sbjct: 276 DVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIR 335

Query: 355 LYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKI 414
           LYNH W+ +  GLG++NI++DYKPS+NKPLSIDDFDLLKVIGKGSFGKVMQV+KKDT KI
Sbjct: 336 LYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKI 395

Query: 415 YALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGEL 474
           YALKAIRKSYIVSKSEVTHTLAERTVLAR+D PFIVPLKFSFQS EKLYLVLA INGGEL
Sbjct: 396 YALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGEL 455

Query: 475 FFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC 534
           F+HLQ+EGRFDLSR+RFY AELLCAL+TLH ++VIYRDLKPENILLDYQGHIALCDFGLC
Sbjct: 456 FYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLC 515

Query: 535 KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPK 594
           KLNMKD+DKT+TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE+VPK
Sbjct: 516 KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPK 575

Query: 595 MYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWM 654
           MYKKILQ+PL FPDGFDR+AK+LLI LL RDP+RRLGYNGADEIK HPFFSQLSWKRL M
Sbjct: 576 MYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLM 635

Query: 655 KGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGS 708
           KGYIPPYKPPV SA DTSNFDQEFTREKP+DSVV+++LSESVQ+QFGGWTYVGS
Sbjct: 636 KGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGS 689

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/664 (57%), Positives = 503/664 (75%), Gaps = 21/664 (3%)

Query: 63  ANTGAGTP---RTSKDRKETIVATANSIAPVRLSTDVAAPGW--PNEGVQS-SVPSSFRD 116
           A+T AG     R S +R++T+ A   SIAPVR+S D     +   NE +    +PS  R 
Sbjct: 36  ADTAAGDSIFSRPSVERRDTVTAANGSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRS 95

Query: 117 AGSETTDVGDEERAGT-------SSGSVVPEQANHSS-ASVSEERGEASMVNSTGIMTIK 168
                +       + +       SS + V E  N ++  S   +R + +M   +G++T+K
Sbjct: 96  HKDSFSPFNSSSNSSSNLGSNRDSSMTDVTELLNDTAFKSTPFDRIDENM--HSGLLTVK 153

Query: 169 VYNGNSFKLPFALTSNPQILGKLLSSGVNAIS--RTGRSSVDELISSVEQVTLSED--ED 224
           VY+G++F +P  +TS+  IL  LL+S ++++       + +++LI+ + QV L+    E+
Sbjct: 154 VYSGSNFTMPVPITSDQGILHNLLNSSISSLEGDNNTYAEMEQLITQLSQVHLANQTSEE 213

Query: 225 KLLPGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFD 284
           +L+    ++ +IPA IK+P  +D  PLIY+T+E+DNT+ATI PE G +  PVFNKISTFD
Sbjct: 214 QLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFD 272

Query: 285 VTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLN 344
           VTRKLP+LK +VF++IPS LLPS  WQQ  A  DP ++ +L+ +++  ++ LDSF LP+ 
Sbjct: 273 VTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVV 332

Query: 345 LQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVM 404
           L  NSA++ RL+NHQW+N+++GLG +N+T+D+KPS +KP+ IDDF+LL V+GKGS+GKVM
Sbjct: 333 LDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVM 392

Query: 405 QVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYL 464
           QV+KKDT KIYALKAIRKSYIV+KSEV HTLAERT+LARV+ PFIVPLKF+FQ+PEKLYL
Sbjct: 393 QVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYL 452

Query: 465 VLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQG 524
           VLA INGGELF HLQ+EG FD+SRARFY +ELL AL++LH ++V+YRDLKPENILLD QG
Sbjct: 453 VLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQG 512

Query: 525 HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGL 584
           HIALCDFGLCKLNMKD +KT+TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLLYEMLTGL
Sbjct: 513 HIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGL 572

Query: 585 PPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           PPYYDE+V +MYKKIL+ PL FPDG D +AK+LL  LL RDP RRLG NGADEIK H FF
Sbjct: 573 PPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFF 632

Query: 645 SQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWT 704
           + L W  +W K Y+PP++P V +A DTSNFD EFT++KPVDSV++++LSESVQ QF GW+
Sbjct: 633 NDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWS 692

Query: 705 YVGS 708
           Y+GS
Sbjct: 693 YLGS 696

>Kwal_47.16761
          Length = 744

 Score =  352 bits (904), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 249/367 (67%), Gaps = 19/367 (5%)

Query: 357 NH-QWLNMEKGL------GRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKK 409
           NH QW  ++  +      G +++  D+K +  +     DF++L+++GKG+FG+V QV+KK
Sbjct: 295 NHEQWYKLQSRIVGESVTGHISVKWDFKATMKQHYGPQDFEVLRLLGKGTFGQVYQVRKK 354

Query: 410 DTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN---PFIVPLKFSFQSPEKLYLVL 466
           DT +IYA+K + K  IV K+E+ HT+ ER +L R  +   PFIV LKFSFQ+P  LYLV 
Sbjct: 355 DTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPADLYLVT 414

Query: 467 AFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHI 526
            F++GGELF+HLQKEGRF   RARFY AEL+ ALE LH  +++YRDLKPENILLD  G+I
Sbjct: 415 DFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILLDANGNI 474

Query: 527 ALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLP 585
           ALCDFGL K ++K  D+TNTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  
Sbjct: 475 ALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWS 532

Query: 586 PYYDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIELLCRDPKRRLG-YNGADEIKRHPF 643
           P++ ED  KMY+KI    ++FP D    E ++ +  LL R+P+ RLG  +   E++ HPF
Sbjct: 533 PFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHRLGAIDDGRELRAHPF 592

Query: 644 FSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPV----DSVVNDFLSESVQQQ 699
           F+++ W+ L  K   PP+KP +    DTSNFD EFT+          +    LS ++Q +
Sbjct: 593 FAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFTQTSTSFMNKQGIAATPLSPAMQAK 652

Query: 700 FGGWTYV 706
           F G+T+V
Sbjct: 653 FVGFTFV 659

>Scas_703.5
          Length = 749

 Score =  352 bits (903), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/357 (50%), Positives = 246/357 (68%), Gaps = 19/357 (5%)

Query: 364 EKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKS 423
           E   G + I  +Y  +K +    +DF++L+++GKG+FG+V QVKKKDT +IYA+K + K 
Sbjct: 319 ENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKK 378

Query: 424 YIVSKSEVTHTLAERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480
            IV K+EV HT+ ER +L   A   +PFIV LKFSFQ+P  LYLV  F++GGELF+HLQK
Sbjct: 379 VIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQK 438

Query: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540
           EGRF   RA+FY AEL+ ALE LH  +++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 439 EGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 497

Query: 541 QDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
            D+TNTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P++ ED  KMY+KI
Sbjct: 498 -DRTNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKI 556

Query: 600 LQEPLRFP-DGFDREAKNLLIELLCRDPKRRLG-YNGADEIKRHPFFSQLSWKRLWMKGY 657
               ++FP D    E ++ +  LL R+PK RLG  +   E++ HPFF+ + W  L  K  
Sbjct: 557 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKI 616

Query: 658 IPPYKPPVMSALDTSNFDQEFT--------REKPVDSVVNDFLSESVQQQFGGWTYV 706
            PP+KP ++S  DTSNFD EFT        + +P+ +     LS ++Q +F G+T+V
Sbjct: 617 PPPFKPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAKFAGFTFV 670

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  353 bits (907), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 253/369 (68%), Gaps = 24/369 (6%)

Query: 358 HQWLNMEKGL------GRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDT 411
           HQW +++  +      G + I   YK +K +     DF++L+++GKG+FG+V QVKKKDT
Sbjct: 375 HQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDT 434

Query: 412 NKIYALKAIRKSYIVSKSEVTHTLAERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAF 468
            +IYA+K + K  IV K+E+ HT+ ER +L   A   +PFIV LKFSFQ+P  LYLV  +
Sbjct: 435 QRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDY 494

Query: 469 INGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIAL 528
           ++GGELF+HLQKEGRF   RA+FY AEL+ ALE LH  +++YRDLKPENILLD  G+IAL
Sbjct: 495 MSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIAL 554

Query: 529 CDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPY 587
           CDFGL K ++K  D+TNTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P+
Sbjct: 555 CDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPF 612

Query: 588 YDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIELLCRDPKRRLG-YNGADEIKRHPFFS 645
           + E+  KMY+KI    ++FP D   +E ++ +  LL R+PK RLG  +   E++ HPFF+
Sbjct: 613 FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA 672

Query: 646 QLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFT--------REKPVDSVVNDFLSESVQ 697
            + W+ L  K   PP+KP ++S  DTSNFD EFT        + +P+ +     LS ++Q
Sbjct: 673 DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATP--LSPAMQ 730

Query: 698 QQFGGWTYV 706
            +F G+T+V
Sbjct: 731 AKFAGFTFV 739

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  350 bits (899), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 259/389 (66%), Gaps = 25/389 (6%)

Query: 337 DSFQLPLNLQFNSATSIRLYNHQWLNM------EKGLGRVNITIDYKPSKNKPLSIDDFD 390
           D F   + L+ N+ T   ++N QW  +      E   G + +  +Y  ++ +     DF+
Sbjct: 247 DVFLGQVRLRPNTHTKHDVHN-QWSKLNGRTVGESVSGEILVRWEYWHTEKRHYGPQDFE 305

Query: 391 LLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN---P 447
           +L+++GKG+FG+V QV+KKDT +IYA+K + K  IV K+E+ HT+ ER +L R  +   P
Sbjct: 306 VLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCP 365

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           FIV LKFSFQ+P  LYLV  F++GGELF+HLQKEGRF   RA+FY AEL+ ALE LH  +
Sbjct: 366 FIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDND 425

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ-GYSK 566
           ++YRDLKPENILLD  G+IALCDFGL K ++K  D+TNTFCGT EYLAPELLL + GY+K
Sbjct: 426 IVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTK 483

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIELLCRD 625
           +VD+W+LGVL++EM  G  P++ ED  KMY+KI    ++FP D    E ++ +  LL R+
Sbjct: 484 MVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRN 543

Query: 626 PKRRLG-YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTR---- 680
           PK RLG  N   E++ HPF S + W+ L  K   PP+KP + S  DTSNFD EFT+    
Sbjct: 544 PKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFDPEFTQTSTS 603

Query: 681 ---EKPVDSVVNDFLSESVQQQFGGWTYV 706
              ++P+ +     LS ++Q +F G+T+V
Sbjct: 604 FMNKQPIAATP---LSPAMQAKFAGFTFV 629

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  351 bits (900), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 256/389 (65%), Gaps = 23/389 (5%)

Query: 337 DSFQLPLNLQFNSATSIRLYNHQWLNM------EKGLGRVNITIDYKPSKNKPLSIDDFD 390
           D F   + L+ N  T+  + + QW  +      EK  G + +   Y  +K +     DF+
Sbjct: 282 DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQDFE 341

Query: 391 LLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN---P 447
           +L+++GKG+FG+V QVKKKDT +IYA+K + K  IV K+E+ HT+ ER +L    +   P
Sbjct: 342 VLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASP 401

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           FIV LKFSFQ+P  LYLV  +++GGELF+HLQ+EGRF   RA+FY AEL+ ALE LH  +
Sbjct: 402 FIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHDND 461

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ-GYSK 566
           ++YRDLKPENILLD  G+IALCDFGL K ++K  D+TNTFCGT EYLAPELLL + GY+K
Sbjct: 462 IVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDESGYTK 519

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIELLCRD 625
           +VD+W+LGVL++EM  G  P+Y ED  KMY+KI    ++FP D    E ++ +  LL R+
Sbjct: 520 MVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRN 579

Query: 626 PKRRLG-YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPV 684
           PK RLG  +   E++ HPFF+ + W+ L  K   PP+KP ++S  DTSNFD EFT+    
Sbjct: 580 PKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS-- 637

Query: 685 DSVVNDF-------LSESVQQQFGGWTYV 706
            S +N         LS  +Q +F G+T+V
Sbjct: 638 TSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  346 bits (888), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 246/356 (69%), Gaps = 18/356 (5%)

Query: 364 EKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKS 423
           E   G + I  +Y  +K +     DF++L+++GKG+FG+V QV+KKDT +IYA+K + K 
Sbjct: 300 EHVTGDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKK 359

Query: 424 YIVSKSEVTHTLAERTVLARV---DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480
            IV K+E+ HT+ ER +L R     +PFIV LKFSFQ+P  LYLV  F++GGELF+HLQK
Sbjct: 360 VIVKKNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQK 419

Query: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540
           EGRF   RA+FY AEL+ ALE LH  +++YRDLKPENILLD  G+IALCDFGL K ++K 
Sbjct: 420 EGRFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK- 478

Query: 541 QDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
            D+TNTFCGT EYLAPELL+ + GY+K+VD+W+LGVL++EM  G  P++  D  KMY+KI
Sbjct: 479 -DRTNTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKI 537

Query: 600 LQEPLRFP-DGFDREAKNLLIELLCRDPKRRLG-YNGADEIKRHPFFSQLSWKRLWMKGY 657
               ++FP D    E ++ +  LL R+PK RLG  +   E++ HPFF+ + W+ +  K  
Sbjct: 538 AFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKI 597

Query: 658 IPPYKPPVMSALDTSNFDQEFTR-------EKPVDSVVNDFLSESVQQQFGGWTYV 706
            PP+KP ++S  DTSNFD EFT+       ++P+ +     LS ++Q +F G+T+V
Sbjct: 598 PPPFKPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKFVGFTFV 650

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  278 bits (711), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 195/292 (66%), Gaps = 6/292 (2%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF +L+ +G GSFG+V  V+     + YA+K ++K+ +V   +V HT  ER +L+ V +P
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           FI+ +  +FQ  ++L++++ +I GGELF  L+K  RF    A+FY AE+  ALE LHS  
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKV 567
           +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y+K 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 320

Query: 568 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPK 627
           VDWW+ GVL+YEML G  P+YD +  K Y+ IL  P+RFP  F  +A++L+ +L+ RD  
Sbjct: 321 VDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLITRDLS 380

Query: 628 RRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           +RLG   NG++++K HP+FS++ W++L  K    PY+PP+ +   DTS +D+
Sbjct: 381 QRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDR 432

>Scas_651.18
          Length = 371

 Score =  271 bits (693), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 197/295 (66%), Gaps = 6/295 (2%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           +++DF +L+ +G GSFG+V  ++     + YALK ++K  IV   +V HT  ER +L+ V
Sbjct: 55  TLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVV 114

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +PF+V +  +FQ  E++++++ +I GGELF  L+K  RF    A+FY AE+  ALE LH
Sbjct: 115 SHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 174

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           S+++IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 175 SMDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTKPY 231

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCR 624
           +K VDWW+ G+L+YEML G  P+YD +  K Y+ IL   L+FP+ F  + K+LL +L+ +
Sbjct: 232 NKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLITK 291

Query: 625 DPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           +   RLG   NG++++KRHP+FS++ W++L  +    PY+PP+     DTS FD+
Sbjct: 292 NLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  271 bits (693), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 192/292 (65%), Gaps = 6/292 (2%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           +F +L+ +G GSFG+V  ++ +   + YA+K ++K  +V   +V HT  ER +L+ V +P
Sbjct: 86  NFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHP 145

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           FI+ +  +FQ  +++++++ +I GGELF  L+K  RF    A+FY AE+  ALE LHS +
Sbjct: 146 FIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 205

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKV 567
           +IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y+K 
Sbjct: 206 IIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 262

Query: 568 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPK 627
           +DWW+ G+L+YEML G  P+YD +  K Y+KIL   LRFP  F+ + K+LL  L+ RD  
Sbjct: 263 IDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLS 322

Query: 628 RRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           +RLG   NG +++K HP+F ++ W++L  +    PY+PP+     DTS FD+
Sbjct: 323 QRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDK 374

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  273 bits (697), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 196/304 (64%), Gaps = 6/304 (1%)

Query: 376 YKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL 435
           Y  + +   ++ DF +L+ +G GSFG+V  ++     + YALKA++K  +V   +V HT 
Sbjct: 139 YGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTN 198

Query: 436 AERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAE 495
            ER +L+ V +PFI+ +  +FQ  + +++V+ +I GGELF  L+K  RF    A+FY AE
Sbjct: 199 DERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 258

Query: 496 LLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLA 555
           +  ALE LHS  +IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+A
Sbjct: 259 VCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIA 315

Query: 556 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAK 615
           PE++  + Y+K VDWW+ G+L+YEML G  P+YD +  K Y+ IL   L+FP  F  + +
Sbjct: 316 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 616 NLLIELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTS 672
           +LL +L+ RD  +RLG   NG++++K HP+FS++ W++L  +    PY+PP+     DTS
Sbjct: 376 DLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTS 435

Query: 673 NFDQ 676
            FD+
Sbjct: 436 QFDR 439

>Kwal_33.13846
          Length = 375

 Score =  268 bits (684), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 194/295 (65%), Gaps = 6/295 (2%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           +++DF +L+ +G GSFG+V  V+     + YA+K ++K  IV   +V HT  ER +L+ V
Sbjct: 61  TLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVV 120

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +PFI+ +  +FQ  E +++++ +I GGELF  L+K  RF    A+FY AE+  ALE LH
Sbjct: 121 SHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 180

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           + ++IYRDLKPEN+LLD  GH+ + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 181 AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV---PDVTYTLCGTPDYIAPEVVSTKPY 237

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCR 624
           +K VDWW+ G+L++EML G  P+YD +  K Y+ IL   L+FP  F  + ++LL +L+ R
Sbjct: 238 NKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLSQLITR 297

Query: 625 DPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           D  +RLG   NG++++K H +FS++ W++L  +    PY+PPV +   DTS +D+
Sbjct: 298 DLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDR 352

>Scas_689.25*
          Length = 409

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 190/295 (64%), Gaps = 6/295 (2%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           +IDDF++L+  G GSFG+V  V+     + YALK ++K  +V   +V HT  ER +L+  
Sbjct: 95  TIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVS 154

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            + FIV L  +FQ  E L++++ ++ GGELF  L++  RF    A+FY AE+  AL+ LH
Sbjct: 155 VHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLH 214

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           SL++IYRDLKPEN+LLD  GHI + DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 215 SLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAKPY 271

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCR 624
           +K VDWW+ G+L+YEML+G  P+YD    K Y+ IL  PL+FP  F  +A++LL  L+ R
Sbjct: 272 NKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLITR 331

Query: 625 DPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           D   RLG   NG ++IK H +FS++ W +L  +    PY+PP+     DTS FD+
Sbjct: 332 DLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  265 bits (677), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 134/301 (44%), Positives = 195/301 (64%), Gaps = 7/301 (2%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK K  S+ DF +++ +G GSFG+V  V+     + YA+K ++K+ +V   ++ HT  ER
Sbjct: 42  SKGK-YSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDER 100

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +L  V++PF++ +  +FQ    L++V+ +I GGELF  L+K  RF    A+FY AE+  
Sbjct: 101 RMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTL 160

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
           ALE LH  N+IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE+
Sbjct: 161 ALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEV 217

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y+K VDWW+LGVL+YEML G  P+YD    K Y+KIL   + +P  F+ +  +LL
Sbjct: 218 IATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLL 277

Query: 619 IELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFD 675
            +LL  D  RR+G    GA +IK HP+F+++ W++L  K    PY+PP+ + + DTS FD
Sbjct: 278 SKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFD 337

Query: 676 Q 676
           Q
Sbjct: 338 Q 338

>Kwal_56.24059
          Length = 353

 Score =  263 bits (671), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 196/301 (65%), Gaps = 7/301 (2%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK K  S++DF +L+ +G GSFG+V  V+     + YA+K ++K  ++   ++ HT  ER
Sbjct: 34  SKGK-YSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDER 92

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +L  VD+PF++ +  +FQ    L++V+ +I GGELF  L+K  RF    A+FY AE++ 
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
           ALE LHS ++IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE+
Sbjct: 153 ALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEV 209

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y+K VDWW+LG+L++EML G  P+YD    K Y+KILQ  + +P  F  +  +LL
Sbjct: 210 IATKPYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLL 269

Query: 619 IELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFD 675
            +L+  D  RRLG   +G  ++K HP+FS++ W++L  K    PY+PP+ + + DTS FD
Sbjct: 270 CKLITSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFD 329

Query: 676 Q 676
           Q
Sbjct: 330 Q 330

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  257 bits (656), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 131/301 (43%), Positives = 195/301 (64%), Gaps = 7/301 (2%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK K  S+ DF +++ +G GSFG+V  V+     + YA+K ++K  ++   ++ HT  ER
Sbjct: 27  SKGK-YSLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDER 85

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +L  V++PF++ +  +FQ    L++V+ +I GGELF  L+K  RF    A+FY AE+  
Sbjct: 86  RMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 145

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
           ALE LH+ N+IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE+
Sbjct: 146 ALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEV 202

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y+K +DWW+LG+L++EML G  P+YD    K Y+KIL   + FP  F  +A +LL
Sbjct: 203 ITTKPYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLL 262

Query: 619 IELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFD 675
            +L+  D  RRLG   +G+ +IK HP+FS++ W++L  K    PY+PP+ + + D+S FD
Sbjct: 263 GKLITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFD 322

Query: 676 Q 676
           Q
Sbjct: 323 Q 323

>Scas_690.13
          Length = 354

 Score =  254 bits (650), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/301 (43%), Positives = 193/301 (64%), Gaps = 7/301 (2%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK K  ++ DF +++ +G GSFG+V  V+     + YA+K ++K  +V   ++ HT  ER
Sbjct: 35  SKGK-YTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDER 93

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +L  V++PF++ +  +FQ    L++V+ +I GGELF  L+K  RF    A+FY AE+  
Sbjct: 94  RMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 153

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
            LE LHS N+IYRDLKPENILLD  GHI + DFG  K   +    T T CG P+Y+APE+
Sbjct: 154 GLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEV 210

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y+K VDWW+LGVL++EML G  P+YD    K Y+KILQ  + +P  F  +  +LL
Sbjct: 211 IATKPYNKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLL 270

Query: 619 IELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFD 675
            +L+  D  RR+G   +G+ +IK HP+FS++ W++L  K    PY+PP+ + + DTS FD
Sbjct: 271 GKLITADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFD 330

Query: 676 Q 676
           Q
Sbjct: 331 Q 331

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  255 bits (651), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/301 (43%), Positives = 193/301 (64%), Gaps = 7/301 (2%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK K  ++ DF +++ +G GSFG+V  V+     + YA+K ++K  I+   ++ HT  ER
Sbjct: 53  SKGK-YTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDER 111

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +L  V++PF++ +  +FQ    L++V+ +I GGELF  L+K  RF    A+FY AE+  
Sbjct: 112 RMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTL 171

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
           ALE LHS N+IYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE+
Sbjct: 172 ALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEV 228

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y+K VDWW+LG+L++EML G  P+YD    K Y+KIL   + +P  F  +  +LL
Sbjct: 229 ITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLL 288

Query: 619 IELLCRDPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFD 675
            +L+  D  RRLG   +G D+IK HP+F+++ W++L  K    PY+PP+   + D+S FD
Sbjct: 289 GKLITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFD 348

Query: 676 Q 676
           Q
Sbjct: 349 Q 349

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  270 bits (691), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 140/335 (41%), Positives = 207/335 (61%), Gaps = 6/335 (1%)

Query: 377  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA 436
            + SK   +S+D+F LLKV+GKG+FGKV+  + K+TN++ A+K ++K  I+   ++    A
Sbjct: 805  RGSKRPKVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARA 864

Query: 437  ERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + RA+FY 
Sbjct: 865  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 923

Query: 494  AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
            AE+L AL+  H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT+TFCGTPE+
Sbjct: 924  AEVLLALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEF 983

Query: 554  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE 613
            +APELL  Q Y+K VDWW  GVLLY+ML    P+  +D  +++  IL +   +P     +
Sbjct: 984  MAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1043

Query: 614  AKNLLIELLCRDPKRRLGYNGAD--EIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDT 671
               +   LL +DP++RLG    D  EI   PFF  +++  L      PPY P + SA DT
Sbjct: 1044 IVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDT 1103

Query: 672  SNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYV 706
            S F+QEFT   P  + +   LS + Q++F G++Y+
Sbjct: 1104 SYFEQEFTSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  253 bits (646), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           ++ DF +L+ +G GSFG+V  V+     + YA+K ++K  +V   +V HT  ER +L+ V
Sbjct: 72  TLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVV 131

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +PFI+ +  +FQ   ++++++ +I GGELF  L+K  RF    A+FY AE+  ALE LH
Sbjct: 132 SHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 191

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           S ++IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y
Sbjct: 192 SKDIIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPY 248

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCR 624
           +K VDWW+ G+L+YEML G  P+YD++    Y+ IL   ++FP  F+ + ++LL +L+ R
Sbjct: 249 NKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLITR 308

Query: 625 DPKRRLG--YNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSAL-DTSNFDQ 676
           D  +RLG   NG+ ++K HP+FS++ W +L  +    PY+PP+ +   DTS +D+
Sbjct: 309 DLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  269 bits (687), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 209/335 (62%), Gaps = 6/335 (1%)

Query: 377  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA 436
            K  K + +S+DDF LLKV+GKG+FGKV+  + K+T+++ A+K ++K +I+   ++    A
Sbjct: 810  KTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARA 869

Query: 437  ERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + RA+FY 
Sbjct: 870  EKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 928

Query: 494  AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
            AE+L AL+  H   +IYRDLK ENILL  +GHI + D+GLCK  M   ++T+TFCGTPE+
Sbjct: 929  AEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEF 988

Query: 554  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE 613
            +APE+L  Q Y+K VDWW  GVLLY+ML    P+  +D  +++  IL +   +P     +
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1048

Query: 614  AKNLLIELLCRDPKRRLGYNGAD--EIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDT 671
               +   LL +DP++RLG    D  E+   PFF  +++  +      PPY P + +A DT
Sbjct: 1049 IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDT 1108

Query: 672  SNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYV 706
            S F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1109 SYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFM 1143

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  268 bits (686), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 208/335 (62%), Gaps = 6/335 (1%)

Query: 377  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA 436
            + +K + +S+D+F LLKV+GKG+FGKV+  K K+T+++ A+K ++K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 437  ERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + RA+FY 
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 494  AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
            AE+L AL+  H   VIYRDLK ENILL  +GHI + D+GLCK  M   ++T+TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 554  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE 613
            +APE+L  Q Y+K VDWW  GVLLY+ML    P+  +D  +++  IL +   +P     E
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 614  AKNLLIELLCRDPKRRLGY--NGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDT 671
               +   LL +DP++RLG     ADE+   PFF  +++  +      PPY P + S  DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 672  SNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYV 706
            S F+QEFT   P  + +   L+ S Q++F G++++
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  268 bits (685), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 205/328 (62%), Gaps = 6/328 (1%)

Query: 384  LSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-- 441
            +S+DDF LLKV+GKG+FGKV+  + K+T+ + A+K ++K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 442  -ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCAL 500
                 +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q   R  + RA+FY AE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 501  ETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL 560
            +  H   VIYRDLK ENILL  +GHI + D+GLCK NM   +KT+TFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 561  GQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIE 620
            GQ Y+K VDWWT GVLLY+ML    P+  ED  +++  IL +   +P     +   +   
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 621  LLCRDPKRRLGYNGAD--EIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEF 678
            LL +DP++RLG    D  EI   PFFS +++  +      PP+ P + +A DTS F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 679  TREKPVDSVVNDFLSESVQQQFGGWTYV 706
            T   P  + +   LS  +Q++F G++++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFM 1155

>Scas_715.34
          Length = 1150

 Score =  266 bits (681), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/335 (39%), Positives = 206/335 (61%), Gaps = 6/335 (1%)

Query: 377  KPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA 436
            + SK + +S+D+F LLKV+GKG+FGKV+  + K+T ++ A+K ++K  I+   ++    A
Sbjct: 811  RNSKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARA 870

Query: 437  ERTVL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + RA+FY 
Sbjct: 871  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 929

Query: 494  AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
            AE+L AL+  H   VIYRDLK ENILL  QGHI + D+GLCK  M   +KT+TFCGTPE+
Sbjct: 930  AEVLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEF 989

Query: 554  LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE 613
            +APE+L  QGY++ VDWW  GVLLY+ML    P+  +D  +++  IL +   +P     +
Sbjct: 990  MAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1049

Query: 614  AKNLLIELLCRDPKRRLGYNGAD--EIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDT 671
               +   LL +DP+ RLG    D  E+   PFF  ++++ +      PPY P + S  DT
Sbjct: 1050 IVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDT 1109

Query: 672  SNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYV 706
            S F+ EFT   P  + +   L+ + Q++F G++++
Sbjct: 1110 SYFEHEFTSAPPTLTPLPSILTTTQQEEFRGFSFM 1144

>Kwal_27.10581
          Length = 1154

 Score =  266 bits (681), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 205/332 (61%), Gaps = 6/332 (1%)

Query: 380  KNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT 439
            K + +S+DDF LLKV+GKG+FGKV+  + K+  ++ A+K ++K +I+   ++    AE+ 
Sbjct: 818  KRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKK 877

Query: 440  VL---ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAEL 496
            V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + RA+FY AE+
Sbjct: 878  VFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEV 936

Query: 497  LCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAP 556
            L AL+  H   VIYRDLK ENILL  +GHI + D+GLCK  M   +KT+TFCGTPE++AP
Sbjct: 937  LLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAP 996

Query: 557  ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKN 616
            E+L  Q Y+K VDWW  GVLLY+ML    P+  ED  +++  IL +   +P     +   
Sbjct: 997  EILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQ 1056

Query: 617  LLIELLCRDPKRRLGYNGAD--EIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNF 674
            +   LL +DP+RRLG    D  E+   PFF  + +  +      PPY P + +A DTS F
Sbjct: 1057 IFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYF 1116

Query: 675  DQEFTREKPVDSVVNDFLSESVQQQFGGWTYV 706
            ++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1117 EKEFTSAPPTLTPLPSVLSSNLQEEFRGFSFM 1148

>Kwal_23.6458
          Length = 868

 Score =  238 bits (608), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 186/319 (58%), Gaps = 36/319 (11%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ +K++G+G  GKV  VK+K TN++YALK   K  ++ + ++   LAE+ +LA  ++PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQ--KEGRFDLSRARFYTAELLCALETLHSL 506
           IV L  SFQS + LYL + +  GGE F  LQ  K    D   ARFY++E++ A+E LH +
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 544
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDTKNPVVKGSAQSSLLDTKICSDGFRT 642

Query: 545 NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPL 604
           N+F GT EY+APE++ G G++  VDWWTLG+L+YEML G  PY  ++  K +  +L+  +
Sbjct: 643 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEV 702

Query: 605 RFPDG--FDREAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMKGYIPPY 661
            FP+     R  K+L+ +LL +   RRLG   GA +IK+HPFF ++ W  L  +      
Sbjct: 703 SFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQ------ 756

Query: 662 KPPVMSALDTSNFDQEFTR 680
           +PP++  L  + +D  FTR
Sbjct: 757 EPPLIPVLTENGYD--FTR 773

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  234 bits (598), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 188/319 (58%), Gaps = 36/319 (11%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ ++++G+G  GKV  VK+K TN++YALK   KS ++ + ++   LAE+ +LA  ++PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR--ARFYTAELLCALETLHSL 506
           +V L  SFQS + LYL + +  GGE F  LQ      +S   A+FY +E+  ALE LH L
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 544
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLS-IQAKDAKVPVVKGNAQSTVVDTKICSDGFRT 675

Query: 545 NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPL 604
           N+F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+  E+  + +  IL++ +
Sbjct: 676 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDV 735

Query: 605 RFPDG--FDREAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMKGYIPPY 661
            FP+     R  K+L+ +LL ++  +RLG   GA +IK+HPFF +++W  L  +      
Sbjct: 736 TFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQ------ 789

Query: 662 KPPVMSALDTSNFDQEFTR 680
           +PP++  L  + +D  FT+
Sbjct: 790 EPPLIPVLTENGYD--FTK 806

>Scas_629.16
          Length = 918

 Score =  233 bits (595), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 177/302 (58%), Gaps = 30/302 (9%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ +K++G+G  GKV  V++K TN++YALK   KS ++ + ++   LAE+ +LA  ++PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR--ARFYTAELLCALETLHSL 506
           +V L  SFQS + LY  + +  GGE F  LQ      +S   ARFY +E+  ALE LH L
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 544
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICSDGFRT 697

Query: 545 NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPL 604
           N+F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+      + +  IL+  +
Sbjct: 698 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDV 757

Query: 605 RFPDGFD--REAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMKGYIPPY 661
            FP+  D  R  K+L+ +LLC++  +RLG   GA ++KRHPFF ++ W   +++   PP 
Sbjct: 758 SFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWS--FLRNQEPPL 815

Query: 662 KP 663
            P
Sbjct: 816 IP 817

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  229 bits (583), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/313 (38%), Positives = 186/313 (59%), Gaps = 29/313 (9%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ ++++G+G  GKV  ++++DTN+I+ALK + K  ++ + ++   L E+ +LA  D+PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQ--KEGRFDLSRARFYTAELLCALETLHSL 506
           IV L  SFQ+ + LYL + +  GGE F  LQ  K        A+FY +E++ ALE LH L
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLC-------KLNMKDQD-----------KTNTFC 548
             IYRDLKPENILL   GH+ L DF L        K  MKD             +TN+F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPD 608
           GT EYLAPE++ G G++  VDWWTLG+L+YEML G  P+  ++  + +  IL + ++FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 609 G--FDREAKNLLIELLCRDPKRRLGY-NGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPV 665
                +  K+L+ +LL ++  +RLG  +GA +IKRHPFF ++ W       ++    PP+
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQW------SFLRNQDPPL 617

Query: 666 MSALDTSNFDQEF 678
           + AL+ +  +  F
Sbjct: 618 IPALNDNGCELPF 630

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  229 bits (583), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 185/349 (53%), Gaps = 63/349 (18%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +DF  ++VIGKG+FG+V  V+KKDT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 368 EDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDS 427

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P+IV L +SFQ  + LYL++ F+ GG+L   L +   F     RFY AE + A+ET+H L
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 487

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 534
             I+RD+KP+NIL+D +GHI L DFGL                                 
Sbjct: 488 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAG 547

Query: 535 --------------KLNMKDQDKTNTF-----------CGTPEYLAPELLLGQGYSKVVD 569
                          L M ++ +  T+            GTP+Y+APE+ L QGY +  D
Sbjct: 548 DGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCD 607

Query: 570 WWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFPDG--FDREAKNLLIELLCRD 625
           WW+LG ++YE L G PP+  E   + Y+KI+  ++ L+FP+      EA++L+  LL   
Sbjct: 608 WWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHS 667

Query: 626 PKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNF 674
            +R     GADEIK HPFF  + W  +  +    PY P + S  DT  F
Sbjct: 668 NQRLGRQGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRFF 714

>Kwal_56.22788
          Length = 515

 Score =  218 bits (556), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/391 (32%), Positives = 203/391 (51%), Gaps = 62/391 (15%)

Query: 380 KNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVS------------ 427
           K+   +++DF  ++V+G+G++GKV+ VK   T+++YA+K ++K+ I+             
Sbjct: 116 KHGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDS 175

Query: 428 --KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFD 485
             +  +  T AERT+L+++++P IV L +SF    KLYL+L FI GGELF+HL+++G  D
Sbjct: 176 NLEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLD 235

Query: 486 LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT- 544
                FY AE+ CAL  LH   V+YRDLKPEN LLD +GH+ L DFGL K++  D     
Sbjct: 236 EDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADG 295

Query: 545 ----------------NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYY 588
                           ++  GTPEY APE+L G+ Y++  DW++LG L+++ML G PPY 
Sbjct: 296 GDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYT 355

Query: 589 DEDVPKMYKKILQEPL-RFPDGFDREAKNLLIELLCRD------------------PKRR 629
             +   +  KIL++ + + P       K+ L  LL +D                   K++
Sbjct: 356 GVNHKVILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKK 415

Query: 630 LGYNGADEIKRHPFFSQLSWKRL----WMKGYIPPYKPPVMSALDTSNFDQEFT------ 679
            G       + H  F ++SW ++      +    P  P +       NFD EFT      
Sbjct: 416 AGQAKTTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDS 475

Query: 680 --REKPVDSVVNDFLSESVQQQFGGWTYVGS 708
             +++P +  +N F     +  F G++YV S
Sbjct: 476 EAQDQPANLQINGFSRSGDKDVFKGFSYVAS 506

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  224 bits (570), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/313 (38%), Positives = 181/313 (57%), Gaps = 32/313 (10%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ ++++G+G  GKV  V++K ++++YALK   K+ ++ + ++   LAE+ +LA  ++PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR--ARFYTAELLCALETLHSL 506
           IV L  SFQ+ + LYL + +  GGE F  LQ      +S   ARFY +E+  ALE LH +
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGL-----------CKLNMK----------DQDKTN 545
             IYRDLKPENILL   GH+ L DF L            K N +          D  +TN
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 546 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLR 605
           +F GT EY+APE++ G G++  VDWWTLG+L YEML G  P+  ++  + +  IL+  + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 606 FPDGFD--REAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMKGYIPPYK 662
           FP+  D  R  K+L+ +LL +   +RLG   GA EIK+HPFF  + W  L  +      +
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQWALLRNQ------E 754

Query: 663 PPVMSALDTSNFD 675
           PP++  L    +D
Sbjct: 755 PPLIPVLTEDGYD 767

>Scas_720.103
          Length = 804

 Score =  221 bits (563), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 175/312 (56%), Gaps = 36/312 (11%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ +K++G+G  GKV  VK+K TN +YA+K   K  ++ + ++   + E+ +LA  ++PF
Sbjct: 405 FEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPF 464

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR--ARFYTAELLCALETLHSL 506
           IV L  SFQ+ + LYL + +  GGE F  LQ      +    ARFY +E+L ALE LH L
Sbjct: 465 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLL 524

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD------------------------ 542
             IYRDLKPENILL   GHI L DF L  ++ KD                          
Sbjct: 525 GFIYRDLKPENILLHKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKIC 583

Query: 543 ----KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 598
               +TN+F GT EY+APE++ G G++  VDWWTLG+L++EML G  P+  +   + +  
Sbjct: 584 SEGFRTNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFAN 643

Query: 599 ILQEPLRFPDGFD--REAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMK 655
           IL +   FP+  D  R  KNL+ +LL ++  +RLG   GA EIK+H FF  ++W  L  +
Sbjct: 644 ILSKDFEFPNSNDITRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWNML--R 701

Query: 656 GYIPPYKPPVMS 667
              PP  P + S
Sbjct: 702 NEEPPLIPELSS 713

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  216 bits (550), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 196/359 (54%), Gaps = 56/359 (15%)

Query: 383 PLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV-------------SKS 429
           P  +DDF  ++ +G+G++GKV+ VK   ++K+YA+K ++K+ I+              + 
Sbjct: 164 PRVLDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEK 223

Query: 430 EVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA 489
            +  T AERT+L+++++P IV L +SF    KLYLVL +I GGELF+HL+++G  D    
Sbjct: 224 RIERTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTV 283

Query: 490 RFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT----- 544
            FY AEL CAL+ LHS  ++YRDLKPEN LL+ +GH+ L DFGL K ++ D   T     
Sbjct: 284 AFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGE 343

Query: 545 -----NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
                 +  GTPEY APE+L G+ Y++  DW++LG L+Y+ML G PP+   +   +  KI
Sbjct: 344 NVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKI 403

Query: 600 LQE------PLRFPDGFDREAKNLLIELLCRDPKRR------LGYNGADEIKR------- 640
            QE      P    DGF    K+ L  LL +DP +R         +G    K+       
Sbjct: 404 KQEKTGARIPSYLSDGF----KDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKT 459

Query: 641 -----HPFFSQLSWKRL----WMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVND 690
                H  F ++ WK+L      K  + P  P +       NFD EFT EK +D+ + D
Sbjct: 460 TNYIGHFIFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFT-EKRLDTSIYD 517

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  220 bits (560), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 174/302 (57%), Gaps = 30/302 (9%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F+ ++++G+G  G+V  V++K TN++YALK   K  ++ + ++   L E+ +LA  ++PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR--ARFYTAELLCALETLHSL 506
           IV L  SFQ+ + LYL + +  GGE F  LQ      +S   ARFY++E+  ALE LH +
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD----------------------KT 544
             IYRDLKPENILL   GHI L DF L  +  KD                        +T
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICSDGFRT 557

Query: 545 NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPL 604
           N+F GT EY+APE++ G G++  VDWWTLG+L+YEML G  P+  ++  + +  IL+  +
Sbjct: 558 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEV 617

Query: 605 RFPDGFD--REAKNLLIELLCRDPKRRLGYN-GADEIKRHPFFSQLSWKRLWMKGYIPPY 661
             P+  +  R  K+L+ +LL ++  +RLG   GA +IK+HPFF    W    ++   PP 
Sbjct: 618 VIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWS--LLRNQEPPL 675

Query: 662 KP 663
            P
Sbjct: 676 IP 677

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  209 bits (532), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 188/360 (52%), Gaps = 65/360 (18%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV-------SKSE------- 430
           ++ DF  ++V+G+G++GKV+ VK  +T+K+YA+K +RK+ I+       SK E       
Sbjct: 124 NLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDG 183

Query: 431 ------------VTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478
                       +  T AER++L+ +++P IV L +SF    KLYL+L +I GGELF+HL
Sbjct: 184 NNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHL 243

Query: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
           ++ G  D +   FY AE+ CAL  LH+  V+YRDLKPEN LL+ +GH+ L DFGL K + 
Sbjct: 244 KEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSA 303

Query: 539 KD-----QDKTN-----TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYY 588
            D     +D  N     +  GTPEY APE+LLG+ YS+  DW++LG LLY+ML G PPY 
Sbjct: 304 NDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYT 363

Query: 589 DEDVPKMYKKILQEPL--RFPDGFDREAKNLLIELLCRDPKRRLGYN------GADE--- 637
             +   +  KI Q     + P       K++L  LL ++  +R   +      GA+    
Sbjct: 364 GSNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANNKPT 423

Query: 638 --------------IKRHPFFSQLSWKRL----WMKGYIPPYKPPVMSALDTSNFDQEFT 679
                            H  F ++ WK L      K  + P  P +       NFD EFT
Sbjct: 424 KSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDTEFT 483

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  207 bits (528), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 168/291 (57%), Gaps = 51/291 (17%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV------------------- 426
           I DF  ++V+G+G++GKV+ VK K T+K+YA+K ++K+ I+                   
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 427 ---SKSE-----VTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478
              S+ E     +  T AERT+L+++++P IV L +SF    KLYL+L +I GGELFFHL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
           ++ G  +     FY AE+ CAL+ LHS  V+YRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 539 --------------KDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGL 584
                         +D ++ ++  GTPEY APE+LLGQ Y+   DW++LG LLY+MLTG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 585 PPYYDEDVPKMYKKILQE------PLRFPDGFDREAKNLLIELLCRDPKRR 629
           PPY   +   +  KI  +      P    DG     K++L  LL  DPK+R
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGM----KDVLGALLKSDPKKR 428

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  205 bits (522), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 185/352 (52%), Gaps = 52/352 (14%)

Query: 380 KNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS---------- 429
           +  P  ++DF  ++V+G+G++GKV+ VK + T+K++A+K ++K+ IV  +          
Sbjct: 137 RQTPRKLEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGED 196

Query: 430 ----------EVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQ 479
                      V  T AERT+L+++++P IV L +SF    KLYLVL +I GGELF+HL+
Sbjct: 197 AVLLPAVVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLK 256

Query: 480 KEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 539
           ++G  D     FY AE+ CAL+ LHS  ++YRDLKPEN LLD +GH+ L DFGL K  + 
Sbjct: 257 EQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVN 316

Query: 540 DQD---------KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE 590
             D         +  +  GTPEY APE+L GQ Y++  DW++LG L Y+ML G PP+   
Sbjct: 317 QADSPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGA 376

Query: 591 DVPKMYKKILQEP-LRFPDGFDREAKNLLIELLCRDPKRRLGYN---------------- 633
           +   +  KI Q+  ++ P       K+ L  LL +D  +R   +                
Sbjct: 377 NHKVILSKIKQDKGIKIPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAG 436

Query: 634 --GADEIKRHPFFSQLSWKRL----WMKGYIPPYKPPVMSALDTSNFDQEFT 679
                  + H  F +++WK +      +    P  P +       NFD EFT
Sbjct: 437 QAKTSCYQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>Scas_593.14d
          Length = 495

 Score =  198 bits (504), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 166/278 (59%), Gaps = 33/278 (11%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV------SKSE-------- 430
           ++ DF  ++V+G+G++GKV+ VK K TNK+YA+K ++K+ I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 431 VTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRAR 490
           +  T AE+++LA +++P IV L +SF    KLYL+L +I GGELFFHL+++G  D     
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 491 FYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCK--------------- 535
           FY AE+ CAL+ LH   ++YRDLKPEN LL+ +GH+ L DFGL K               
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 536 LNMKDQDKT--NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP 593
           LN   +D +  ++  GTPEY APE+L G  Y+K  DW++LG L+Y+ML+G PPY   +  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 594 KMYKKILQEPL--RFPDGFDREAKNLLIELLCRDPKRR 629
            +  KI ++    + P       K++L  LL +D  +R
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKR 409

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 157/268 (58%), Gaps = 4/268 (1%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           SK + L + DF++ KV+GKG FG+V  V+  ++  + ALKA+ K  I+  +       E 
Sbjct: 99  SKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREV 158

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            + + + +P +  L   F   +++YL++ ++  GEL+ HL+    F+   A +Y  ++  
Sbjct: 159 EIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD 218

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
           AL+ +H  N+++RD+KPENI++ +   I L DFG   +  K   K  T CGT +YL+PEL
Sbjct: 219 ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKG-SKRKTLCGTVDYLSPEL 277

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           +  + Y++ VD W LGVL YE+L G PP+ +E     YK+IL+  L FPD  D EA++L+
Sbjct: 278 IRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLI 337

Query: 619 IELLCRDPKRRLGYNGADEIKRHPFFSQ 646
             LL  DP  R+      E+K+HP+  +
Sbjct: 338 SRLLEYDPGDRIPLK---EVKKHPWIEK 362

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  176 bits (446), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 159/278 (57%), Gaps = 7/278 (2%)

Query: 367 LGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV 426
           LGR ++    K + N  LS+ DF++ + +GKG FGKV  V+ K +  I ALKAI K+ I+
Sbjct: 81  LGRNSLE---KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEIL 137

Query: 427 SKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDL 486
             + +     E  +   +D+P I+ L   F   +++YL++     GEL+  L+  G F+ 
Sbjct: 138 QFNLLKQLKREVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFND 197

Query: 487 SRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT 546
             A  Y  ++  AL  +H   +I+RD+KPEN+L+ +   + L DFG   LN  +  K  T
Sbjct: 198 VLASHYIYQIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKRKT 256

Query: 547 FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRF 606
            CGT +YL+PE++  + Y + VD W LGVL YE++ G+PP+ +      YK+IL+  L F
Sbjct: 257 LCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNF 316

Query: 607 PDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           P+   ++AK+L+ +LL  D  +RL   G   +K HP+ 
Sbjct: 317 PESISKDAKDLISKLLVTDTTQRLSLTG---VKTHPWI 351

>Kwal_56.24091
          Length = 381

 Score =  176 bits (445), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 163/279 (58%), Gaps = 9/279 (3%)

Query: 373 TIDYKPSKNKP-----LSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVS 427
           T+  K S N P     +S+DDF++ K +GKG FGKV  VK K T  I ALKA++KS IV 
Sbjct: 102 TLSGKVSNNSPVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQ 161

Query: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487
            +       E  + + + +P +  L   F   +++YL++ ++  GEL+ HL+  G F+  
Sbjct: 162 YNVQKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDI 221

Query: 488 RARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTF 547
            A  +  ++  AL  +HS N+++RD+KPENILL +Q  + L DFG    N+ +  K  T 
Sbjct: 222 TASHFVHQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGN-SKRKTL 280

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP 607
           CGT +YL+PEL+  + Y   VD W LGVL YE+L G PP+ ++     YK+I++  LRFP
Sbjct: 281 CGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFP 340

Query: 608 DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           D     A++L+  LL  DP+ R+      ++KRHP+  +
Sbjct: 341 DQVSPHARDLISRLLEYDPQNRI---PLKDVKRHPWIKK 376

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  172 bits (435), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 168/287 (58%), Gaps = 9/287 (3%)

Query: 369 RVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSK 428
           RV I  D+   K + +++ DF++ K++GKG FGKV  VK ++T  I ALKA+ K  IV  
Sbjct: 81  RVPILNDHN-DKFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQY 139

Query: 429 SEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR 488
           +       E  +     +  +  L   F   +++YL++ ++  GEL+  L+  G  + + 
Sbjct: 140 TIQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETL 199

Query: 489 ARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC 548
           A ++  ++  AL+ +HS N+++RD+KPENIL+ +   I L DFG    N +D  K  T C
Sbjct: 200 ASYFVYQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLC 258

Query: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM-YKKILQEPLRFP 607
           GT +YL+PEL+  + Y+  VD W LGVL YE+L G PP ++ED  +M Y++IL+  L+FP
Sbjct: 259 GTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPP-FEEDTKEMTYRRILRCDLKFP 317

Query: 608 DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFS--QLSWKRL 652
                +A++L++ LL  +P +R+  +   E+K H + +  + SW  L
Sbjct: 318 LNVSPQARDLIVRLLQFEPSKRIPLS---EVKSHAWIANNRGSWTDL 361

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  175 bits (444), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 177/375 (47%), Gaps = 64/375 (17%)

Query: 357 NHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYA 416
           N +W N  +    V      KP KNK     DF+++  +G+G +G+V   +K+DT ++ A
Sbjct: 145 NEEWNNYLQKEHEVLRKRRLKP-KNK-----DFEMITQVGQGGYGQVYLARKRDTKEVCA 198

Query: 417 LKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFF 476
           LK + K  +V  +E  H L ER +L    + ++V L ++FQ PE LYL + F+ GG+   
Sbjct: 199 LKILNKKLLVKLNETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRT 258

Query: 477 HLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC-- 534
            L          ARFY +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL   
Sbjct: 259 LLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAG 318

Query: 535 --------------------------------------KLNMKDQDKTNTFCGTPEYLAP 556
                                                  L   D +  N+  G+P+Y+A 
Sbjct: 319 TVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMAL 378

Query: 557 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY------KKILQEPLRFPDGF 610
           E+L G+ Y   VD+W+LG +L+E L G  P+      + Y      K+ L+ P    DG 
Sbjct: 379 EVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF-LNDGR 437

Query: 611 ----DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVM 666
               DR  +  LI  L  DP  RL     + +KR  +F ++++  L  +   PP+ P + 
Sbjct: 438 SAISDRAWE--LITRLIADPINRL--RSFEHVKRMNYFHEINFDTL--RQLSPPFTPQLD 491

Query: 667 SALDTSNFDQEFTRE 681
           +  D   FD +FT E
Sbjct: 492 NETDAGYFD-DFTNE 505

>Scas_705.23
          Length = 553

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 179/379 (47%), Gaps = 70/379 (18%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +K+DT ++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ  E LYL + F+ GG+    L        + ARFY +E+ CA+  LH L 
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336

Query: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                   L   + +  N+  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396

Query: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      KK L+ P+   +G   F     +++  L+  DP  RL     + I
Sbjct: 397 SGSSTNETYENLRHWKKTLRRPV-LDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFD------------QEFTREKPVDS 686
           KR P+F+++++  L      PP+ P + S  D   FD              F R+  + S
Sbjct: 453 KRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510

Query: 687 VVNDFLSESVQQQFGGWTY 705
           +V+D    +V  +  G+T+
Sbjct: 511 MVDD---SAVDSKLVGFTF 526

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 168/343 (48%), Gaps = 56/343 (16%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +KKDT ++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 176 DFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSE 235

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ  + LYL + F+ GG+    L          ARFY +E+ CA+  LH L 
Sbjct: 236 WLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLG 295

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 296 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIE 355

Query: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                  +L  K+ +  N+  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 356 DRRKMYNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 415

Query: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      K+ L+ P R  DG   F     +L+  L+  DP  RL     + +
Sbjct: 416 SGSSTNETYDNLRRWKQTLRRP-RQSDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHV 471

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTRE 681
           KR  +F+ +++  L  +  IPP+ P + S  D   FD +FT E
Sbjct: 472 KRMSYFADINFSTL--RSMIPPFTPQLDSETDAGYFD-DFTSE 511

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 180/378 (47%), Gaps = 66/378 (17%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +DF++L  +G+G +G+V   +K+DT ++ ALK + K  +   +E  H L ER +L    +
Sbjct: 142 NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRS 201

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
            ++V L ++FQ    LYL + F+ GG+    L        + ARFY +E+ CA+  LH L
Sbjct: 202 EWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHEL 261

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 535
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 262 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPI 321

Query: 536 ---------LNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 586
                    L   D +  N+  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L    P
Sbjct: 322 EDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTP 381

Query: 587 YYDEDVPKMYKKI--LQEPLRFPD-GFDREAKN----LLIELLCRDPKRRLGYNGADEIK 639
           +      + Y+ +   ++ LR P  G  R A +      I  L  DP  RL     + +K
Sbjct: 382 FSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRL--KSFEHVK 439

Query: 640 RHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFD------------QEFTREKPVDSV 687
           R P+FS++ + +L  +   PP+ P + S +D   FD              F R+  ++++
Sbjct: 440 RMPYFSEIDFSKL--REMSPPFIPQLDSEVDAGYFDDFTNEADMAKYADVFKRQNKLNAM 497

Query: 688 VNDFLSESVQQQFGGWTY 705
           ++D    +V  +  G+T+
Sbjct: 498 IDD---SAVDSKLVGFTF 512

>Kwal_23.3992
          Length = 571

 Score =  171 bits (433), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/343 (30%), Positives = 170/343 (49%), Gaps = 56/343 (16%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +K+DT +I ALK + K  ++  +E  H L ER +L    + 
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ P  LYL + F+ GG+    L          ARFY +E+ CA++ LH L 
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                   L   D +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      K++L+ P R  +G   F     +L+I L+  DP  RL     + +
Sbjct: 415 SGSSTNETYENLRCWKQVLRRP-RCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHV 470

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTRE 681
           K+  +F+++S++ L  +   PP+ P + +  D   FD +FT E
Sbjct: 471 KKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 169/353 (47%), Gaps = 56/353 (15%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +KKDT +I ALK + K  ++      H L ER +L    + 
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ P+ LYL + F+ GG+    L          ARFY +E+ CA+  LH L 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                  KL  ++    ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      K +LQ P +  +G   F      L+  L+  DP  RL     + +
Sbjct: 411 SGNSTNETYENLRNWKHVLQRP-KCDNGRYAFSDRTWELITRLIA-DPINRL--KSFEHV 466

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDF 691
           KR  +FS++ +  L  +   PP+ P + +  D   FD +FT E+ +   V+ F
Sbjct: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  167 bits (424), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 159/304 (52%), Gaps = 40/304 (13%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQ-VKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT---V 440
           S  DF   + +G GS+  V + + KK  NKIYA+K   K +I+ +++V +   E+    +
Sbjct: 7   SPHDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNL 66

Query: 441 LARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCAL 500
           LA+  +  I+ L ++F   E LY VL F  GGEL   L K G F+    R +TA+L+ AL
Sbjct: 67  LAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDAL 126

Query: 501 ETLHSLNVIYRDLKPENILLDYQGHIALCDFGL------------CKLN-----MKDQDK 543
           E +HS  +I+RDLKPEN+LLD  G + + DFG              K N      KD   
Sbjct: 127 EFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQN 186

Query: 544 TNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEP 603
             +F GT EY++PELLL        D W LG ++Y+ + G PP+  E+  K ++KI+   
Sbjct: 187 CASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVA-- 244

Query: 604 LRFPDGFDREAK-----------NLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK-- 650
           L +P G +               NL+ ++L  +   R+     ++IKRHP+FS++ W   
Sbjct: 245 LDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKVDWNDK 301

Query: 651 -RLW 653
            ++W
Sbjct: 302 IKIW 305

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  167 bits (423), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 159/291 (54%), Gaps = 17/291 (5%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           I+DF   + +G GS+  V+     ++NK YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 446 N-PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
           N   I+ L F+FQ    LY +L +   G+L   ++K G  +    ++Y A+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDQD-------KTNTFCGTPEYLA 555
              VI+RDLKPENILLD    + L DFG  +L  +  + D       ++N+F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 556 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAK 615
           PELL         D W  G +L++M+ G PP+   +    ++K+++    F  GF    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 616 NLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKR--LWMKG--YIPPYK 662
           +L+  +L ++P+RRL  N   +IK H FF+ +++    +W K    + PYK
Sbjct: 392 DLVKNILIKNPERRLLIN---QIKAHQFFADVNFGNGSVWDKDPPELGPYK 439

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  164 bits (414), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 170/353 (48%), Gaps = 56/353 (15%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +KKDT +I ALK + K+ +   +   H L ER +L    + 
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ P  LYL + F+ GG+    L          ARFY +E+ CA++ LH L 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                  ++  K+ +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      K++L+ P R  +G   F      L+  L+  DP  RL     + +
Sbjct: 421 SGSSSNETYENLRRWKQVLRRP-RCENGRPAFSDRTWELITRLIA-DPINRL--RSFEHV 476

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDF 691
           K+  +F+++ +  L  +   PP+ P + S  D   FD +FT E  +    + F
Sbjct: 477 KKMKYFAEIDFANL--RSMSPPFIPQLDSETDAGYFD-DFTNEADMAKYADVF 526

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  165 bits (417), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 152/277 (54%), Gaps = 12/277 (4%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT---VLARV 444
           DF   + +G GS+  V +   + T +++A+K   K +I+S+++V +   E+    +LA  
Sbjct: 9   DFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHG 68

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
           ++P I+ L ++F   E LY VL F  GGEL   LQ +GRF+ +  + +  +L+ ALE +H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK---TNTFCGTPEYLAPELLLG 561
              V++RDLKPEN+LL  +G + + DFG+   N+   D    T++F GT EY++PELLL 
Sbjct: 129 GCKVVHRDLKPENLLLSSEGKLMITDFGVAS-NLAATDNLSSTSSFVGTAEYVSPELLLQ 187

Query: 562 QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIEL 621
              +   D W +G +LY+   G PP+  E+    ++KI+     +     +   +L+ ++
Sbjct: 188 NKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKI 247

Query: 622 LCRDPKRRLGYNGADEIKRHPFFSQLSW--KRLWMKG 656
           L  DP  R       +IK H +F  + W  K L  KG
Sbjct: 248 LVLDPDSRYTL---PQIKNHAWFQGIDWTNKELIWKG 281

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 160/297 (53%), Gaps = 21/297 (7%)

Query: 384 LSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 443
           + I DF   + +G GS+  V+    +D+ K YA+K + K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 444 VD-NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
           ++    I  L F+FQ    LY +L +   G+    ++K G  + + AR+Y ++++ A+++
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL------NMKDQD-------KTNTFCG 549
           LH++ +I+RD+KPENILLD    + L DFG  K+      N  D         K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 550 TPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG 609
           T EY++PELL         D W  G +LY+ML G PP+   +    ++K+++    F  G
Sbjct: 300 TAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG 359

Query: 610 FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK--RLWMKG--YIPPYK 662
           F +  K+L+ +LL RDP  RL      +IK H FF +++++   +W      I PYK
Sbjct: 360 FPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFEDGSVWDDNPPEIQPYK 413

>Kwal_56.22693
          Length = 984

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 152/273 (55%), Gaps = 12/273 (4%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV- 444
           I DF   +V+G GS+  VM  +  D+ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
           D   ++ L F+FQ    LY +L +   G+    ++K G      A +Y+A++L A++ LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ--------DKTNTFCGTPEYLAP 556
              +++RD+KPENILLD    + L DFG  ++  KD+        +++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 557 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKN 616
           ELL         D W  G +L++M+ G PP+   +    ++K+++    F  GF    ++
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 617 LLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
           L+ ++L + P++RL    A +IK+H FF  +++
Sbjct: 395 LIKKILVKSPEQRL---DASQIKKHHFFKDVNF 424

>Scas_660.20
          Length = 957

 Score =  164 bits (415), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 156/280 (55%), Gaps = 21/280 (7%)

Query: 388 DFDLLKVIGKGSFGKVMQ-VKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT---VLAR 443
           DF   + +G GS+  V + + K++T +I+A+K   K++I+ +S+V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
             +P IV L ++F   E LY VL ++ GGEL   L K   F    ++ +T +L+  LE +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN----TFCGTPEYLAPELL 559
           HS  VI+RDLKPEN+LLD  G + + DFG         +  N    +F GT EY++PELL
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 560 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI--LQEPL--------RFPDG 609
           L    S   D W LG ++++ +TG PP+  E+  K ++KI  L  P         +F + 
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVALDYPWSSTNIHNNKFLNN 249

Query: 610 FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
            +    NL+ ++L  +PK RL      +IK+ P+F+ ++W
Sbjct: 250 INPLIINLVRKILVLEPKDRLSL---KKIKQDPWFATVNW 286

>Scas_716.33
          Length = 573

 Score =  160 bits (406), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 176/379 (46%), Gaps = 70/379 (18%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF+++  +G+G +G+V   +KKDTN++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 177 DFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQ 236

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
           ++V L ++FQ  + LYL + F+ GG+    L        + ARFY +E+  A+  LH L 
Sbjct: 237 WLVKLLYAFQDTQNLYLAMEFVPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALHDLG 296

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD---------QDKT-- 544
             +RDLKPEN L+D +GHI L DFGL             K+ +++          DK+  
Sbjct: 297 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSIE 356

Query: 545 -----------------NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587
                            N+  G+P+Y+A E+L G+ Y   VD+W+L  +L+E L G  P+
Sbjct: 357 DRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTPF 416

Query: 588 YDEDVPKMY------KKILQEPLR---FPDGFDREAKNLLIELLCRDPKRRLGYNGADEI 638
                 + Y      KK L+ P+     P   DR      I  L  DP  RL     + +
Sbjct: 417 SGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWD--FITRLIADPINRL--RSFEHV 472

Query: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFD------------QEFTREKPVDS 686
           KR  +F  + +  L  +   PP+ P + +  D   FD              F R+  + +
Sbjct: 473 KRMTYFESVDFNTL--RDLSPPFIPQLDNETDAGYFDDFTNEADMAKYADVFKRQNKLST 530

Query: 687 VVNDFLSESVQQQFGGWTY 705
           +VND     +  +  G+T+
Sbjct: 531 MVND---ADIDSKLVGFTF 546

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  162 bits (411), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 158/293 (53%), Gaps = 19/293 (6%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           I DF   +++G G++  VM    KD+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 179 IKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLN 238

Query: 446 NPF-IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
           N   IV L F+FQ    LY +L +   G+    ++K G       R+Y+A+++  ++ LH
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLH 298

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQDKTN----------TFCGTPEY 553
           S  +I+RD+KPENILLD    + + DFG  K L  K++D+ N          +F GT EY
Sbjct: 299 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 554 LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE 613
           ++PELL         D W  G ++++M+ G PP+   +    ++K+++    F  GF   
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV 418

Query: 614 AKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK--RLWMKGY--IPPYK 662
            ++L+  +L + P++RL      +I++H F+  +S++   +W      I PYK
Sbjct: 419 VRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFEDGSVWTAPAPEIQPYK 468

>Scas_627.7
          Length = 349

 Score =  153 bits (387), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 94/263 (35%), Positives = 152/263 (57%), Gaps = 4/263 (1%)

Query: 382 KPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 441
           KPLS+DDF++ K +GKG FGKV  V+ K+T  I ALK + K+ IV  +       E  + 
Sbjct: 84  KPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQ 143

Query: 442 ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
             +++P +  L   F   +++YL++ ++  GEL+  L+  G F+   A  +  ++  AL 
Sbjct: 144 TSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALN 203

Query: 502 TLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLG 561
            LH   +I+RDLKPENIL+ +   I L DFG   +N +   K  T CGT +YL+PE++  
Sbjct: 204 YLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGV-KRKTLCGTIDYLSPEMIRS 262

Query: 562 QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIEL 621
           + Y   VD W LGVL YE++ G PP+ ++     YK+IL+  ++FP+    + K+L+ +L
Sbjct: 263 REYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLISKL 322

Query: 622 LCRDPKRRLGYNGADEIKRHPFF 644
           L  +P  R+      ++ +HP+ 
Sbjct: 323 LKYNPSERISMR---DVMKHPWI 342

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  159 bits (402), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 155/281 (55%), Gaps = 15/281 (5%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT---VL 441
           S  DF   + +G GS+  V +V ++ +   YA+K   K +I+ +++V +   E+    +L
Sbjct: 6   SPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLL 65

Query: 442 ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
            + ++P I+ L ++F   E LY V+    GGEL   L+++  F  + AR Y  +L+  +E
Sbjct: 66  GQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVE 125

Query: 502 TLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMK-----DQDKTNT-FCGTPEYLA 555
            +HS+ VI+RDLKPEN+LLD +G + + DFG      +     D DK  T F GT EY++
Sbjct: 126 YIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVS 185

Query: 556 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAK 615
           PELLL        D W LG +LY+ L G PP+  ++  + +++I+     +    +  A 
Sbjct: 186 PELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAA 245

Query: 616 NLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW---KRLW 653
            L+ ++L  DP +R      ++IK+H +FS + W   +++W
Sbjct: 246 GLVSKILVLDPSQRYTL---EQIKKHKWFSGVDWNNKEKIW 283

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 150/265 (56%), Gaps = 9/265 (3%)

Query: 391 LLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS--EVTHTLAERTVLAR-VDNP 447
           L K +GKGS G+V   K  +T K+ A+K + K ++ S    ++ + +    ++ + + +P
Sbjct: 75  LGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIMKLISHP 134

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            ++ L   +++  +LYLVL ++ GGELF +L  +G+   S A  Y  +++ A+   H  N
Sbjct: 135 NVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFN 194

Query: 508 VIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY-S 565
           + +RDLKPEN+LLD +   I + DFG+  L   D+    T CG+P Y +PE++LG+ Y  
Sbjct: 195 ICHRDLKPENLLLDKKKRSIKIADFGMAALETSDK-LLETSCGSPHYASPEIVLGRKYHG 253

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRD 625
              D W+ G++L+ +LTG  P+ D++V K+  K+     + P     EAK+L+  +L  D
Sbjct: 254 SPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQWLSVEAKDLISRILVVD 313

Query: 626 PKRRLGYNGADEIKRHPFFSQLSWK 650
           P RR+     D+I +H   ++   K
Sbjct: 314 PNRRITI---DQILQHELLTKYDQK 335

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  155 bits (393), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 106/158 (67%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           DDF+ +KVIGKG+FG+V  V+KKDT KIYA+K + KS + +K ++ H  AER VLA  D+
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P++V L +SFQ  + LYL++ F+ GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT 544
             I+RD+KP+NIL+D +GHI L DFGL     K  D +
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSS 458

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 77/131 (58%), Gaps = 6/131 (4%)

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLR 605
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  ++ L+
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 606 FPDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKP 663
           FPD      EA++L+  LL     R   + GADEIK HPFFS + W  +  +    PY P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTI--RQVEAPYIP 648

Query: 664 PVMSALDTSNF 674
            + S  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  157 bits (396), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 156/294 (53%), Gaps = 20/294 (6%)

Query: 386 IDDFDLLKVIGKGSFGKV-MQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           I DF    ++G GS+ +V +   K D++K YA+K + K Y++ + +V +   E+T L  +
Sbjct: 115 IKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNL 174

Query: 445 DN-PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            +   ++ L F+FQ    LY +L +   G+    ++K G  +     +Y+A+++ A+ ++
Sbjct: 175 KSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGSM 234

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK-----------TNTFCGTPE 552
           HS  +I+RD+KPENILLD    I L DFG  KL  K  DK           +++F GT E
Sbjct: 235 HSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAE 294

Query: 553 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDR 612
           Y++PELL         D W  G L+Y+M+ G PP+   +    ++K+++    F  GF  
Sbjct: 295 YVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPT 354

Query: 613 EAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW--KRLWMKG--YIPPYK 662
             ++L+  +L + P++RL      +IK H  F  +++    +W +    I PY+
Sbjct: 355 IIRDLVKNILVKQPEKRL---TIPQIKEHCLFENINFSDNSVWNRDPPKILPYR 405

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  153 bits (387), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +DF  +KVIGKG+FG+V  V+KKDT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P++V L +SFQ  + LYL++ F+ GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 542
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 463

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 78/131 (59%), Gaps = 7/131 (5%)

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLR 605
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  ++ L 
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 606 FPDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKP 663
           FPD      EA++L+  LL      RLG +GA+EIK HPFF  + W+ +   G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 664 PVMSALDTSNF 674
            + S  DT  F
Sbjct: 649 KLSSVTDTRFF 659

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  154 bits (390), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 156/292 (53%), Gaps = 18/292 (6%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           I DF   + +G GS+  V+     ++ K YA K + K Y++ + +V +   E+  L R++
Sbjct: 197 IKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLN 256

Query: 446 N---PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
           +   P ++ L F+FQ    LY +L +   G+    +++ G       ++Y A++L A+  
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL-NMKDQDK-------TNTFCGTPEYL 554
           LH   +I+RD+KPENILLD    I L DFG  KL   +D++K       + +F GT EY+
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 555 APELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREA 614
           +PELL         D W  G +L++M+ G PP+   +    ++K+++    F  GF    
Sbjct: 377 SPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMIL 436

Query: 615 KNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKR--LWMK--GYIPPYK 662
           ++L+ +LL + P++RL      +I++H FF+ ++++   +W      I PYK
Sbjct: 437 RDLIKQLLVKKPEQRLTI---LQIEKHHFFNDINFRNGSVWSNPAPQIAPYK 485

>Kwal_33.14554
          Length = 714

 Score =  153 bits (387), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +DF  +KVIGKG+FG+V  V+KKDT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P++V L +SFQ  + LYL++ F+ GG+L   L +   F     RFY AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 542
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 456

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (58%), Gaps = 6/131 (4%)

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLR 605
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  ++ L+
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 606 FPDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKP 663
           FPD      EA++L+  LL    +R   + GADEIK HPFF  + W  +  +    PY P
Sbjct: 589 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIP 646

Query: 664 PVMSALDTSNF 674
            + S  DT  F
Sbjct: 647 KLSSITDTRFF 657

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  154 bits (389), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 157/304 (51%), Gaps = 41/304 (13%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKI-YALKAIRKSYIVSKSEVTHTLAERT---VLAR 443
           +F   + +G GS+  V +   K   K  YA+K   K +I+ +++V +   E+    +LAR
Sbjct: 10  EFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLAR 69

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            ++P IV L ++F   E LY VL + +GGEL   L K G F  S A+ + A+L+  LE +
Sbjct: 70  GNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFM 129

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDQDKT----------------- 544
           H+  VI+RDLKPEN+LL  +G + + DFG      N  D+D T                 
Sbjct: 130 HARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSG 189

Query: 545 -----NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
                ++F GT EY++PELLL    S   D W LG ++Y+ + G PP+  E+  K ++KI
Sbjct: 190 DKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGENELKTFEKI 249

Query: 600 LQ-----EPLRFPD--GFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW--- 649
           +       P R  +    + +  NL+  +L  D  +R      D+IKR P+F+ + W   
Sbjct: 250 VSLDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATI---DQIKRDPWFANVDWGDK 306

Query: 650 KRLW 653
           K+LW
Sbjct: 307 KKLW 310

>Kwal_47.18307
          Length = 621

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 153/271 (56%), Gaps = 11/271 (4%)

Query: 387 DDFDLLKVIGKGSFGKVMQ-VKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER---TVLA 442
           D +  L  +G+GS+  V + V++ ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 443 RVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
           +  +  IV L  +F   E LY VL +++GGEL   +Q+ GR     +R  TA+L+  ++ 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFG-LCKL---NMKDQDKTNTFCGTPEYLAPEL 558
           +HS  VI+RDLKPEN+LL  +G + + DFG  C       ++  +T +F GT EY++PEL
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLL 618
           LL        D W LG ++Y++  G PP+  E+  + ++KI+    ++      +  +++
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIV 247

Query: 619 IELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
             +L  DP +R     A ++K++P+F+ + W
Sbjct: 248 QSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>Scas_654.12
          Length = 737

 Score =  152 bits (384), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +DF  +KVIGKG+FG+V  V+K DT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P++V L +SFQ  + LYL++ F+ GG+L   L +   F     RFY AE + A+ET+H L
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQD 542
             I+RD+KP+NIL+D +GHI L DFGL     K  D
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHD 472

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (58%), Gaps = 6/131 (4%)

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLR 605
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  ++ L+
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 606 FPDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKP 663
           FPD      EA++L+  LL    +R   + GADEIK HPFF  + W  +  +    PY P
Sbjct: 608 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIP 665

Query: 664 PVMSALDTSNF 674
            + S  DT  F
Sbjct: 666 KLSSITDTRFF 676

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  152 bits (383), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 147/273 (53%), Gaps = 23/273 (8%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT----- 439
           ++  + L K +GKGS G+V   K   + K+ A+K      IV K  V H   + T     
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK------IVPKRNVRHNQKQVTALPYG 110

Query: 440 ------VLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
                 ++  + +P I+ L   +++  +LYLVL ++ GGELF +L   G+     A  Y 
Sbjct: 111 IEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYF 170

Query: 494 AELLCALETLHSLNVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTNTFCGTPE 552
            +++  +   H+ N+ +RDLKPEN+LLD +   + + DFG+  L   ++    T CG+P 
Sbjct: 171 KQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNR-LLETSCGSPH 229

Query: 553 YLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFD 611
           Y +PE+++GQ Y     D W+ G++L+ +LTG  P+ D++V K+  K+     + P    
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVS 289

Query: 612 REAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           +EAK+L+ ++L  DP++R+     D+I  HP  
Sbjct: 290 KEAKDLISKILVVDPEKRI---TVDKILEHPLL 319

>Scas_502.2
          Length = 1116

 Score =  150 bits (378), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 154/290 (53%), Gaps = 16/290 (5%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           I DF   +++G G++  VM     D+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 171 IKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLN 230

Query: 446 NP-FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
           N   I+ L F+FQ    LY +L +   G+L   ++K G  +     +Y A+++ A++ +H
Sbjct: 231 NSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMH 290

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKL--------NMKDQDKTNTFCGTPEYLAP 556
           S  +I+RD+KPENILLD    + + DFG  K+        +     ++ +F GT EY++P
Sbjct: 291 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSP 350

Query: 557 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKN 616
           ELL         D W  G ++++M+ G PP+   +    ++K+++    F  GF    ++
Sbjct: 351 ELLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRD 410

Query: 617 LLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK--RLWMKGY--IPPYK 662
           L+  +L + P++RL     + I++H FF   +++   +W      I PYK
Sbjct: 411 LVKRILIKAPEQRLTI---EAIEKHHFFRSKNFQDSSIWNDPAPEIQPYK 457

>Kwal_26.7788
          Length = 1267

 Score =  148 bits (374), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 148/270 (54%), Gaps = 7/270 (2%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR- 443
           +I  + L K +GKGS G+V   K  +T K+ A+K + K+       + + +    ++ + 
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKL 113

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
           + +P ++ L   +++  +L+LVL +++GGELF +L   GR     A  Y  +++      
Sbjct: 114 ISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 504 HSLNVIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ 562
           H  N+ +RDLKPEN+LLD +   I + DFG+  L   ++    T CG+P Y +PE+++G+
Sbjct: 174 HGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNK-LLETSCGSPHYASPEIVMGK 232

Query: 563 GYS-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIEL 621
            Y+    D W+ G++L+ +LTG  P+ D+++ ++  K+     + P      A++L+  +
Sbjct: 233 NYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDLISRI 292

Query: 622 LCRDPKRRLGYNGADEIKRHPFFSQLSWKR 651
           L  DP +R+  N   EI  HP  ++   KR
Sbjct: 293 LVVDPDKRISIN---EILAHPLLAKYGNKR 319

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  142 bits (358), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 134/251 (53%), Gaps = 10/251 (3%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+   K +G G+FG V Q +    N+  A+K + K  +   +E+     E ++L ++D+P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRAL-KGNELQMLYDELSILQKLDHP 113

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV  K  F+S EK Y+V     GGELF  + K+G+F  + A     ++L A+E +HS N
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 508 VIYRDLKPENIL-LD--YQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           V++RDLKPEN+L LD   +  + + DFG+ K    +    +   G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDREAKNLL 618
            K  D W+LGV+ Y +L G  P+  E      +++    +P+ F     +   +EAK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 619 IELLCRDPKRR 629
           +  L   P RR
Sbjct: 294 LRALTLTPARR 304

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 107/303 (35%), Positives = 152/303 (50%), Gaps = 38/303 (12%)

Query: 377 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL 435
           K +K +P+S  D + L K +G G +  V + K K T +  A+K         + +     
Sbjct: 187 KLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFR 246

Query: 436 AERTVLARVDNPFIVPLKFSFQSPE-----KLYLVLAFINGGELFFHLQKEG--RFDLSR 488
            E  +L RV +P IV L  SF  P      + YLVL  I+ GELF  + ++   R D S+
Sbjct: 247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESK 306

Query: 489 ARFYTAELLCALETLHSLNVIYRDLKPENILLDYQG-------------------HIALC 529
           A F   +LL  L+ LH  N+I+RD+KPENILL+                       + + 
Sbjct: 307 ALF--KQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIA 364

Query: 530 DFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYD 589
           DFGL K   + Q  TNT CGTP Y+APE+L  +GY+  VD W+ GV+LY  L G PP+ D
Sbjct: 365 DFGLAKFTGEMQ-FTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSD 423

Query: 590 E-DVPKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           +   P + ++ILQ    F     D  D    +L+  LL  +P  R  YN  DE   HP+F
Sbjct: 424 QLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDER--YN-IDEALNHPWF 480

Query: 645 SQL 647
           + +
Sbjct: 481 NDI 483

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 150/302 (49%), Gaps = 34/302 (11%)

Query: 377 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL 435
           K +K KPLS  D + L K +G G +  V + K K T +  A+K         + +     
Sbjct: 180 KFAKLKPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR 239

Query: 436 AERTVLARVDNPFIVPLKFSFQSPE-----KLYLVLAFINGGELFFHLQKEGRFDLSRAR 490
            E T+L ++ +P IV L  SF  P      + YLVL  I+ GELF  + K+       ++
Sbjct: 240 EETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESK 299

Query: 491 FYTAELLCALETLHSLNVIYRDLKPENILLDYQG-------------------HIALCDF 531
               ++L  L+ LHS N+I+RD+KPENILL+ +                     + + DF
Sbjct: 300 AIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADF 359

Query: 532 GLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE- 590
           GL K   + Q  TNT CGTP Y+APE+L+ +GY+  VD W+ GV+LY  L G PP+ D+ 
Sbjct: 360 GLAKFTGEMQ-FTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 591 DVPKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
             P + ++I+     F     D  D  A +L+  LL  DP+ R   + A     HP+   
Sbjct: 419 GPPSLKEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAA---AAHPWLDS 475

Query: 647 LS 648
           +S
Sbjct: 476 VS 477

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  145 bits (365), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 143/278 (51%), Gaps = 18/278 (6%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+   + +G+G F +  Q+K  D+ KI+A K + K  I S+      L+E  +   + + 
Sbjct: 80  DYHRGQFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV     F+    +Y++L     G L   ++K         RF+  ++   ++ +HS  
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GYS 565
           VI+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L+G+  G+S
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDREAKNLLIELLC 623
             VD W++GV+LY +L G PP+  +DV  +Y++I Q    +P      ++AK L+ ++L 
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPY 661
            +P  R            P   ++    +W +G  PPY
Sbjct: 319 LNPMER------------PSIQEI-MDYVWFRGTFPPY 343

>Scas_693.17
          Length = 1049

 Score =  145 bits (367), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 164/344 (47%), Gaps = 57/344 (16%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR--------KSYIVSKSEVTHTLA 436
           S+ D+D ++ +G GS GKV   K + TN++ A+K +         K Y    +  T  L+
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 437 ERTVLARVDN-----------------------PFIVPLKFSFQSPEKLYLVLAFINGGE 473
           E+ V+ R  N                       P I  L          Y++  +++GG+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 474 LFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGL 533
           L  ++ + G    SRAR +T ++  AL+ LHS N+++RDLK ENI++   G+I L DFGL
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 534 CKLNMKDQ-DKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDED 591
              N+ D+ +K  T+CG+  + APELL    Y    +D W+ GV+LY ++ G  P+ DE+
Sbjct: 247 S--NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDEN 304

Query: 592 VPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKR 651
              +++KI Q  + +P     E  +LL ++L  DP +R      D++  H          
Sbjct: 305 SNVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATL---DQVMNH---------- 351

Query: 652 LWM--------KGYIPPYKPPVMSALDTSNFDQEFTREKPVDSV 687
            WM        K YIP   P  +  LD     +E  R + VD V
Sbjct: 352 HWMVRDCDGPPKSYIPDRPPLTIEQLDVKVI-KEMKRLEFVDDV 394

>Scas_644.15
          Length = 726

 Score =  144 bits (363), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 143/277 (51%), Gaps = 18/277 (6%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+     +G+G F +  Q+K  ++ KI+A K + K  I ++      L+E  +   + +P
Sbjct: 91  DYRRGHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV     F+    +Y++L   + G L   ++K         RF+T ++  A++ +HS  
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GYS 565
           VI+RDLK  NI  D   ++ + DFGL  +   ++++  T CGTP Y+APE+L+G+  G+S
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHS 269

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDREAKNLLIELLC 623
             VD W++GV++Y +L G PP+  +DV  +Y +I      +P       EAK L+ ++LC
Sbjct: 270 FEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILC 329

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP 660
            DP  R            P   ++    +W +G  PP
Sbjct: 330 VDPVER------------PSIREI-IDDVWFRGIFPP 353

>Kwal_26.8709
          Length = 829

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 148/274 (54%), Gaps = 16/274 (5%)

Query: 373 TIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTN------KIYALKAIRKSYIV 426
           +  Y   K K ++   + +   +G+G FGKV     K +N      K  A+K IR+  I 
Sbjct: 24  STSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIP 83

Query: 427 SKSEVTHTL-AERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFD 485
             SE    +  E   L  +++P IV L+   Q+ + + +VL + +GGE + ++QK+ R  
Sbjct: 84  KNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 143

Query: 486 LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
              A    A+L+  +  +HS  +++RDLK EN+LLD   ++ + DFG     + + +   
Sbjct: 144 EGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMK 203

Query: 546 TFCGTPEYLAPELLL-GQGY-SKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMY 596
           T CG+P Y APEL++  + Y ++  D W+ GV+LY ML G  P+ D       +D+ K+Y
Sbjct: 204 TSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLY 263

Query: 597 KKILQEPLRFPDGFDREAKNLLIELLCRDPKRRL 630
           + I + PL+FPD      ++LL E+L  DPKRR+
Sbjct: 264 RYITRTPLKFPDYIAPVPRDLLREILIPDPKRRI 297

>Scas_616.10
          Length = 1461

 Score =  144 bits (363), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 158/312 (50%), Gaps = 44/312 (14%)

Query: 373 TIDYKPSKNKPL-SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV----S 427
           + D K SK K   ++  + L K +GKGS G+V   K  +T ++ A+K + K + +    S
Sbjct: 84  STDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSS 143

Query: 428 KSEVT------------HTLA---------------------ERTVLARVDNPFIVPLKF 454
            S V+             TLA                     E  ++  + +P ++ L  
Sbjct: 144 HSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYE 203

Query: 455 SFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLK 514
            +++  +LYLVL +++GGELF +L  +G+     A  Y  +++  +   HS N+ +RDLK
Sbjct: 204 VWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLK 263

Query: 515 PENILLDYQGH-IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWT 572
           PEN+LLD +   I + DFG+  L + ++    T CG+P Y +PE+++G+ Y     D W+
Sbjct: 264 PENLLLDKKNKSIKIADFGMAALELPNK-LLQTSCGSPHYASPEIVMGKSYHGGPSDVWS 322

Query: 573 LGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGY 632
            G++L+ +LTG  P+ D+++ K+  K+     R P     EA++L+  +L  DP +R+  
Sbjct: 323 CGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVIDPSKRI-- 380

Query: 633 NGADEIKRHPFF 644
              D I  HP  
Sbjct: 381 -TTDRILNHPLI 391

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  142 bits (357), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 134/246 (54%), Gaps = 5/246 (2%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+     +G+G F +  Q+K  D+ K++A K + K  I S+      L+E  +   + +P
Sbjct: 72  DYHRGMFLGEGGFARCFQMKD-DSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV     F+    +Y++L     G L   L++  +      RF+T +++ A++ +HS  
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRR 190

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GYS 565
           +I+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L G+  G+S
Sbjct: 191 IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHS 250

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDREAKNLLIELLC 623
             VD W++GV++Y +L G PP+  ++V  +Y++I      FP       EAK L+ ++L 
Sbjct: 251 FEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILS 310

Query: 624 RDPKRR 629
            DP  R
Sbjct: 311 LDPLER 316

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 156/303 (51%), Gaps = 39/303 (12%)

Query: 394 VIGKGSFGKVM----------QVKKKDTNKIYALKAIRKSYIVSKSEVTHTL-AERTVLA 442
            +G+G FGKV             ++   +K  A+K IR+  IV  SE    +  E   L 
Sbjct: 49  TLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALK 108

Query: 443 RVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
            + +P +V L+   Q+ + + +VL + +GGE + ++Q++ R   S A    A+L+  +  
Sbjct: 109 HLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTY 168

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ 562
           +HS N+++RDLK EN+LLD   ++ + DFG     + D +   T CG+P Y APEL++  
Sbjct: 169 MHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIST 228

Query: 563 G--YSKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQEPLRFPDGFDRE 613
               ++  D W+ G++LY ML G  P+ D       +D+ K+Y+ I + PL+FP+     
Sbjct: 229 RPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPI 288

Query: 614 AKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSN 673
            ++LL ++L  DP +R+       I RH           W+K    P++P    A+ TS 
Sbjct: 289 PRDLLRKILVPDPNKRV---NMQYIHRHE----------WLK----PHRP--FLAVSTSQ 329

Query: 674 FDQ 676
           +D+
Sbjct: 330 WDK 332

>Kwal_0.96
          Length = 427

 Score =  135 bits (341), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 137/259 (52%), Gaps = 10/259 (3%)

Query: 381 NKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS-EVTHTLAERT 439
           N  ++  D+   K +G GSFG V Q ++  + +  A+K + K  +  K  E+     E +
Sbjct: 38  NSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELS 97

Query: 440 VLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCA 499
           +L ++D+P IV  K  F+S +K Y+V     GGELF  + K+G+F    A     ++L A
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 500 LETLHSLNVIYRDLKPENILLDYQG---HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAP 556
           +E LHS N+++RDLKPEN+L   +     + L DFG+ K    D +  +   G+  Y+AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 557 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK--ILQEPLRFPDGF---- 610
           E++   G+ K  D W+LGV+ Y +L G  P+  E V    ++  I + P+ F   +    
Sbjct: 218 EVVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNI 277

Query: 611 DREAKNLLIELLCRDPKRR 629
             EAK+ ++  L  +P  R
Sbjct: 278 SNEAKDFILRALTVNPHDR 296

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  135 bits (340), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 144/307 (46%), Gaps = 38/307 (12%)

Query: 371 NITIDYKPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS 429
           N T     ++ +P S  D +   K +G G +  V + + K+T +  A+K           
Sbjct: 82  NTTKKLSRTREQPRSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDK 141

Query: 430 EVTHTLAERTVLARVDNPFIVPLKFSFQSPE-----KLYLVLAFINGGELFFHLQKEG-- 482
                  E  +L  + +P IV L   F  P      + YLVL  IN GELF  + ++   
Sbjct: 142 RTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL 201

Query: 483 RFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQG------------------ 524
           R D ++A F   +LL  L+ LHS N+I+RD+KPENILL                      
Sbjct: 202 REDETKALF--RQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELD 259

Query: 525 -HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTG 583
             + + DFGL K    +   TNT CGTP Y+APE+L+  GY+  VD W+ GVLLY  L G
Sbjct: 260 IQVKIADFGLAKFT-GEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCG 318

Query: 584 LPPYYDEDV-PKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEI 638
            PP+ ++   P M ++ILQ    F     D  D    +L+  LL  +P  R   N A   
Sbjct: 319 FPPFSEQLAPPSMKEQILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDA--- 375

Query: 639 KRHPFFS 645
             HP+F+
Sbjct: 376 LTHPWFT 382

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 153/290 (52%), Gaps = 19/290 (6%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +   + AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 153

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 565 SK-VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P    + A NL+  +L 
Sbjct: 213 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLI 272

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPV-MSALDTS 672
            +P  R+  +   E +             W K  +P Y  PV M A  TS
Sbjct: 273 VNPLNRITIHEIMEDE-------------WFKVDLPDYLVPVDMKADATS 309

>Kwal_47.18233
          Length = 598

 Score =  137 bits (346), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 163/318 (51%), Gaps = 16/318 (5%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 86

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +   + AR +  +++ A+E  H
Sbjct: 87  RHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 145

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKLY 204

Query: 565 SK-VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P      A NL+  +L 
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI 264

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKP 683
            +P  R+  +            Q  W ++ M+ Y+ P  P + +  +    D E   +  
Sbjct: 265 VNPLNRITIHE---------IMQDEWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQND 313

Query: 684 VDSVVNDFLSESVQQQFG 701
            +  V+D L   + +  G
Sbjct: 314 AEEEVDDSLVTMLSKTMG 331

>Scas_660.28
          Length = 623

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 139/247 (56%), Gaps = 5/247 (2%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 101

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 102 RHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 161 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 219

Query: 565 SK-VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P    + A  L+ ++L 
Sbjct: 220 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI 279

Query: 624 RDPKRRL 630
            +P  R+
Sbjct: 280 VNPLNRI 286

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 145/293 (49%), Gaps = 19/293 (6%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+     +G+G F +  Q+K  D  K++A K + K  I S+      L+E  +   + +P
Sbjct: 89  DYHRGHFLGEGGFARCFQMKD-DKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV     F+    +Y++L     G +   L++         RF   +++ A+  +HS  
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GYS 565
           VI+RDLK  NI  D + ++ + DFGL  +   D+++  T CGTP Y+APE+L G+  G+S
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDREAKNLLIELLC 623
             VD W++GV+LY +L G PP+  ++V  +Y++I      FP       +AKNL+  LL 
Sbjct: 268 YEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQ 327

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQ 676
            +P  R            P   +++   +W +   P   P  ++  +  NFD 
Sbjct: 328 LNPAAR------------PSLYEIT-DNVWFRNTFPSRLPSTITK-EIPNFDH 366

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  137 bits (346), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 151/277 (54%), Gaps = 20/277 (7%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS---------EVTHTLA 436
           I  + L + +G GS GKV+  +  +T +I A+K I KS   ++          +V     
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 437 ER--TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTA 494
           ER   ++  +++P ++ L   +++ + LY+VL ++  GELF  L + G    + A  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 495 ELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYL 554
           +++  +   H+L +++RDLKPEN+LLD++ +I L DFG+  L  KD+    T CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSCGSPHYA 194

Query: 555 APELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQEPLRFP--DG 609
           APE++ G  Y     D W+ GV+LY +LTG  P+ +ED  +  +  K+       P  D 
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254

Query: 610 FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
              EA++L++++L  +P++R+      EI +HP   +
Sbjct: 255 ISPEARDLIVQILTVEPEQRIKTR---EILKHPLLQK 288

>Kwal_26.8796
          Length = 796

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 147/271 (54%), Gaps = 30/271 (11%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVP 451
           +V+G+G+F  V +  ++ T K +A+K I K  +V    V   +A E  VL R+D+P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYR 511
           LK  ++  +  YLV+ F++GG+L   +   G       R  T ++L A++ +HS+ + +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 512 DLKPENILLDYQGH--IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQG------ 563
           DLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++ G+       
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQ-GNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 564 --YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----QEPL---RFPDGFDRE 613
             YS +VD W++G L+Y +LTG  P+       +YK+I      + PL   R  D    +
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPLKDYRISD----D 423

Query: 614 AKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           A++ +   L  DP+ R+    A++  RHP+ 
Sbjct: 424 ARDFIESFLQVDPRNRM---TAEQALRHPWI 451

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  135 bits (340), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 137/248 (55%), Gaps = 5/248 (2%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 110

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 111 RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 170 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 228

Query: 565 S-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P      A  L+  +L 
Sbjct: 229 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI 288

Query: 624 RDPKRRLG 631
            +P  R+ 
Sbjct: 289 VNPLNRIS 296

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  134 bits (338), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 144/261 (55%), Gaps = 8/261 (3%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           + ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 565 SK-VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P      A +L+  +L 
Sbjct: 213 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLI 272

Query: 624 RDPKRRLGYNGADEIKRHPFF 644
            +P  R+  +   EI +  +F
Sbjct: 273 VNPLNRISIH---EIMQDEWF 290

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  134 bits (338), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 140/247 (56%), Gaps = 5/247 (2%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 444
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 90

Query: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     AR +  +++ A++  H
Sbjct: 91  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYCH 149

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
              +++RDLKPEN+LLD   ++ + DFGL  + M D +   T CG+P Y APE++ G+ Y
Sbjct: 150 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 208

Query: 565 SK-VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLC 623
           +   VD W+ GV+LY ML    P+ DE +P ++K I       P+   + A +L+ ++L 
Sbjct: 209 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLI 268

Query: 624 RDPKRRL 630
            +P  R+
Sbjct: 269 VNPVNRI 275

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  136 bits (342), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 437 ERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAEL 496
           E  ++  + +P ++ L   +++  +LYLVL +++GGELF +L  +G+     A  Y  ++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 497 LCALETLHSLNVIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQDKTNTFCGTPEYLA 555
           +  +   HS N+ +RDLKPEN+LLD +   I + DFG+  L + ++    T CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNK-LLETSCGSPHYAS 294

Query: 556 PELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREA 614
           PE+++G+ Y     D W+ G++L+ +LTG  P+ D+++ K+  K+     + P     +A
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 615 KNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           K+L+  +L  +P++RL  N   EI  HP   +
Sbjct: 355 KDLITRILVTNPEKRLTIN---EILNHPLIKK 383

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 156/314 (49%), Gaps = 42/314 (13%)

Query: 378 PSKNKPLSIDDFDLLKVIGKGSFGKV---------MQVKKKDTN-----------KIYAL 417
           P   K ++   + +   +G+G FGKV          Q    + N           K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 418 KAIRKSYIVSK-SEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFF 476
           K I++ +I    S+ T    E   L  + +P IV L+   Q+ + + +VL +  GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 477 HLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL 536
            +Q++ R   + A    ++L+ A+  +HS  +++RDLK EN+LLD + ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 537 NMKDQDKTNTFCGTPEYLAPELLL-GQGY-SKVVDWWTLGVLLYEMLTGLPPYYDE---- 590
            ++      T CG+P Y APEL++  + Y ++  D W+ G++L+ ML G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 591 ---DVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQL 647
              D+ ++Y  IL  PL+FP+  +   ++LL ++L  DPK+R+       I++HP+    
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRS---IEKHPWLESH 333

Query: 648 S---------WKRL 652
           S         W RL
Sbjct: 334 STFLSITPDEWDRL 347

>Scas_618.8
          Length = 427

 Score =  130 bits (328), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 141/262 (53%), Gaps = 13/262 (4%)

Query: 378 PSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI-RKSYIVSKSEVTHTLA 436
           PSK   ++  D++  K +G GSFG V +  KK  N+  A+K + +K+   ++ ++     
Sbjct: 19  PSK---VTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYD 75

Query: 437 ERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAEL 496
           E T+L ++ +P IV  K  F++ +K+Y+V     GGELF  + K+GRF    A     ++
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQI 135

Query: 497 LCALETLHSLNVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
           L A+E +HS ++++RDLKPEN+L         + + DFG+ K   K +       G+  Y
Sbjct: 136 LSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGY 195

Query: 554 LAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFP---- 607
           +APE+L   G+ K  D W++GV+ Y +L+G   +  E V     +      P++F     
Sbjct: 196 VAPEVLTVDGHGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYW 255

Query: 608 DGFDREAKNLLIELLCRDPKRR 629
           D    +AKN +++ L  +P++R
Sbjct: 256 DNISDDAKNFILKALDLNPQKR 277

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 136/261 (52%), Gaps = 13/261 (4%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           I ++ + K IG+GSFGKV     + T++   LK   K          + + E     + D
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------RDPNVVREVFYHRQFD 86

Query: 446 NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHS 505
            P+I  L     +  ++++VL + +G EL+ HL KE R  L  ++   +++  A+   H 
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
           L  ++RDLK EN+LLD  GH  L DFG  +  M  + +  T CGT  Y+APEL+  + Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 566 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRF-PDGFDREAKNLLIELLC 623
              VD W+LG++LY M+ G  P+ ++D  K   KI+ + L F  +    +A +L+  +L 
Sbjct: 206 GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLR 265

Query: 624 RDPKRRLGYNGADEIKRHPFF 644
           ++P  R+      ++  HPF 
Sbjct: 266 KNPNERISLA---QVLSHPFL 283

>Kwal_33.13112
          Length = 505

 Score =  131 bits (330), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 139/267 (52%), Gaps = 12/267 (4%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           +D+ + +GKGSFG V +   K+T ++ A+K I      ++ ++     E   L+ +  PF
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEE--TQDDIDVLAQEIYFLSELRAPF 93

Query: 449 IVPLKFSFQSPEKLYLVLAFINGG---ELFFHLQKEGRFDLSRARFYTAELLCALETLHS 505
           +     ++     +++V+ F  GG   +L  HL  E R   ++  +   E+L  LE LHS
Sbjct: 94  VTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHL-PEHRLPENKVAYIIREVLYGLEYLHS 152

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGY 564
              I+RD+K  NILL  +G + L DFG+    M    K NTF GTP ++APE++    GY
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATL-KRNTFVGTPYWMAPEIIARDNGY 211

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDREAKNLLIELLC 623
            +  D W+LG+   E+LTG PPY   D  K+   I L++P R    F   A++ +   L 
Sbjct: 212 DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLT 271

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWK 650
           +DP  R     A ++  H F ++ +W+
Sbjct: 272 KDPALR---PTASDLLSHKFLNRPTWR 295

>Scas_564.7
          Length = 1210

 Score =  134 bits (338), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 163/338 (48%), Gaps = 50/338 (14%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 441
           S+ D+D L+ +G GS GKV   +   T +I A+K +    K+++  +  +     E+ VL
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 442 AR-----------------------VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478
            R                       + +P I  L          Y++  +++GG+L  ++
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
            + G      AR +   +  ALE +H+ N+++RDLK ENI++   G I + DFGL   N+
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS--NV 335

Query: 539 KDQDKT-NTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 596
            D+ K  +TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DE+   ++
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 395

Query: 597 KKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWM-K 655
           +KI Q  + +P+    E  +LL ++L  DP RR       ++  HP          WM +
Sbjct: 396 EKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRASLK---QVVEHP----------WMTR 442

Query: 656 GY---IPPYKP---PVMSALDTSNFDQEFTREKPVDSV 687
           GY    P Y P   P+   +  +N  +E  R + +D V
Sbjct: 443 GYDYPPPSYVPRRIPMTPEIIDNNVIREMFRLEFIDGV 480

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  134 bits (337), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 145/274 (52%), Gaps = 24/274 (8%)

Query: 391 LLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV------SKSEVTHTL-----AERT 439
           L + +G GS GKV+    + T +  A+K I K+         S  + T+ L      E  
Sbjct: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81

Query: 440 VLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCA 499
           ++  +++P ++ L   +++   LYLVL +   GELF  L + G    + A     +++  
Sbjct: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141

Query: 500 LETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL 559
           +   HSL V++RDLKPEN+LLD + +I + DFG+  L  +D+    T CG+P Y APE++
Sbjct: 142 ISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDK-LLETSCGSPHYAAPEII 200

Query: 560 LG---QGYSKVVDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQEPLRFPDG--FDR 612
            G   +G+S   D W+ GV+L+ +LTG  P+ +ED  +  +  K+ +     PD     +
Sbjct: 201 SGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITK 258

Query: 613 EAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           EA++LL  LL  DP +R+      EI +HP   +
Sbjct: 259 EAQDLLARLLTVDPSKRITIR---EILKHPLLQK 289

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  130 bits (326), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 128/246 (52%), Gaps = 9/246 (3%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 452
           + +G GSFG V + K+  +++  A+K + K  +     +     E  ++  +D+P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 453 KFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRD 512
           K  F++  K Y+V    +GGELF  +  +G++    A     ++L A+E LHS N+I+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 513 LKPENIL-LD--YQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVD 569
           LKPEN+L LD      I L DFG+ +    D D      G+  Y+APE+    G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 570 WWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDREAKNLLIELLC 623
            W++GV+ Y +L G  P+  E V     ++   + P++F     DG    AKN ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 624 RDPKRR 629
            DP  R
Sbjct: 309 LDPACR 314

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  130 bits (326), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKAI-RKSYIVSKSEVTHTLAERTVLARVDNPFIVP 451
           K +G G+FG V Q +   TN+  A+K + +K+   +  ++     E ++L  + +P IV 
Sbjct: 49  KTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLKHPNIVE 108

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYR 511
            K  F+S +K Y+V     GGELF  +  +G+F    A   T ++L A++ +HS NV++R
Sbjct: 109 FKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYMHSKNVVHR 168

Query: 512 DLKPENIL-LDY--QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVV 568
           DLKPEN+L +D      + + DFG+ K    + D      G+  Y+APE+L   G+ K  
Sbjct: 169 DLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGHGKPC 228

Query: 569 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE--PLRFP----DGFDREAKNLLIELL 622
           D W++GV++Y +L G   +  E V    ++  Q   P+ F     D    EAKN ++  L
Sbjct: 229 DIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDEAKNFILRAL 288

Query: 623 CRDPKRR 629
             DP  R
Sbjct: 289 TLDPAER 295

>Kwal_56.22476
          Length = 697

 Score =  132 bits (333), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 140/269 (52%), Gaps = 8/269 (2%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           D+     +G+G F +  Q+K  D  KI+A K + K  I S+      L+E  +   + + 
Sbjct: 78  DYHRGHFLGEGGFARCFQIKD-DGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHT 136

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            IV     F+    +Y++L     G L   L++         RF+T +++ A++ +HS  
Sbjct: 137 NIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRR 196

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GYS 565
           VI+RDLK  NI  D   ++ + DFGL  +   D+++  T CGTP Y+APE+L G+  G+S
Sbjct: 197 VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHS 256

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP-DGF-DREAKNLLIELLC 623
             VD W+ GV++Y +L G PP+  ++V  +Y++I      FP D F   EA  L+ ++L 
Sbjct: 257 YEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILS 316

Query: 624 RDPKRRLGYNGADEIKRHPFFSQLSWKRL 652
            DP  R      DEI  + +F  L   R+
Sbjct: 317 IDPLER---PSLDEIIDYVWFRGLFPSRI 342

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  133 bits (334), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 148/278 (53%), Gaps = 33/278 (11%)

Query: 394 VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLK 453
           ++G+G+F  V +  ++ T K +A+K I K  ++ K +      E  VL ++++P IV LK
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVK--RELDVLQKLNHPRIVKLK 254

Query: 454 FSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDL 513
             F+  +  Y+++ F++GG+L   +   G       R  T ++L A++ +H   + +RDL
Sbjct: 255 DFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDL 314

Query: 514 KPENILLDYQG--HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQG-------- 563
           KP+NI+++      I + DFGL K+  ++    NTFCGT  Y+APE++ G+         
Sbjct: 315 KPDNIMIEQDDPVLIKITDFGLAKVQNQNT-FLNTFCGTLAYVAPEVIDGKNAEDKTNRD 373

Query: 564 -YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-----LQEPLRFPDGFDREAKNL 617
            YS +VD W++G L+Y +LTG  P+  +   +++K+I      + PL+       EA+N 
Sbjct: 374 LYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGSYHEGPLK-DYRISEEARNF 432

Query: 618 LIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMK 655
           +  LL  DPK R+    A +  +HP          WMK
Sbjct: 433 IDCLLNVDPKERM---NAGKALQHP----------WMK 457

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  133 bits (334), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 85/261 (32%), Positives = 138/261 (52%), Gaps = 13/261 (4%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           + ++ ++K +G+GSFGKV     K T++   LK   KS      EV +         + +
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYH-------RQFE 86

Query: 446 NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHS 505
            PFI  L     +  ++++ L +  G EL+ +L  + R  L   R   A+++ A+   HS
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
           L  ++RDLK ENILLD  G+  L DFG  +     + +  T CGT  Y+APEL+  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 566 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-QEPLRFPDGFDREAKNLLIELLC 623
              VD W+LG++LY ML G  P+ ++D  +   KI+ +EP    +    +AK+L++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 624 RDPKRRLGYNGADEIKRHPFF 644
           ++  +R   N   E+ +HPF 
Sbjct: 266 KNAAQRPNLN---EVLQHPFL 283

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  133 bits (334), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 149/283 (52%), Gaps = 34/283 (12%)

Query: 382 KPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 441
           K  SI+D    +V+G+G+F  V +  +++T K +A+K I K  ++    V     E  VL
Sbjct: 214 KDFSIND----EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGN--VDGVTRELEVL 267

Query: 442 ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
            R+++P IV LK  ++  E  YL++ F++GG+L   +   G       R  T ++L A+ 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 502 TLHSLNVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDQDKTN---TFCGTPEYLAP 556
            +H   + +RDLKP+NIL++      + + DFGL K+    QD T    TFCGT  Y+AP
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKI----QDNTTFMKTFCGTLAYVAP 383

Query: 557 ELLLGQG----------YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----Q 601
           E++ G+           YS +VD W++G L+Y +LTG  P+      ++YK+I      +
Sbjct: 384 EVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYHE 443

Query: 602 EPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
            PL+       EA++ +  LL  +P  RL    A+   +HP+ 
Sbjct: 444 GPLK-DYWISDEARDFIDSLLQINPVDRL---TAERALQHPWL 482

>Scas_700.34
          Length = 864

 Score =  132 bits (332), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 140/271 (51%), Gaps = 20/271 (7%)

Query: 380 KNKPLSIDDFDLLKVIGKGSFGKVMQVKKK----------DTNKIYALKAIRKSYIVS-K 428
           K K ++   + +   +G+G FGKV     K          D  K  A+K IR+  I    
Sbjct: 39  KRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDS 98

Query: 429 SEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR 488
           S+      E   L  + +P IV L+   Q+ + + +VL + +GGE + ++Q++ R     
Sbjct: 99  SKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGP 158

Query: 489 ARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC 548
           A    A+L+  +  +HS  +++RDLK EN+LLD   ++ + DFG         +   T C
Sbjct: 159 ACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSC 218

Query: 549 GTPEYLAPELLLG-QGY-SKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKI 599
           G+P Y APEL++  + Y +K  D W+ GV+LY ML G  P+ D       +D+ ++Y  I
Sbjct: 219 GSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYI 278

Query: 600 LQEPLRFPDGFDREAKNLLIELLCRDPKRRL 630
            Q PL+FPD  +   ++LL  +L  DP+RR+
Sbjct: 279 TQTPLKFPDYINPIPRDLLRRILISDPRRRI 309

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  129 bits (323), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 133/247 (53%), Gaps = 10/247 (4%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKA-IRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 451
           K +G G+FG V Q K  +T +  A+K  I+K+   +K ++     E  +L R+ +P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYR 511
            K  F+S +K Y++     GGELF  + K+G+F    A     E+L A++ +HS N+++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 512 DLKPENIL-LDY--QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVV 568
           DLKPEN+L +D   +  + + DFG+ K    D++      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 569 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDREAKNLLIELL 622
           D W++GV+ Y +L G   +  E V     +    + P++F     D    +AK  +++ L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 623 CRDPKRR 629
             DP +R
Sbjct: 281 NLDPSKR 287

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  132 bits (333), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 99/350 (28%), Positives = 165/350 (47%), Gaps = 54/350 (15%)

Query: 381 NKPL---SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR---KSYIVSKSEVTHT 434
           NKP    S+ D+D L+ +G GS GKV   K + TN++ A+K +    KSY+  ++++   
Sbjct: 87  NKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPP 146

Query: 435 LAERTVLAR-----------------------VDNPFIVPLKFSFQSPEKLYLVLAFING 471
             E  ++ R                       + +P I  L          Y++  +++G
Sbjct: 147 KTEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSG 206

Query: 472 GELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDF 531
           G+L  ++ + G      AR +   +  AL+ LH  N+++RDLK ENI++   G I + DF
Sbjct: 207 GQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDF 266

Query: 532 GLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDE 590
           GL  L   ++ + +TFCG+  + APELL    Y    VD W+ GV++Y ++ G  P+ DE
Sbjct: 267 GLSNL-YDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDE 325

Query: 591 DVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK 650
           +   +++KI +  + +P     E  +LL ++L  DP +R       ++  H         
Sbjct: 326 NASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDPLKRASLK---QVCNH--------- 373

Query: 651 RLWMK--------GYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFL 692
             WM+         YIP   P  +  LD  N  +E  R + V+  VND L
Sbjct: 374 -QWMQRGFDFPPPSYIPHRVPLTVEMLDV-NVIKEMHRLELVND-VNDAL 420

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  131 bits (330), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 147/315 (46%), Gaps = 47/315 (14%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI------------------------ 420
           S+ D+D L+ +G GS GKV   K + TN++ A+K +                        
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEE 109

Query: 421 ----RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFF 476
               RK      S    T+ E ++   + +P I  L          Y++  +++GG+L  
Sbjct: 110 LLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 169

Query: 477 HLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL 536
           ++ + G      AR +   +  AL+ LH  N+++RDLK ENI++   G I + DFGL   
Sbjct: 170 YIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS-- 227

Query: 537 NMKDQDKT-NTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDEDVPK 594
           NM D  K  +TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DE+   
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 595 MYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWM 654
           +++KI Q  + +P     +  +LL ++L  DP +R                Q+   +   
Sbjct: 288 LHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKRA------------TLKQVVHHQWMQ 335

Query: 655 KGY-IPP--YKPPVM 666
           KGY  PP  Y PP +
Sbjct: 336 KGYDFPPPSYLPPCV 350

>Scas_700.54
          Length = 698

 Score =  130 bits (327), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 165/337 (48%), Gaps = 42/337 (12%)

Query: 382 KPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 441
           K  SI D    +V+G+G+F  V +  ++ T K +A+K I K  ++   E      E  VL
Sbjct: 220 KDFSIQD----EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVL 273

Query: 442 ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
            ++D+P IV LK  ++  +  Y+V+ F++GG+L   +   G       +  + ++L A++
Sbjct: 274 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 333

Query: 502 TLHSLNVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL 559
            +HS  + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 334 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVI 392

Query: 560 LGQG--------YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ--------EP 603
            G+G        YS +VD W++G L+Y +LTG  P+      ++YK+I +        + 
Sbjct: 393 GGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGSYHEGPLKD 452

Query: 604 LRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKP 663
            R  D    EA++ +  LL  +P  RL    A E   HP+          M  Y   +K 
Sbjct: 453 FRISD----EARSFIDSLLQVNPGNRLTAARALE---HPWIK--------MAQYSQSFKE 497

Query: 664 PVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQF 700
               +L  S   Q+    + +D    +F+    +QQ 
Sbjct: 498 ASQISLTESLSQQKLL--ESMDDAQYEFVKAQRKQQL 532

>Scas_613.5
          Length = 517

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 155/333 (46%), Gaps = 46/333 (13%)

Query: 377 KPSKNKPLSI-DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL 435
           K  + K LS  D + L K +G G +  V +   K T +  A+K         + +     
Sbjct: 191 KIVRTKQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFR 250

Query: 436 AERTVLARVDNPFIVPLKFSFQSPE-----KLYLVLAFINGGELFFHLQKEG--RFDLSR 488
            E  +L R+ +P IV L   F  P      + YLVL  I+ GELF  + K+   R D ++
Sbjct: 251 EETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETK 310

Query: 489 ARFYTAELLCALETLHSLNVIYRDLKPENILLDYQG-------------------HIALC 529
           A F   ++L  L+ LH  N+I+RD+KPENILL+                       + + 
Sbjct: 311 AIF--NQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIA 368

Query: 530 DFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYD 589
           DFGL K   + Q  TNT CGTP Y+APE+L  +GY+  VD W+ GV+LY  L G PP+ +
Sbjct: 369 DFGLAKFTGEMQ-FTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSE 427

Query: 590 E-DVPKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           +   P + ++ILQ    F     D  D    +L+  LL  D   R  Y+  D I  HP+F
Sbjct: 428 QLGPPSLKEQILQAKFAFYTPYWDNIDDNVLHLISHLLVLDADAR--YSVEDTI-NHPWF 484

Query: 645 S--------QLSWKRLWMKGYIPPYKPPVMSAL 669
           +         L  KRL +     P     +S L
Sbjct: 485 NDTRQANSVSLEMKRLQLSDSQMPKTYSELSCL 517

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  130 bits (327), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 143/274 (52%), Gaps = 32/274 (11%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR---KSYIVSKSEV---------- 431
           S+  +D ++ +G GS GKV   K K++N++ A+K +    K+Y+    ++          
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 432 -------------THTLAERTVLARVDNPFIVPLKFSFQS-PEKLYLVLAFINGGELFFH 477
                          T+ E ++   + +P +  L +  Q+     Y+   FI+GG+L  +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFISGGQLLDY 181

Query: 478 LQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLN 537
           + + G    + AR  +  +L AL+ LH+ N+++RDLK ENI+L   G I L DFGL   N
Sbjct: 182 IIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLS--N 239

Query: 538 MKDQDKT-NTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM 595
           M D  K+  TFCG+  + APELL    Y    VD W+ GV+LY ++ G  P+ DE+   +
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSAL 299

Query: 596 YKKILQEPLRFPDGFDREAKNLLIELLCRDPKRR 629
           ++KI +  + +P     +  +LL ++L  DP++R
Sbjct: 300 HEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKR 333

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  126 bits (316), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 131/252 (51%), Gaps = 10/252 (3%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS-EVTHTLAERTVLARVDN 446
           D+   K +G G+FG V Q +   + +  A+K + K  +  +S ++     E ++L ++++
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
           P IV  K  F+S EK Y+V     GGELF  + ++G+F    A F   ++L  ++ LH  
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYLHQR 164

Query: 507 NVIYRDLKPENILLDYQGH---IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQG 563
           N+++RDLKPENIL   +     + + DFG+ K    D +  +   G+  Y+APE+L   G
Sbjct: 165 NIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSG 224

Query: 564 YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDREAKNL 617
           + K  D W++GV+ Y +L G  P+  E      ++    Q P+ F     +   + AK  
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKTAKEF 284

Query: 618 LIELLCRDPKRR 629
           ++  L   PKRR
Sbjct: 285 ILWALTVSPKRR 296

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  125 bits (314), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 139/265 (52%), Gaps = 13/265 (4%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTV-LARVDNP 447
           +++L+ IG+G+FG V + +   +N+I A+K +    +    E    LA+    L+ + +P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGEL--FFHLQKEGRFDLSRARFYTAELLCALETLHS 505
           +I   K +F     +++V+ +  GG          E +    +  F  +E+L  L+ LHS
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL--LGQG 563
              I+RD+K  NILL   GH+ L DFG+    M  + K +TF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSGQMMVTR-KRDTFVGTPFWMAPEVIDRNKQG 195

Query: 564 YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDREAKNLLIELL 622
           Y+++ D W+LG+ + E+L G PP    D  K    I  ++P +    F   A++ + + L
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCL 255

Query: 623 CRDPKRRLGYNGADEIKRHPFFSQL 647
            +DP +R     A E+ +H F  ++
Sbjct: 256 IKDPSQR---PTAAELLKHRFVKRV 277

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 145/305 (47%), Gaps = 44/305 (14%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 441
           S+ D+D L+ +G GS GKV   K + T ++ A+K +    K+++  +      +  + ++
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 442 ARVD-----------------------NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478
            R                         +P I  L          Y++  ++ GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
            + G      AR +   +  AL+ LH+ N+++RDLK ENI++   G I + DFGL   N+
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS--NV 281

Query: 539 KDQDKT-NTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 596
            D  K  +TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DE+   ++
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 341

Query: 597 KKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWM-K 655
           +KI +  + +P     E  +LL ++L  DP RR       ++  HP          WM K
Sbjct: 342 EKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLK---QVVEHP----------WMTK 388

Query: 656 GYIPP 660
           GY  P
Sbjct: 389 GYDTP 393

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 146/278 (52%), Gaps = 20/278 (7%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS---------EVTHTL 435
           +I  + L   +G GS GKV+    +   +  A+K I KS   ++          +V    
Sbjct: 13  TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYG 72

Query: 436 AER--TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            ER   ++  +++P ++ L   +++ + LY+VL ++  GELF  L + G    + A  + 
Sbjct: 73  IEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFF 132

Query: 494 AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
            +++  +   H+L +++RDLKPEN+LLD++ ++ L DFG+  L  KD+    T CG+P Y
Sbjct: 133 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDK-LLETSCGSPHY 191

Query: 554 LAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQEPLRFP--D 608
            APE++ G  Y     D W+ GV+LY +LTG  P+ +ED  +  +  K+       P  D
Sbjct: 192 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 609 GFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
               EA++L+  +L  DP++R+      EI +HP   +
Sbjct: 252 EISSEAQDLIARILTVDPEQRI---KTREILKHPLLRK 286

>Scas_640.14*
          Length = 728

 Score =  127 bits (319), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 141/272 (51%), Gaps = 23/272 (8%)

Query: 394 VIGKGSFGKV---------MQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL-AERTVLAR 443
            +G+G FGKV            K  + +K  A+K IR+ +I   SE    +  E   L  
Sbjct: 43  TLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKH 102

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
           + +P IV L+   Q+ + + +VL + +GGE + ++Q++ R   + A    A+L+  +  +
Sbjct: 103 LTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYM 162

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQ 562
           HS  +++RDLK EN+LLD   ++ + DFG       D +   T CG+P Y APEL++  +
Sbjct: 163 HSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTE 222

Query: 563 GY-SKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQEPLRFPD-GFDRE 613
            Y ++  D W+ G++LY ML G  P+ D       ED+ ++Y  I + PL+FP   +   
Sbjct: 223 PYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTF 282

Query: 614 AKNLLIELLCRDPKRRLGYNGADEIKRHPFFS 645
               L  +L  +P RR+    +  IK+H + S
Sbjct: 283 LGICLRHILVSNPVRRM---SSRHIKKHEWLS 311

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  127 bits (319), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 147/291 (50%), Gaps = 38/291 (13%)

Query: 382 KPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 441
           K  SI+D    +V+G G+F  V +  +++T K +A+K I K  +V   +      E  VL
Sbjct: 185 KDFSIND----EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSR--ELEVL 238

Query: 442 ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
            ++++P IV LK  ++     Y+V+ FI+GG+L   +   G       R  + ++L A++
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 502 TLHSLNVIYRDLKPENILLDYQG--HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL 559
            +HS  + +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKV-QGNGSIMKTFCGTLAYVAPEVI 357

Query: 560 LG--------------QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ---- 601
            G                YS +VD W++G L++ +LTG  P+      ++Y++I +    
Sbjct: 358 GGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGSYH 417

Query: 602 ----EPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLS 648
               +  R  D    EA++ +  LL  D  +R+     D+   HP+  Q S
Sbjct: 418 EGPLKDFRISD----EARDFIDGLLQVDQSKRM---TVDDALNHPWIKQCS 461

>Kwal_23.3590
          Length = 499

 Score =  124 bits (311), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 88/296 (29%), Positives = 134/296 (45%), Gaps = 33/296 (11%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           +  +P   D +   K +G G +  V +   KD+  + A+K     +   + +      E 
Sbjct: 176 ANRRPSFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREET 235

Query: 439 TVLARVDNPFIVPLKFSFQSPE-----KLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
            +L  + +  IV L   F  P      + +LVL  ++ GELF  + ++ R          
Sbjct: 236 KILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIF 295

Query: 494 AELLCALETLHSLNVIYRDLKPENILLDYQGH-------------------IALCDFGLC 534
            ++L  L  LH+ N+I+RD+KPENILL  +                     I + DFGL 
Sbjct: 296 KQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLA 355

Query: 535 KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDV-P 593
           K  + +   TNT CGTP Y+APE+L   GY+  VD W+ GVLLY  L G PP+ ++   P
Sbjct: 356 KF-IGEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPP 414

Query: 594 KMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFS 645
            M ++IL     F     D  D    +L+  LL  +P  R       +   HP+FS
Sbjct: 415 SMKEQILNGKFAFYSPYWDDIDDSCLHLISNLLVVNPAYRF---DVQKTINHPWFS 467

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  126 bits (317), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 147/309 (47%), Gaps = 21/309 (6%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 447
           F   +VIG+G FG V +     T ++YA+K +  +   S+ EV     E   LA +   P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+     L++++ +  GG L   L + G+ D         ELL AL+ +H  N
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSLR-SLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-EPLRFPD-GFDREAKNLLIELLCR 624
            VD W+LG+  YE+ TG PPY D +  +  + I++ +P R  +  +  + K  +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 625 DPKRRLGYNGADE------IKRH-----PFFSQLSWKRLWMKGYIPPYKPPVMSALDTSN 673
           DP+ RL    A+E      IK H         +L  + L  +     YK     A D  N
Sbjct: 253 DPQERL---SAEELLKTKFIKTHKATPTTILKELISRYLLFRDKNKSYKDSAYLADDIPN 309

Query: 674 FDQEFTREK 682
              E T E+
Sbjct: 310 AKAELTNEE 318

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  126 bits (317), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 149/283 (52%), Gaps = 27/283 (9%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYI----VSKSEVTHTLA---- 436
           +I  + L + +G GS GKV   +   T +  A+K I K+      VS + +  +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 437 ------ERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRAR 490
                 E  ++  +++P ++ L   +++   LYLVL +   GELF  L + G      A 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 491 FYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGT 550
            +  +++  +   H+L +++RDLKPEN+LLD++ +I + DFG+  L  + +    T CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK-LLETSCGS 193

Query: 551 PEYLAPELLLG---QGYSKVVDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQEPLR 605
           P Y APE++ G   QG++   D W+ GV+L+ +LTG  P+ +ED  +  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 606 FP--DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
            P  D   REA++L+ ++L  DP+RR+      +I +HP   +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRI---KTRDILKHPLLQK 291

>Scas_493.2
          Length = 1117

 Score =  126 bits (317), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 145/281 (51%), Gaps = 23/281 (8%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSK--SEVTHTLA------ 436
           +I  + L + +G GS GKV     + TN+  A+K I KS   +K  S  T  +A      
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77

Query: 437 ------ERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRAR 490
                 E  ++  + +  ++ L   +++   LY++L +   GELF  L ++G      A 
Sbjct: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137

Query: 491 FYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGT 550
            +  +++  +   H+L +++RDLKPEN+LLD++ +I + DFG+  L  +D+    T CG+
Sbjct: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDK-LLETSCGS 196

Query: 551 PEYLAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQEPLRFP 607
           P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +ED  +  +  K+       P
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 608 DG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           D     R+A++L+  +L  DP +R+      EI +HP   +
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRI---KTREILKHPLLQK 294

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  125 bits (315), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 139/273 (50%), Gaps = 30/273 (10%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 441
           S+ D++ ++ +G GS GKV   K + TN++ A+K +    K+++  +  +     E+ VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 442 AR-----------------------VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHL 478
            R                       + +P I  L          Y++  +++GG+L  ++
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 479 QKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
            + G     +AR +   +  AL  LH+ N+++RDLK ENI++     I + DFGL   N+
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS--NI 293

Query: 539 KDQDKT-NTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 596
            D  K  +TFCG+  + APELL    Y+   VD W+ GV+L+ ++ G  P+ DE+   ++
Sbjct: 294 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLH 353

Query: 597 KKILQEPLRFPDGFDREAKNLLIELLCRDPKRR 629
           +KI Q  + +P     E  +LL ++L  DPKRR
Sbjct: 354 EKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 133/267 (49%), Gaps = 25/267 (9%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           + ++ + K IG+GSFGKV     + T +   LK   KS     + V      R    + D
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS---DPNVVREVFYHR----QFD 91

Query: 446 NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHS 505
            P+I  L     +  K+++ L +  G EL+ HL  + R          A++  A+   H+
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHT 151

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
           LN ++RDLK EN+LLD  G+  L DFG  + +M  +    T CGT  Y+APE++  + Y 
Sbjct: 152 LNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 566 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK-------ILQEPLRFPDGFDREAKNL 617
              VD W+LGV+LY +L G  P +DED   + K+       ++ E +  P     EA+NL
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLP-FDEDDDLLTKQKIINDTPVIDERITIP-----EAQNL 264

Query: 618 LIELLCRDPKRRLGYNGADEIKRHPFF 644
           + +LL +DP  R   +    I  HPF 
Sbjct: 265 IEQLLSKDPTERPNTSA---ILLHPFL 288

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 149/289 (51%), Gaps = 18/289 (6%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVM----QVKKKDTNKIYALKAIRKSYIVSKSEVTHT 434
           SK K ++   + +   +G+G FGKV     + +    ++  A+K IR+  +   SE    
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 435 L-AERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
           +  E   L  + +P IV L+   Q+ + + +VL + +GGE + ++QK+ R     A    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 494 AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEY 553
           A+L+  +  +H   + +RDLK EN+LLD   ++ + DFG      K+ D   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKN-DLMRTSCGSPCY 213

Query: 554 LAPELLL-GQGYS-KVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQEPL 604
            APEL++  + YS +  D W+ GV+LY ML G  P+ D       ED+ K+Y+ I    L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 605 RFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLW 653
           +FP+      ++LL  +L  +P+ RL      +I++H +    +   +W
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRL---TVADIEQHAWLQPHAQFLMW 319

>Scas_700.28
          Length = 896

 Score =  123 bits (309), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 131/261 (50%), Gaps = 13/261 (4%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 445
           + ++ +L  IG+GSFGKV   + + T+    LK+       S     + + E     + D
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKS-------SDKNDPNIVREVFYHRQFD 87

Query: 446 NPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHS 505
            P+I  L     +  K+++ L +  G EL+  +    R          A+++  +   HS
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
           LN ++RDLK ENILLD  G   L DFG  +  M  +    T CGT  Y+APEL+  + Y 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECMT-KTTLETICGTTVYMAPELIERKSYD 206

Query: 566 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-QEPLRFPDGFDREAKNLLIELLC 623
              +D W+LGV+LY M+ G  P+ ++D  K   KI+ Q P    +    +AK+L++ LL 
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 624 RDPKRRLGYNGADEIKRHPFF 644
           ++P  R      ++I +HPF 
Sbjct: 267 KNPNDRP---TVEQILKHPFL 284

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  123 bits (308), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 130/260 (50%), Gaps = 10/260 (3%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVDNP 447
           F   +VIG+G FG V +     T ++YA+K +       + E V   +     L ++ N 
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISN- 81

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+     L++++    GG L   L + G+ D         ELL AL+ +H  N
Sbjct: 82  -ITRYYGSYLKDTSLWIIMEHCAGGSLR-SLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  N+L+  +G++ LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-EPLRFPD-GFDREAKNLLIELLCR 624
            VD W+LG+  YE+ TG PPY D +  +  + I++ +P R  D  +    K  +   L  
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 625 DPKRRLGYNGADEIKRHPFF 644
           DPK RL    AD++ +  F 
Sbjct: 260 DPKERL---SADDLLKSKFI 276

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 104/160 (65%), Gaps = 3/160 (1%)

Query: 379 SKNKPL--SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA 436
           S+ KPL  SI D+D++K I KG++G V   +KK T   +A+K +RKS +++K++VT+  +
Sbjct: 770 SQMKPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKS 829

Query: 437 ERTVL-ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAE 495
           ER ++  + D P++  L  +FQ+ + L+LV+ ++ GG+L   L+  G       + Y +E
Sbjct: 830 ERAIMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSE 889

Query: 496 LLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCK 535
           ++  +E +H+  +I+ DLKPEN+L+D  GH+ L DFGL +
Sbjct: 890 IIIGVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSR 929

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 95/173 (54%), Gaps = 21/173 (12%)

Query: 533  LCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDV 592
            L   N +D  +   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 593  PKMYKKILQEPLRFP--DGFDR-------EAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
             ++++ IL+  + +P  D  +        EAK+L+++ L  DP +RLGYNG +EIK HP+
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 644  FSQLSWKRLW--MKGYIPPYKPPVMSALDTSNFD------QEFTREKPVDSVV 688
            F  + W  ++     Y+P  + P     DT  FD      Q+F  +   D+V+
Sbjct: 1209 FKDVKWDHVYDETASYVPNIEDPE----DTDYFDLRGATLQDFGDDNDEDAVL 1257

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 102/155 (65%), Gaps = 1/155 (0%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 443
           SI D+D++K I KG++G V   KK+ T + +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 698 SIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 757

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            D P++  L  +FQ+ E L+LV+ +++GG++   ++  G      A+ Y  E++  ++ +
Sbjct: 758 SDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVISGVDDM 817

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
           H   +I+ DLKP+N+L+D  GHI L DFGL ++ +
Sbjct: 818 HQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  120 bits (302), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 13/250 (5%)

Query: 394 VIGKGSFGKVM---QVKKKDTNKIYALKAIRKSYIVSKSEV-THTLAERTVLARVDNPFI 449
            +G+G FGKV         D +K  A+K IR+  I   SE       E   L  + +P I
Sbjct: 61  TLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNI 120

Query: 450 VPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVI 509
           V L+   Q+ + + +VL + +GGE + ++QK+ R     A    A+L+  +  +H   + 
Sbjct: 121 VTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMHHKGLA 180

Query: 510 YRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGY-SKV 567
           +RDLK EN+LLD   ++ + DFG         D   T CG+P Y APEL++  + Y ++ 
Sbjct: 181 HRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARK 240

Query: 568 VDWWTLGVLLYEMLTGL-------PPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIE 620
            D W+ GV+LY ML G             +D+ K+Y  I +  L+FP+  +   +++L  
Sbjct: 241 ADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFPEYINPIPRDILRR 300

Query: 621 LLCRDPKRRL 630
           +L  DP +R+
Sbjct: 301 ILVSDPSKRI 310

>Scas_201.1*
          Length = 274

 Score =  114 bits (285), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 124/230 (53%), Gaps = 10/230 (4%)

Query: 399 SFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVPLKFSFQ 457
           +FG V Q ++  + +  A+K + K+ +         L  E ++L R+ +P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 458 SPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPEN 517
           S +K Y+V     GGELF  + K+G+F    A     +LL A++ +HS N+++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 518 IL-LD--YQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLG 574
           +L LD   +  + + DFG+ K    + D      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 575 VLLYEMLTGLPPYYDEDVPKMYKKILQE--PLRFP----DGFDREAKNLL 618
           V+ Y +L+G  P+  E V    ++  +   P++F     D    EAK+ +
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDSISDEAKDFI 274

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  118 bits (295), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 122/272 (44%), Gaps = 30/272 (11%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 452
           K +G G +  V +   K T +  A+K           +      E  +L  +++  IV L
Sbjct: 159 KELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKL 218

Query: 453 KFSFQSP-----EKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
              F  P      + YLVL  I  GELF  + ++ +      R    ++L  L+ LH  N
Sbjct: 219 LERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRN 278

Query: 508 VIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDQDKTNTFC 548
           +I+RD+KPENILL  +                     + + DFGL K   + Q  T T C
Sbjct: 279 IIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGEMQ-FTTTLC 337

Query: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDV-PKMYKKILQEPLRFP 607
           GTP Y+A E+L   GY+  VD W+ GVLLY  L G PP+ D+   P M ++ILQ    F 
Sbjct: 338 GTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFY 397

Query: 608 ----DGFDREAKNLLIELLCRDPKRRLGYNGA 635
               D  D    +L+  LL  DP +R     A
Sbjct: 398 SPYWDEIDDSVLHLISNLLVVDPAKRYSVRDA 429

>Kwal_47.17252
          Length = 872

 Score =  120 bits (300), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 145/304 (47%), Gaps = 54/304 (17%)

Query: 383 PLSIDDFDLLKV-IGKGSFGKVMQ---VKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           P+ I D  L++  IGKGSF  V +      +D N   A+KA+ +S + +K  + +   E 
Sbjct: 13  PIMISDKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEI 72

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEG----RFDLSRARF--- 491
            +L ++ +P IV L    ++    +L++ +   G+L F ++K G    +  L R  F   
Sbjct: 73  AILKKIKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKY 132

Query: 492 -----------------YTAELLCALETLHSLNVIYRDLKPENILL-----DYQGH---- 525
                            Y  +L  AL  L S N+++RD+KP+N+LL     +Y       
Sbjct: 133 PPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFH 192

Query: 526 ------------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTL 573
                       + + DFG  +  + +     T CG+P Y+APE+L  Q Y+   D W++
Sbjct: 193 KMGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADLWSV 251

Query: 574 GVLLYEMLTGLPPYYDEDVPKMYKKI--LQEPLRFPD--GFDREAKNLLIELLCRDPKRR 629
           G +LYEM  G PP+   +  +++KKI    + + FP     D + + L+  LL  DP +R
Sbjct: 252 GTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPSQR 311

Query: 630 LGYN 633
           +G+N
Sbjct: 312 MGFN 315

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 98/155 (63%), Gaps = 1/155 (0%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 443
           SI D+D+LK I KG++G V   +KK T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            D P++  L  SFQ+ + L+LV+ ++ GG+L   ++  G      A+ Y  E++  +  +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
           H   +I+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 12/146 (8%)

Query: 540  DQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 598
            D  +   F GTP+YLAPE + G+G  +K  DWW++G + +E+L G PP++ E    ++KK
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 599  ILQEPLRFPDGFDR---------EAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
            IL   +++P+  +          EAK+L+ +LL  DP +RLG  G  EIK HP+F  + W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 650  KRLWMKGYIPPYKPPVMSALDTSNFD 675
              ++ +     + P + +  DT  FD
Sbjct: 1260 DHVYDEE--ASFVPTIDNPEDTDYFD 1283

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 103/160 (64%), Gaps = 1/160 (0%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 443
           SI D+D++K I KG++G V    K+ T + +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 678 SIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQ 737

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            + P++  L  +FQ+ E L+LV+ +++GG+L   ++  G      A+ Y  E++  ++ +
Sbjct: 738 SEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDM 797

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 543
           H   +I+ DLKP+N+L+D  GH+ L DFGL ++ +  + K
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHK 837

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 14/172 (8%)

Query: 540  DQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
            D+D +  F GTP+YL+PE +LG G S   DWW++G +L+E L G PP++   V  ++K I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 600  LQEPLRFP---------DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWK 650
            L   + +P         +    EAK+L+++LL  +P+ RLG NGA EIK HP+F  ++W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 651  RLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGG 702
            +++ +     + P V +  DT  FD    R   +D ++ D   E   Q   G
Sbjct: 1114 KVYDEEA--SFVPTVDNPEDTDYFD---LRGADLDELLRDNYGEDDLQSTSG 1160

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 123/247 (49%), Gaps = 11/247 (4%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 447
           F   +VIG+G FG V +     T ++YA+K +  +    + EV     E   LA +   P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+    KL++++ +  GG L   L + G+ D         +LL AL  +H  N
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSLRT-LLRPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  N+L+  +GH+ LCDFG+         K  T  GTP ++APE+++ G  Y+ 
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIEL--LC- 623
             D W+LG+  YE+ TG PPY D +  +  + I +   + P    R    LL E   LC 
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKS--KPPRLEGRNYSPLLKEFIALCL 259

Query: 624 -RDPKRR 629
             DP+ R
Sbjct: 260 DEDPEER 266

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 142/282 (50%), Gaps = 18/282 (6%)

Query: 379 SKNKPLS-IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA- 436
           S  KP S I  + L + +G GS GKV   + + T    A+K I KS   +    ++  + 
Sbjct: 10  SAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV 69

Query: 437 -------ERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA 489
                  E  ++  + +P ++ L   +++   LYL+L +   GELF  L   G      A
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129

Query: 490 RFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCG 549
                +++  +   H+L +++RDLKPEN+LLD   +I + DFG+  L   D D   T CG
Sbjct: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSCG 188

Query: 550 TPEYLAPELLLGQGYSKVV-DWWTLGVLLYEMLTGLPPYYDE--DVPKMYKKILQEPLRF 606
           +P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  +V  +  K+ +     
Sbjct: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248

Query: 607 PDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           P+     R+A++L+ ++L  DP++R+      +I  HP   +
Sbjct: 249 PNDTEISRDAQDLIGKILVVDPRQRIKIR---DILSHPLLKK 287

>Kwal_26.8751
          Length = 848

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 143/297 (48%), Gaps = 18/297 (6%)

Query: 363 MEKGLGRVNITIDYKP-----SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYAL 417
            E+   + NI+  Y       S N+   + ++ +LK++G+GSFGKV       T++   L
Sbjct: 6   FEQNQLKANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVL 65

Query: 418 KAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFH 477
           K      + SK++  + + E     + D   I  L     +   +++ L +  G EL+ +
Sbjct: 66  K------MGSKND-PNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEY 118

Query: 478 LQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLN 537
           L  +    L       ++++ A+   HS+  ++RDLK ENILLD +GH  L DFG  +  
Sbjct: 119 LLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-E 177

Query: 538 MKDQDKTNTFCGTPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMLTGLPPYYDED-VPKM 595
              +    T CGT  Y+APEL+  + Y    +D W+LG++LY M+ G  P+ + D V   
Sbjct: 178 CATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTK 237

Query: 596 YKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRL 652
           YK +   P    D  D   K L+ +LL +DP +R       ++ +HPF      K L
Sbjct: 238 YKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLT---QVLQHPFLQPYGLKIL 291

>Scas_580.6
          Length = 1015

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 130/262 (49%), Gaps = 14/262 (5%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 447
           F   +VIG+G FG V +     T +IYA+K +  +    + EV     E   L+ +   P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+     L++++ +  GG L   L + G+ D         ELL AL+ +H  N
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSLR-SLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIEL--LC- 623
            VD W+LG+  YE+ TG PPY + +  +  + I +   + P    R    LL E   LC 
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKS--KPPRLESRSYTPLLKEFIALCL 271

Query: 624 -RDPKRRLGYNGADEIKRHPFF 644
             DPK RL    A+E+ +  F 
Sbjct: 272 DEDPKERL---SAEELSKTKFI 290

>YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinase
           kinase (MEK) activated by high osmolarity through the
           Sln1p-Ypd1p-Ssk1p two-component osmosensor and the Sho1p
           osmosensor [2007 bp, 668 aa]
          Length = 668

 Score =  117 bits (292), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 149/313 (47%), Gaps = 22/313 (7%)

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           LN    L   +  ID+    +  +++D+ + L  +G G++G V +V  K TN I A K +
Sbjct: 332 LNFAGKLSLSSKGIDFSNGSSSRITLDELEFLDELGHGNYGNVSKVLHKPTNVIMATKEV 391

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGEL---FFH 477
           R    + +++    L E  VL + ++P+IV    +F     +Y+ + +++GG L   +  
Sbjct: 392 RLE--LDEAKFRQILMELEVLHKCNSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDE 449

Query: 478 LQKEGRFDLSRARFYTAELLCALETL-HSLNVIYRDLKPENILLDY-QGHIALCDFGLCK 535
             + G  D  +  F    ++  L+ L    N+I+RD+KP NIL    QG + LCDFG+  
Sbjct: 450 SSEIGGIDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTVKLCDFGVSG 509

Query: 536 LNMKDQDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLTGLPPY--- 587
             +    KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY   
Sbjct: 510 NLVASLAKTNIGCQS--YMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPPE 567

Query: 588 -YDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFS 645
            YD    ++   +   P R P D F  +A++ +   L + P+RR  Y    E   HP+  
Sbjct: 568 TYDNIFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYAALTE---HPWLV 624

Query: 646 QLSWKRLWMKGYI 658
           +   + + M  YI
Sbjct: 625 KYRNQDVHMSEYI 637

>Scas_707.36
          Length = 915

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 155/326 (47%), Gaps = 58/326 (17%)

Query: 372 ITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI----RKSYIV- 426
           I++ Y P  +K   ++ ++++K +G G  GKV   K    N++ A+K +    +K+Y   
Sbjct: 77  ISLSYDPV-SKTQILNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 427 -SKSEVTHTLAERTVLARVDNPFIVPLKFSFQ--SPEKLYLVLAFINGGELFF----HLQ 479
             +++      E  ++ + +N  +V L       S  K+YLVL +   G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 480 KEGR----FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC- 534
            + R        RAR    +++  LE LHS  +I+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 535 ----KLNMKDQD-KTNTFCGTPEYLAPELLLGQG-----------------YSKVVDWWT 572
                ++  D + +     GTP + APE+ LG                    S  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 573 LGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP------DGFDRE---------AKNL 617
           LG+ LY +L G+ P+  E   K+++KI+ E LRFP      D    E         AK+L
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREFVHAKDL 375

Query: 618 LIELLCRDPKRRLGYNGADEIKRHPF 643
           L +LL ++P +R+      +IK HPF
Sbjct: 376 LNKLLEKNPAKRISI---PDIKVHPF 398

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 150/313 (47%), Gaps = 22/313 (7%)

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           LN    L   +  ID+    +  +++D+   ++ +G G++G V +V  K  N + A+K +
Sbjct: 341 LNFAGKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEV 400

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGEL---FFH 477
           R    + +S+    L E  VL + ++PFIV    +F     +Y+ + +++GG L   +  
Sbjct: 401 R--LELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDE 458

Query: 478 LQKEGRFDLSRARFYTAELLCALETLHSL-NVIYRDLKPENILLDY-QGHIALCDFGLCK 535
             + G  D  +  F T  ++  L  L  + NVI+RD+KP NIL    QG + LCDFG+  
Sbjct: 459 NPEMGGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSG 518

Query: 536 LNMKDQDKTNTFCGTPEYLAPELLLGQG-----YSKVVDWWTLGVLLYEMLTGLPPYYDE 590
             +    KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY  E
Sbjct: 519 NLVASLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPE 576

Query: 591 DVPKMYKKILQ----EPLRFP-DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFS 645
               ++ ++       P + P D F  EA++ +   L + P RR  Y+    +  HP+ +
Sbjct: 577 TFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNYS---NLYEHPWLA 633

Query: 646 QLSWKRLWMKGYI 658
           +     + M  YI
Sbjct: 634 KYRSIDVQMGPYI 646

>Kwal_14.1159
          Length = 1521

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 102/155 (65%), Gaps = 1/155 (0%)

Query: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 443
           SI D+D++K I KG++G V   K++ T + +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 673 SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 732

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETL 503
            + P++  L  +FQ+   L+LV+ +++GG+L   ++  G       + Y +E++  +E +
Sbjct: 733 SNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVEDM 792

Query: 504 HSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNM 538
           H   +I+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 793 HQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 9/120 (7%)

Query: 543  KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE 602
            K   F GTP+YLAPE + G G +   DWW++G +L+E + G PP++   V +++  IL  
Sbjct: 954  KNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAG 1013

Query: 603  PLRFPDGFDR---------EAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLW 653
             + +P   D          EA++L+ +LL  DP +RLG NGA+EI  HP+F  + W+ L+
Sbjct: 1014 NIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLY 1073

>Scas_673.20*
          Length = 758

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 128/265 (48%), Gaps = 28/265 (10%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 451
           LK IG+G+ G V    +  T+   A+K I    +  +  +     E  VL    +P I+ 
Sbjct: 484 LKRIGEGASGIVYTAYEIGTDISVAIKQID---LKIQPRLQMIWTEMLVLKEYQHPNIIN 540

Query: 452 LKFSFQSPEKLYLVLAFINGGEL-----FFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
              S+   + L++V+ +++GG L     FF   +E    + R      E L  L  LHS 
Sbjct: 541 FINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFLHSR 594

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSK 566
            +++RD+K +NILL   G I + DFG C    +   K  T  GTP ++APE++  + Y  
Sbjct: 595 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDED-VPKMY------KKILQEPLRFPDGFDREAKNLLI 619
            VD W+LG+++ EM+ G PPY  E  V  +Y      K IL+EP +         KN + 
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKEPEKVGPVL----KNFMD 710

Query: 620 ELLCRDPKRRLGYNGADEIKRHPFF 644
           E L  DP+ RL      ++ +H F 
Sbjct: 711 ECLRVDPEARL---STPQLLKHEFI 732

>Kwal_56.23717
          Length = 858

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 120/237 (50%), Gaps = 26/237 (10%)

Query: 462 LYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLD 521
            Y++  +++GG+L  ++ + G      AR +   +  AL+ LH  N+++RDLK ENI++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 522 YQGHIALCDFGLCKL-NMKDQDKTNTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYE 579
             G I + DFGL  + N K Q   +TFCG+  + APELL    Y+   VD W+ GV+L+ 
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQ--LHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 580 MLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIK 639
           ++ G  P+ DE+   +++KI Q  + +P     E  +LL ++L  DP +R       ++ 
Sbjct: 126 LVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---QVV 182

Query: 640 RHPFFSQLSWKRLWMK--------GYIPPYKPPVMSALDTSNFDQEFTREKPVDSVV 688
            H           WM+         YIP   P    ALD +   +E  R + +D VV
Sbjct: 183 NH----------QWMQRGYDFPAPSYIPHRVPLTADALDATVI-KEMYRLEFIDDVV 228

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  113 bits (283), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 144/285 (50%), Gaps = 35/285 (12%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKK-DTNKIYALKAIR---------KSYIVSKSEVTHTL 435
           I D +L   IG+GSFG V   + K D++ + A+K +              VS+  V H+ 
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 436 AER--TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYT 493
             +   VL  +D              E L+++L   +GG+LF  ++ +   D   A+FY 
Sbjct: 71  CSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYF 121

Query: 494 AELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC----G 549
            +L+ AL  LH + V +RD+KPENILLD +G++ L DFGL     + +D T        G
Sbjct: 122 QQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS-QFRRKDGTLRVSTDQRG 180

Query: 550 TPEYLAPELLLGQG-YSKVVDWWTLGVLLYEMLTG-----LPPYYDEDVPKMYKKILQEP 603
           +P Y+APE+L  QG Y+ + D W+ GVLL+ +LTG     +P   D++         +  
Sbjct: 181 SPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVS 240

Query: 604 LRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLS 648
           L   +  +    NLL ++L  DP++R+     ++++ HP+ +  S
Sbjct: 241 LGPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWLTSRS 282

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 122/223 (54%), Gaps = 11/223 (4%)

Query: 367 LGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIV 426
           + RVN+T    P++        + L +VIGKG++G V +   + T+++ A+KAI      
Sbjct: 1   MHRVNVT----PAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE 56

Query: 427 SKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDL 486
              E    +    +L  + +  IV      QS  +LY++L +   G L   ++KE   + 
Sbjct: 57  ELHEHMLEI---DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEALSE- 112

Query: 487 SRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT 546
           ++A+ Y  + L  L+ LH   VI+RD+K  N+LL   G + L DFG+   + +  +   T
Sbjct: 113 AKAKTYVRQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMT 169

Query: 547 FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYD 589
           + G+P ++APE++LG+G S V D W+LG  + E+LTG PP+Y+
Sbjct: 170 YAGSPNWMAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYN 212

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 141/290 (48%), Gaps = 51/290 (17%)

Query: 393 KVIGKGSFGKVMQVK-KKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 451
           K IGKGSF  V +     D     A+KA+ +S + +K  + +   E  +L ++ +P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFD----------------------LSRA 489
           L    ++    YLV+ +   G+L F ++K    +                      L+RA
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 490 RF--YTAELLCALETLHSLNVIYRDLKPENILL-----DYQ--------GHIAL------ 528
               Y  +L  AL+ L S N+++RD+KP+N+LL     +Y+        G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 529 --CDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 586
              DFG  +  +       T CG+P Y+APE+L  Q Y+   D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 587 YYDEDVPKMYKKI--LQEPLRFPDGFDRE--AKNLLIELLCRDPKRRLGY 632
           +   +  +++KKI    + + FP+  + E   K L+  LL  DP +R+G+
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGF 303

>Scas_713.7
          Length = 983

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 136/269 (50%), Gaps = 15/269 (5%)

Query: 378 PSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAE 437
           P+KNK +    + L +VIGKGS+G V +   K T +I A+K +      +  E+   + E
Sbjct: 18  PNKNKSVQ---YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 438 RTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGEL--FFHLQKEGRFDLSRARFYTAE 495
             +L  +++  IV      Q    LY++L F + G L       K+G  +L  A+ Y  +
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQ 130

Query: 496 LLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLA 555
            L  L  LH   VI+RD+K  N+LLD    + L DFG+   + K  +   T  G+  +++
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMS 187

Query: 556 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAK 615
           PE++  +G S + D W+LG  + E++TG PP+Y      +Y  I  +P   P+    EAK
Sbjct: 188 PEIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAK 247

Query: 616 NLLIELLCRDPKRRLGYNGADEIKRHPFF 644
           + L +   ++  +R     A ++ +HP+ 
Sbjct: 248 DFLKKCFQKNMYKR---PTAKKLLKHPWL 273

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-DNP 447
           F   ++IG+G FG V +     T ++YA+K +      ++ EV     E   L+ +   P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEIQFLSSLKQTP 73

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+    KL++++ +  GG L   L + G  +         E+L AL ++H  N
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSLRT-LLRPGIIEEKYIGVIMREILVALISIHRDN 132

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  NIL+   G + LCDFG+     +   K  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 567 VVDWWTLGVLLYEMLTGLPPY-YDEDVPKMYKKILQEPLRFPDG--FDREAKNLLIELLC 623
            VD W+LG+  YE+ TG PPY + E +  M      +P R  +G  + +  K  +   L 
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRL-EGREYSQPLKEFIALCLD 251

Query: 624 RDPKRR 629
            DPK R
Sbjct: 252 EDPKER 257

>Scas_707.3
          Length = 1598

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 102/166 (61%), Gaps = 1/166 (0%)

Query: 379 SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 438
           +KN   +I D+ +LK I KG++G V   +KK T   +A+K ++KS +++K++VT+  +ER
Sbjct: 689 TKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSER 748

Query: 439 TVL-ARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELL 497
            ++  + D P++  L  +FQ+ E L+LV+ ++ GG+L   ++  G       + Y  E++
Sbjct: 749 AIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEII 808

Query: 498 CALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 543
             ++ +H   +I+ DLKP+N+L+D  GH+ L DFGL +  +  + K
Sbjct: 809 VGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHK 854

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 89/157 (56%), Gaps = 15/157 (9%)

Query: 529  CDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYY 588
             D  L   +   QDK   F GTP+YLAPE + G G     DWW++G +++E+L G PP++
Sbjct: 989  SDLALFHPDDSKQDKK--FFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFH 1046

Query: 589  DEDVPKMYKKILQEPLRFPDGFDR----------EAKNLLIELLCRDPKRRLGYNGADEI 638
                  +++KIL   + +P  FD           EAK+L+++LL  DP +RLG NGADEI
Sbjct: 1047 TNTPEGVFRKILSGKIEWPQ-FDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEI 1105

Query: 639  KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFD 675
            K+HP+F  ++W  ++ +     + P V +  DT  FD
Sbjct: 1106 KQHPYFKDVNWDHVYDEEA--SFVPTVENPEDTDYFD 1140

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 88/149 (59%), Gaps = 11/149 (7%)

Query: 536 LNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM 595
           L++ + +++  F GTP+YLAPE + G G S   DWW++G + +E L G PP++   V ++
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 596 YKKILQEPLRFPDGFDRE---------AKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           ++ I+   +R+P+  D E         AK+L+I+LL  DP +RLG +G+ EIK HP+F  
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 647 LSWKRLWMKGYIPPYKPPVMSALDTSNFD 675
           + W  ++ +   P + P V    DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  110 bits (274), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 140/306 (45%), Gaps = 50/306 (16%)

Query: 371 NITIDYKPSKNK---PLSIDDFDLLKVIGKGSFGKVMQVK--KKDTNKIYALKAIRKSYI 425
           N + DY  S ++    L + ++ LL  IG+G+F +V +      D     A+KAI K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 426 VS--------------KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFING 471
            S              + +V + +A   ++++ +NP         +S    YLV   + G
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSK-NNPHCTKFIAFQESANYYYLVTELVTG 218

Query: 472 GELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILL----------D 521
           GE+F  + +   F    AR    ++  A++ +H + +++RD+KPEN+L           D
Sbjct: 219 GEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGD 278

Query: 522 YQGH--------------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKV 567
            Q                + L DFGL K    +  KT   CGT EY+A E+   + YS  
Sbjct: 279 MQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYSMK 336

Query: 568 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAKNLLIELLC 623
           VD W++G +L+ +L G PP+Y+++   + KKI +    F     D     AKN +  LL 
Sbjct: 337 VDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLE 396

Query: 624 RDPKRR 629
            DP +R
Sbjct: 397 VDPNKR 402

>Kwal_55.21545
          Length = 865

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 447
           F   +VIG+G FG V +     T ++ A+K +  +   +  EV     E   L+ +   P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507
            I     S+ +  KL++++ +  GG L   L + G+           ELL AL  +H   
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSLRT-LLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL-GQGYSK 566
           VI+RD+K  N+L+   GHI LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-EPLRFPDGFDREAKNLLIEL-LCR 624
            VD W+LG+  YE+ TG PPY + +  +  + I + +P R        A   +I L L  
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 625 DPKRR 629
           DPK R
Sbjct: 256 DPKER 260

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  110 bits (276), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 128/259 (49%), Gaps = 10/259 (3%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           + L +VIG+G++G V +  K+ TNK  A+K I       +SE+   + E  +L  + +  
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNV 508
           IV  +   Q   +LY++L +   G L   + K G         Y  + L  L+ LH   V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLR-DILKHGPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 509 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVV 568
           I+RD+K  N+LL  +G + L DFG+   + +      T+ G+P ++APE++ GQG S V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 569 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKR 628
           D W+LG  + E+LTG PP+++         I+ E    P     E K+ L     ++  +
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFLSRCFQKNMFK 242

Query: 629 RLGYNGADEIKRHPFFSQL 647
           R     A E+  H +  ++
Sbjct: 243 R---ATAQELLAHIWLKKI 258

>Scas_685.24
          Length = 515

 Score =  109 bits (273), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 143/281 (50%), Gaps = 18/281 (6%)

Query: 370 VNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKS 429
           ++I  +Y P  +K     ++ + + +G+G+FG V +   + TNK+ A+K +    + + +
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 430 EVTHTLAERTV-LARVDNPFIVPLKFSFQSPEKLYLVLAFINGG---ELFFHLQKEGRFD 485
           E    LA+    LA + +P+I+    +      +++V+ +  GG   +L  +    G   
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNG-LP 118

Query: 486 LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
             +  + T E+L  L+ LH    I+RD+K  NILL  +GH+ L DFG+    +K   +  
Sbjct: 119 EKKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRG 177

Query: 546 TFCGTPEYLAPELLLG--QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEP 603
           T  GTP ++APE+     +GY + +D W+LG+ ++E+L G+PP    D  ++   + ++ 
Sbjct: 178 TIVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKS 237

Query: 604 L-RFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
             R    +   AK+ +   L ++P  R     A ++ + PF
Sbjct: 238 APRLQGAYSDAAKSFVALCLIKNPNER---PAAVDLLKFPF 275

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 125/273 (45%), Gaps = 24/273 (8%)

Query: 395  IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-VLARVDNPFIVPLK 453
            IG GSFG V      DT  I A+K I+     S  ++  +L E   V+  +++P IV   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 454  FSFQSPEKLYLVLAFINGGELFFHLQKEGRF-DLSRARFYTAELLCALETLHSLNVIYRD 512
                  +K+ + + F  G  L   L + GR  D    + YT +LL  L  LH   V++RD
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSLA-SLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRD 1383

Query: 513  LKPENILLDYQGHIALCDFGLCKLNMKDQDKT------------NTFCGTPEYLAPELLL 560
            +KPENILLD  G I   DFG  KL  K+  K                 GTP Y+APE + 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 561  GQGYSKVV--DWWTLGVLLYEMLTGLPPY--YDEDVPKMYKKILQEPLRFP--DGFDREA 614
            GQG+ K    D W+LG ++ EM+TG  P+   D +   MY        +FP         
Sbjct: 1444 GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSAG 1503

Query: 615  KNLLIELLCRDPKRRLGYNGADEIKRHPFFSQL 647
            +  +   L +D  +R     A E+   P+ SQ+
Sbjct: 1504 RKFISRCLIQDANKRA---TAMELLLDPWISQI 1533

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 137/298 (45%), Gaps = 50/298 (16%)

Query: 384 LSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 443
           L  +++ + K IGKGSF  V +       +  A+KA+ +S + +K  + +   E  +L +
Sbjct: 16  LPTENYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKK 75

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARF------------ 491
           + +P IV L    ++    YL++ +   G+L F ++K     L                 
Sbjct: 76  IKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPST 135

Query: 492 ------------YTAELLCALETLHSLNVIYRDLKPENI-----LLDYQG----H----- 525
                       Y  +L  AL+ L S N+++RD+KP+N+     LLDY      H     
Sbjct: 136 EHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFV 195

Query: 526 -------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 578
                  + + DFG  +  + +     T CG+P Y+APE+L  Q Y+   D W++G +LY
Sbjct: 196 GIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLY 254

Query: 579 EMLTGLPPYYDEDVPKMYKKI--LQEPLRFPDGFDREAK--NLLIELLCRDPKRRLGY 632
           EM  G PP+   +  ++++KI    + +  P     E K  NL+  LL  DP  R+G+
Sbjct: 255 EMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGF 312

>Scas_582.1
          Length = 638

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 150/313 (47%), Gaps = 22/313 (7%)

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           LN    L   +  ID+    +  +++ + + ++ +G G++G V +V  K TN I A+K +
Sbjct: 302 LNFAGKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTNVIMAMKEV 361

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGEL--FFHL 478
           +    + +++    L E  VL +  +P+IV    +F     +Y+ + +++GG L   +  
Sbjct: 362 KLE--LDEAKFRQILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDQ 419

Query: 479 QKE-GRFDLSRARFYTAELLCALETLHSL-NVIYRDLKPENILLDY-QGHIALCDFGLCK 535
             E G  D  +       ++  L+ L  + ++I+RD+KP NIL    QG I LCDFG+  
Sbjct: 420 DPEIGGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDVKPTNILCSAKQGTIKLCDFGVSG 479

Query: 536 LNMKDQDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMLTGLPPYYDE 590
             +    KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY  E
Sbjct: 480 NLVASMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMALGRYPYPPE 537

Query: 591 DVPKMYKKILQ----EPLRFPDG-FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFS 645
               ++ ++       P + P G F +EA++ +   L + P+RRL Y    E   HP+  
Sbjct: 538 TFDNIFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRLNYTALLE---HPWLV 594

Query: 646 QLSWKRLWMKGYI 658
           +     + M  Y+
Sbjct: 595 KYRDVDVGMSEYL 607

>Scas_573.10
          Length = 569

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 90/314 (28%), Positives = 137/314 (43%), Gaps = 70/314 (22%)

Query: 384 LSIDDFDLLKVIGKGSFGKVMQVKKK---------DTNKIYALKAIRKSYIVS---KSEV 431
           + +  + L++ +G+G+F KV +   +         +  K  A+K I+K+ +V    K+++
Sbjct: 114 VELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKADI 173

Query: 432 ----------THTLAERTVLARVD--------NPFIVPLKFSFQSPEKLYLVLAFINGGE 473
                     + T ++  VL  V          P IV      +S    Y+V   I+GGE
Sbjct: 174 HVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELIHGGE 233

Query: 474 LFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHI------- 526
           +F  + K   F    +R    +L  A++ LHSL V++RD+KPEN+L +    I       
Sbjct: 234 IFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKEPKL 293

Query: 527 ---------------------------ALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL 559
                                       L DFGL K        T T CGT  Y APE++
Sbjct: 294 RKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATN--TKTPCGTVGYTAPEVV 351

Query: 560 LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAK 615
             + YS  VD W +G +LY ML G PP+YDE +  + +KI +    F     D     AK
Sbjct: 352 KDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISAGAK 411

Query: 616 NLLIELLCRDPKRR 629
           N +I LL  DP +R
Sbjct: 412 NAVIRLLEVDPNKR 425

>Kwal_27.9763
          Length = 868

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 121/224 (54%), Gaps = 14/224 (6%)

Query: 369 RVNITIDYKPSKNKPLS---IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYI 425
           +VN+T    P++  P +      + L +V+GKG++G V +   + T+K  A+K I     
Sbjct: 4   KVNLT----PAQKVPSTGSNTHHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD-- 57

Query: 426 VSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFD 485
             +    H L E  +L  + +  IV      Q   +L+++L + + G L   L K G  +
Sbjct: 58  EEEELNEHML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSLR-DLIKRGPVE 115

Query: 486 LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
             + + Y  + L  L+ LH   VI+RD+K  N+LLD Q  + L DFG+   + +  +   
Sbjct: 116 EQQCKTYIRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAM 172

Query: 546 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYD 589
           T+ G+P ++APE+++GQG S V D W+LG  + E+LTG PP+++
Sbjct: 173 TYAGSPNWMAPEVMMGQGASTVSDIWSLGATVVEILTGNPPFHN 216

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  108 bits (271), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 144/310 (46%), Gaps = 53/310 (17%)

Query: 375 DYKPSKNKPL--SIDDFDLLKVIGKGSFGKVMQVK-KKDTNKIYALKAIRKSYIVSKSEV 431
           D+  S N  L  S  ++   K IGKGSF  V +     D ++  A+K + ++ + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 432 THTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK----------- 480
            +   E  +L ++ +P IV L    ++    YL++ +   G+L F L++           
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 481 -----------EGRFDLSRARF--YTAELLCALETLHSLNVIYRDLKPENILLD-----Y 522
                      E    L RA    Y  +L  AL+ L S N+++RD+KP+N+LL      Y
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 523 QGH----------------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSK 566
                              + + DFG  +  + +     T CG+P Y+APE+L  Q Y+ 
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI--LQEPLRFPD--GFDREAKNLLIELL 622
             D W++G +++EM  G PP+   +  +++KKI    + + FP     + E K L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 623 CRDPKRRLGY 632
             DP +R+G+
Sbjct: 307 TFDPAQRIGF 316

>Kwal_26.7355
          Length = 1446

 Score =  109 bits (272), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 141/282 (50%), Gaps = 22/282 (7%)

Query: 379  SKNKPLSIDDFDLLK--VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTL- 435
            SKN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E T ++ 
Sbjct: 1134 SKNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVL 1193

Query: 436  ----AERTVLARVDNPFIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEGRFDLSRAR 490
                +E   L  +D+  IV     F++   +Y L L ++ GG +   ++  G+FD +  R
Sbjct: 1194 EALRSEVATLKDLDHTNIVQY-LGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIR 1252

Query: 491  FYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN-TFCG 549
            F   ++L  L  LHS  +++RD+K +N+LLD  G   + DFG+ K +      ++ T  G
Sbjct: 1253 FLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRG 1312

Query: 550  TPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQEPLR 605
            T  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M+K  K    P  
Sbjct: 1313 TVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPP- 1371

Query: 606  FPDGFDR----EAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
             P+   +    E K  L      +P++R     ADE+  HPF
Sbjct: 1372 IPEDTQKIISAEGKEFLDACFEINPEKRP---TADELLSHPF 1410

>Kwal_0.155
          Length = 587

 Score =  107 bits (267), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 135/302 (44%), Gaps = 58/302 (19%)

Query: 384 LSIDDFDLLKVIGKGSFGKVMQ-VKKKDTNKIY--------ALKAIRKSYIVS-----KS 429
           L + D+ L+  IG+G+F KV + V ++ ++K +        A+K I K ++ S     KS
Sbjct: 152 LELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKS 211

Query: 430 EVT---HTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLA-FINGGELFFHLQKEGRFD 485
           + T     L E  +   V     V     FQ     Y ++   + GGE+F  + +   F 
Sbjct: 212 KATSREQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFS 271

Query: 486 LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGH-------------------- 525
              +R    +L  A++ +H++ +++RD+KPEN+L ++  +                    
Sbjct: 272 EDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDE 331

Query: 526 --------------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWW 571
                         + L DFGL K        T T CGT  Y APE++  + YS  VD W
Sbjct: 332 GIFRPGIGGGGIGTVKLADFGLSKQIYSTN--TKTPCGTVGYTAPEVVKDERYSMQVDMW 389

Query: 572 TLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPK 627
            +G +LY +L G PP+YDE +  + +KI +    F     D     AKN +  LL  DP 
Sbjct: 390 GIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVDPS 449

Query: 628 RR 629
           +R
Sbjct: 450 KR 451

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  106 bits (264), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 123/246 (50%), Gaps = 8/246 (3%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           + +   IG+G+FG V +   + T +I A+K +   +  S  ++     E   LA + +P 
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH--SDEDIELLAQEIFFLAELKSPL 75

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDL--SRARFYTAELLCALETLHSL 506
           I     +      +++V+ +  GG     L++     L   +  F   E+   L+ LH  
Sbjct: 76  ITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQ 135

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ--GY 564
             I+RD+K  NILL+ +G + L DFG+   +++   K +TF GTP ++APE++  +  GY
Sbjct: 136 RKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDGY 194

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDREAKNLLIELLC 623
           ++  D W+LG+  YE+L GLPP    D  K+   +  ++P +    F   AK+ +   L 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLV 254

Query: 624 RDPKRR 629
           + P  R
Sbjct: 255 KTPADR 260

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  108 bits (269), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 150/306 (49%), Gaps = 53/306 (17%)

Query: 379 SKNKPLSI--DDFDLLKVIGKGSFGKVMQVKKKDTNK-IYALKAIRKSYIVSKSEVTHTL 435
           S  +P++I  + + + K IG+GSF  V +    D++    A+KA+ +S + +K  + +  
Sbjct: 6   SGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLE 65

Query: 436 AERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKE----GRFDLSRARF 491
            E  +L ++ +P IV L    ++    YL++ +   G+L F ++K      +  L R  F
Sbjct: 66  IEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLF 125

Query: 492 --------------------YTAELLCALETLHSLNVIYRDLKPENILL-----DY---- 522
                               Y  +L  AL+ L S N+++RD+KP+N+LL     DY    
Sbjct: 126 EKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPA 185

Query: 523 ----QGHIAL--------CDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDW 570
               +G + +         DFG  +  + +     T CG+P Y+APE+L  Q Y+   D 
Sbjct: 186 EFHARGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADL 244

Query: 571 WTLGVLLYEMLTGLPPYYDEDVPKMYKKI--LQEPLRFPDGFDREAK--NLLIELLCRDP 626
           W++G +LYEM  G PP+   +  ++++KI    + ++FP     E+   +L+  LL  +P
Sbjct: 245 WSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEP 304

Query: 627 KRRLGY 632
            +R+G+
Sbjct: 305 AKRMGF 310

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score =  107 bits (266), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 135/277 (48%), Gaps = 21/277 (7%)

Query: 396 GKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS 455
           G G++G V +V  K T+ I A+K +R    + +S+    L E  VL    +P+IV    +
Sbjct: 425 GHGNYGNVSKVLHKPTHIIMAMKEVR--LELDESKFRQILMELEVLHNCQSPYIVDFYGA 482

Query: 456 FQSPEKLYLVLAFINGGEL--FFHLQKEGRFDLSRARFYTAELLCALETLHSL-NVIYRD 512
           F     +Y+ + +++GG L   +  ++ G  D  +    T+ ++  L+ L  + N+I+RD
Sbjct: 483 FFIEGAVYMCMEYMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHNIIHRD 542

Query: 513 LKPENILLDY-QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLG-----QGYSK 566
           +KP NIL    QG I LCDFG+    +    KTN  C +  Y+APE +         YS 
Sbjct: 543 VKPTNILCSASQGTIKLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSLNPDKSTYSV 600

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ----EPLRFPDG-FDREAKNLLIEL 621
             D W+LG+ + EM  G  PY  E    ++ ++       P + P+G F  +A+N +   
Sbjct: 601 QSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMC 660

Query: 622 LCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYI 658
           L + P+RR  Y    E   HP+  +     + M  YI
Sbjct: 661 LQKIPERRPTYAALLE---HPWLKKYENVDVRMSEYI 694

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 98/204 (48%), Gaps = 13/204 (6%)

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKE-------GRFDLSRARFYTAELLCALETLH 504
           L+   ++ + L++V+ ++ GG L   ++               +  +   E    L+ LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
             N+I+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIEL 621
              VD W+LG++  EML G PPY +ED  K    I       L+ P     E K  L   
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 622 LCRDPKRRLGYNGADEIKRHPFFS 645
           LC D K R      +E+  H FF+
Sbjct: 825 LCVDVKYRA---STEELLHHSFFN 845

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 27/268 (10%)

Query: 384 LSIDDFDLLKVIGKGSFGKVMQVK-----------KKDTNKIYALKAIRKSYIVSKSEVT 432
           LS+  F LL+ +GKG+FG V               K   N   A+K I   +  S   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 433 HTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFY 492
             L E   L+ +  P+I     +F     LY+V+ + + G L   L+   R       F 
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 493 TAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC---KLNMKDQ--DKTNTF 547
             ++  ALE LH   +I+RDLK  NILL+  G + L D G+    K N         NTF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 548 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP 607
            GTP ++APE++  Q Y    D W+LG+   E+L G PP    D  K   +I   P    
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPMSHLDSMKALMRI---PKLNA 236

Query: 608 DGFDRE------AKNLLIELLCRDPKRR 629
           D   R        K+ +   L +DP +R
Sbjct: 237 DSILRNMDISPLGKDFIRSCLQQDPNQR 264

>Scas_675.2
          Length = 527

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 140/276 (50%), Gaps = 20/276 (7%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVK-KKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444
           I D  L   IG+GSFG VM      D + I A+K +       K+ +T     R VL   
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 445 ---DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALE 501
               NP ++ L     + + +++++   +GG+LF  ++ +   D   A+FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 502 TLHS-LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC----GTPEYLAP 556
            LH    V +RD+KPENILLD  G++ L DFGL     + +D T        G+P Y+AP
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSS-QYRRKDGTLRISTDQRGSPPYMAP 189

Query: 557 ELLLGQG-YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM-YKKILQEPLRFPDG----F 610
           E+L  +G Y+   D W++G+LL+ +LTG  P+    + ++ +   LQ       G     
Sbjct: 190 EILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFASFLQNNGNLNLGPWAKI 249

Query: 611 DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
           +    NLL ++L  DPK+R        ++ HP+F++
Sbjct: 250 EFFHLNLLRKILQPDPKKRATLK---ILRSHPWFTK 282

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 133/277 (48%), Gaps = 21/277 (7%)

Query: 396 GKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS 455
           G G++G V +V  K TN + A+K +R    + +S+    L E  VL +  +P+IV    +
Sbjct: 384 GHGNYGTVSKVLHKPTNIMMAMKEVRLE--LDESKFRQILMELEVLHKCQSPYIVDFYGA 441

Query: 456 FQSPEKLYLVLAFINGGEL--FFHLQKEGRFDLSRARFYTAELLCALETLHSL-NVIYRD 512
           F     +Y+ + F++GG L   +   + G  +  +    T  ++  L+ L  + N+I+RD
Sbjct: 442 FFIEGAVYMCMEFMDGGSLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRD 501

Query: 513 LKPENILLDY-QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLG-----QGYSK 566
           +KP NIL    QG + LCDFG+    +    +TN  C +  Y+APE +         YS 
Sbjct: 502 VKPTNILCSATQGTVKLCDFGVSGNLVASLARTNIGCQS--YMAPERIKSLNPDKATYSV 559

Query: 567 VVDWWTLGVLLYEMLTGLPPY----YDEDVPKMYKKILQEPLRFP-DGFDREAKNLLIEL 621
             D W+LG+ + EM  G  PY    YD    ++   +   P R P D F  +A++ +   
Sbjct: 560 QSDIWSLGLSIVEMALGAYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLC 619

Query: 622 LCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYI 658
           L + P+RR  Y    E   HP+  +     + M  YI
Sbjct: 620 LQKIPERRPTYASLLE---HPWLKKYRGLDVHMSEYI 653

>Kwal_27.9773
          Length = 406

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/285 (29%), Positives = 136/285 (47%), Gaps = 45/285 (15%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +++ +L+ IG+GSFG V +V    TN++   K I+  ++ SK E    ++E  +L+++ +
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGEL---FFHLQKEGRFDLSRA-------------R 490
             IV         + LY  + + + G+L     H +KE ++   R              R
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 491 FYTAELLCALETLH---------SLNVIYRDLKPENILL---------------DYQG-H 525
            +    L  LET++         S  VI+RDLKP NI L               DY    
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 526 IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLP 585
           + L DFGL K      +   T+ GTP Y++PE+L+ Q YS + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 586 PYYDEDVPKMYKKILQEPL-RFPDGFDREAKNLLIELLCRDPKRR 629
           P+  +   ++ ++I      R PD +  E + +LIE  C DP  R
Sbjct: 256 PFQAKTYTELQRRIKTAKFDRIPDYYSDELQ-MLIE-SCIDPNLR 298

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 122/246 (49%), Gaps = 8/246 (3%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           F +   IG+G+FG V + K    N++ A+K +      S+ EV     E   LA + +P+
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN--SEEEVELLAQEIFFLAELKSPY 62

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDL--SRARFYTAELLCALETLHSL 506
           +     +      +++ + +  GG +   L+      L   + RF T E+L  L  LHS 
Sbjct: 63  VTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQ 122

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL--GQGY 564
             I+RD+K  NILL  +G + L DFG+    +    + +TF GTP ++APE++    +GY
Sbjct: 123 RKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDSEGY 181

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDREAKNLLIELLC 623
            +  D W+LG+ + EML G PP    D  K+   +  ++P +    F  +AK+ +   L 
Sbjct: 182 DERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLI 241

Query: 624 RDPKRR 629
           ++   R
Sbjct: 242 KESAIR 247

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 135/282 (47%), Gaps = 14/282 (4%)

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           +N      RVN+T   + S+        + L +VIG+GS+G V +   K T+++ A+K +
Sbjct: 1   MNSMADTDRVNLTPIQRASEKSV----QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEV 56

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480
                 +  E+   +AE ++L  +++  IV      +   +LY++L +   G L   + +
Sbjct: 57  VYE---NDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISR 113

Query: 481 EGR-FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 539
                  + ++ Y  + L  L+ LH   VI+RD+K  NILL     + L DFG+  +   
Sbjct: 114 SSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTI--- 170

Query: 540 DQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
                 T  GT  ++APE+L  +G S + D W+LG  + EMLT  PPY++     +Y  +
Sbjct: 171 VNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAV 230

Query: 600 LQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRH 641
             +    P  F    K+ L +   ++  +R     AD++ +H
Sbjct: 231 ENDTYYPPSSFSEPLKDFLSKCFVKNMYKR---PTADQLLKH 269

>Kwal_23.6325
          Length = 1542

 Score =  105 bits (263), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 134/280 (47%), Gaps = 34/280 (12%)

Query: 393  KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVDNPFIVP 451
            + +G G+FG V      DT +I A+K I+     S  +V   + E  +VL  +++P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 452  LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRF-DLSRARFYTAELLCALETLHSLNVIY 510
                    +K+ L + +  GG L   L + GR  D    + Y  ++L  L  LH  +V++
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSLA-QLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVH 1371

Query: 511  RDLKPENILLDYQGHIALCDFGLCKLNMKD------------QDKTNTFCGTPEYLAPEL 558
            RD+KPENILLD+ G I   DFG  +    +             D  N+  GTP Y++PE 
Sbjct: 1372 RDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPES 1431

Query: 559  LLG--QGYSKVVDWWTLGVLLYEMLTGLPPYY--DEDVPKMYK----KILQEPLR---FP 607
            + G  +G     D W+LG ++ EM+TG  P++  D +   MY      + Q P +    P
Sbjct: 1432 ITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSP 1491

Query: 608  DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQL 647
             G D      L+  L +DP +R   + A E+  HP+  ++
Sbjct: 1492 QGID-----FLLRCLKQDPNKR---STAMELLLHPWMIEI 1523

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 101/203 (49%), Gaps = 13/203 (6%)

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA-------RFYTAELLCALETLH 504
           L+   ++ + L++V+ ++ GG L   ++     D S +        +   E    L+ LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
             ++I+RD+K +N+LLD  G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIEL 621
            + VD W+LG++  EML G PPY +E+  K    I       L+ P+    E K  L   
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFLSVC 756

Query: 622 LCRDPKRRLGYNGADEIKRHPFF 644
           LC D + R      +E+  H FF
Sbjct: 757 LCVDVRYRA---STEELLHHSFF 776

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 117/241 (48%), Gaps = 6/241 (2%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448
           + L ++IG+GS+G V +   K T +  A+K +         E+   ++E  +L  +++  
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 449 IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNV 508
           IV      Q    LY++L +   G L   + +        A+ Y  + L  L  LH   V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 509 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVV 568
           I+RD+K  NILLD +  + L DFG   ++ K  +   T  G+  ++APE++  +G S + 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 569 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKR 628
           D W+LG  + E+LTG PP+++     +Y  I  +    P      AK+ L +   ++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 629 R 629
           R
Sbjct: 256 R 256

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score =  103 bits (258), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 144/324 (44%), Gaps = 67/324 (20%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTN----KIYALKAIRKS----YIVSKSEVTHTLAE 437
           ++++ ++  IG+G+F +V +      N    K  A+K + K     + + K+    TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 438 RTV---LARVDNPFIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEGRFDLSRARFYT 493
             +   L + + P +V L   FQ  +K Y  +  +I GGE+F  + K   F     R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 494 AELLCALETLHSLNVIYRDLKPENILLD----------YQG------------------- 524
            ++  A++ LH  N+I+RD+KPEN++ +          YQ                    
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 525 -------HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELL---------LGQGYSKVV 568
                   + L DFGL +L    +    T CGT  YLAPE+L             YS  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 569 DWWTLGVLLYEMLTGLPPYYDEDVPK--MYKKILQEPLRFP----DGFDREAKNLLIELL 622
           D W +G +LY ML G PP+Y+++  K  +  KI +   +F     D    EA++L+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 623 CRDPKRRLGYNGADEIKRHPFFSQ 646
             DP +R      D++  HP+ + 
Sbjct: 363 QVDPAKRY---DIDQLLAHPWLNH 383

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 118/246 (47%), Gaps = 23/246 (9%)

Query: 395 IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 454
           IG+G+ G V    +  TN   A+K +       K  +   + E  V+    +P IV    
Sbjct: 626 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELI---INEILVMKGSKHPNIVNFID 682

Query: 455 SFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFDLSRARFYTAELLCALETLHSLNVIY 510
           S+     L++++ ++ GG L     H +  EG+           E L  LE LHS  V++
Sbjct: 683 SYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLEFLHSKGVLH 737

Query: 511 RDLKPENILLDYQGHIALCDFGLC----KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSK 566
           RD+K +NILL  +G I L DFG C    +LN+K      T  GTP ++APE++  + Y  
Sbjct: 738 RDIKSDNILLSMEGDIKLTDFGFCAQINELNLK----RTTMVGTPYWMAPEVVSRKEYGP 793

Query: 567 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIELLC 623
            VD W+LG+++ EM+ G PPY +E   +    I       L+ P+      K  L   LC
Sbjct: 794 KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLC 853

Query: 624 RDPKRR 629
            +P+ R
Sbjct: 854 VEPEDR 859

>Kwal_33.14081
          Length = 580

 Score =  103 bits (258), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 130/277 (46%), Gaps = 21/277 (7%)

Query: 396 GKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFS 455
           G G++G V +V  K TN I A+K +R    + +S+ T  L E  VL +  +P+IV    +
Sbjct: 281 GHGNYGNVSKVLHKPTNVIMAMKEVRLE--LDESKFTQILMELEVLHKCQSPYIVDFYGA 338

Query: 456 FQSPEKLYLVLAFINGGELFFHLQKE--GRFDLSRARFYTAELLCALETLHSL-NVIYRD 512
           F     +Y+ + +++GG L      +  G  D     +    ++  L+ L  + N+I+RD
Sbjct: 339 FFIEGAVYMCMEYMDGGSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVHNIIHRD 398

Query: 513 LKPENILLD-YQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLG-----QGYSK 566
           +KP N+L    QG + LCDFG+    +    KTN  C +  Y+APE +         Y+ 
Sbjct: 399 VKPTNVLCSAAQGTVKLCDFGVSGNLVASLAKTNIGCQS--YMAPERIKSFNPDKATYTV 456

Query: 567 VVDWWTLGVLLYEMLTGLPPY----YDEDVPKMYKKILQEPLRFPDG-FDREAKNLLIEL 621
             D W+LG+ + EM  G  PY    +D    ++   +   P + P G F   A++ +   
Sbjct: 457 QSDIWSLGLSILEMAIGTYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMC 516

Query: 622 LCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYI 658
           L + P+RR  Y    E   HP+        + M  YI
Sbjct: 517 LQKIPERRRNYAALLE---HPWLKTHHLSEVNMSEYI 550

>Scas_711.25
          Length = 1515

 Score =  105 bits (261), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 131/266 (49%), Gaps = 20/266 (7%)

Query: 393  KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE-----VTHTLAERTVLARVDNP 447
            ++IGKGSFG V       T ++ A+K +      S+ E     V    +E + L  +D+ 
Sbjct: 1218 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHL 1277

Query: 448  FIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSL 506
             IV     F++ + +Y L L ++ GG +   ++  GRFD    R    ++L  L  LHS 
Sbjct: 1278 NIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSR 1336

Query: 507  NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD--QDKTNTFCGTPEYLAPELL-LGQG 563
             +++RD+K +N+LLD  G   + DFG+ + + KD   +   T  GT  ++APE++   QG
Sbjct: 1337 GILHRDMKADNLLLDQDGVCKISDFGISRKS-KDIYSNSDMTMRGTVFWMAPEMVDTKQG 1395

Query: 564  YSKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQEPLRFPDGF---DREAKNL 617
            YS  VD W+LG ++ EM  G  P+ + E V  M+K  K    P   PD      +  ++ 
Sbjct: 1396 YSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDF 1455

Query: 618  LIELLCRDPKRRLGYNGADEIKRHPF 643
            L      DP  R     AD +  HPF
Sbjct: 1456 LDACFEIDPDNRP---TADNLLSHPF 1478

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  105 bits (261), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 121/252 (48%), Gaps = 18/252 (7%)

Query: 395  IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVPLK 453
            IG GSFG V      DT  I A+K I+ +   +  +V  ++  E TVL  +++P +V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYY 1256

Query: 454  FSFQSPEKLYLVLAFINGGELFFHLQKEGRF-DLSRARFYTAELLCALETLHSLNVIYRD 512
                  +++ + + +  GG L   L   GR  D    + Y+ ++L  L  LH   V +RD
Sbjct: 1257 GVEVHRDRVNIFMEYCEGGSLA-SLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRD 1315

Query: 513  LKPENILLDYQGHIALCDFGLC---------KLNMKDQDKTNTFCGTPEYLAPELLLGQG 563
            +KPENILLD+ G I   DFG           KLN++   +     GTP Y++PE + G G
Sbjct: 1316 IKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 564  YSKVV--DWWTLGVLLYEMLTGLPPY--YDEDVPKMYKKILQEPLRFP--DGFDREAKNL 617
            Y K    D W+LG ++ EM+TG  P+   D     +Y+    +   FP  +   +     
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 618  LIELLCRDPKRR 629
            L   L +DP +R
Sbjct: 1436 LSRCLIQDPNQR 1447

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  104 bits (259), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 126/266 (47%), Gaps = 19/266 (7%)

Query: 390 DLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFI 449
           DL+K IG+G+ G V      ++    A+K +       K  +   L E  V+    +  I
Sbjct: 622 DLIK-IGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKELI---LNEILVMRESKHSNI 677

Query: 450 VPLKFSFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFDLSRARFYTAELLCALETLHS 505
           V    S+ +   L++V+ ++ GG L     H L  EG+           E L  L+ LHS
Sbjct: 678 VNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGA-----VCRETLKGLQFLHS 732

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
             V++RD+K +NILL  +G+I L DFG C    ++  K  T  GTP ++APE++  + Y 
Sbjct: 733 KGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYG 792

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIELL 622
             VD W+LG+++ EM+ G PPY +E   +    I       L+ P+         L   L
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCL 852

Query: 623 CRDPKRRLGYNGADEIKRHPFFSQLS 648
             DP  R     A E+   PF ++++
Sbjct: 853 KVDPSERA---TATELLDDPFITEIA 875

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  104 bits (259), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 155/336 (46%), Gaps = 69/336 (20%)

Query: 372 ITIDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI-------RKS 423
           I++ Y P SK K L+   ++++K +G G  GKV   +   T ++ A+K +       RK 
Sbjct: 125 ISLTYDPVSKRKVLNT--YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKF 182

Query: 424 YIV---SKSEVTHTLAERTVLARVDNPFIVPLKFSFQS--PEKLYLVLAFINGGELFFH- 477
           +      K+E      E  ++ +  +  +V L          K+YLVL + + GE+ +  
Sbjct: 183 FSFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCP 242

Query: 478 ---LQKEGRFDLSRARFYTAELL----CALETLHSLNVIYRDLKPENILLDYQGHIALCD 530
              L+ E +     +  +T E+L      LE LH   +I+RD+KP N+LL   G + + D
Sbjct: 243 PDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISD 302

Query: 531 FGLC----KLNMKDQDKT------NTFCGTPEYLAPELLLGQ-GYSKV------------ 567
           FG+       N+   D+T          GTP + APE+ LG+  + K             
Sbjct: 303 FGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSC 362

Query: 568 ----VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFD------------ 611
               +D W LGV LY ++ G+ P+      ++++KI+ +P++FP   D            
Sbjct: 363 ISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTE 422

Query: 612 ----REAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
                 AK+LL  LL ++P +R+     +EIKRHPF
Sbjct: 423 EAEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF 455

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 104/204 (50%), Gaps = 13/204 (6%)

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKE-----GRFDLSRARF-YTAELLC-ALETLH 504
           L+   ++ + L++V+ ++ GG L   ++       G+  L+  +  Y     C  L+ LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
             ++I+RD+K +N+LLD +G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIEL 621
            + VD W+LG++  EML   PPY +E+  K    I       L+ P+    E K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 622 LCRDPKRRLGYNGADEIKRHPFFS 645
           LC D K R      +E+  H FF+
Sbjct: 843 LCVDVKYRA---STEELLHHSFFN 863

>Scas_618.15
          Length = 620

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/366 (26%), Positives = 149/366 (40%), Gaps = 82/366 (22%)

Query: 371 NITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVK-----------KKDTNKIYALKA 419
           N TI YK  +   L    + LL  IGKG+F  V +             K+  N++ A+K 
Sbjct: 140 NSTITYKFKEQAELK--GYKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEV-AIKI 196

Query: 420 IRK--------------SYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLV 465
           I+K              S++ S+ +V        V +   +  +  + F  ++    Y+V
Sbjct: 197 IKKVDLSEDLKDHERDTSHVSSREQVLKEACLHKVASSECSEVVGFIDF-VETKSYYYIV 255

Query: 466 LAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGH 525
             +++GGE++  + +   F     R    +L  A++ LHS+ +I+RD+KPEN+L +   H
Sbjct: 256 QEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQH 315

Query: 526 I----------------------------------ALCDFGLCKLNMKDQDKTNTFCGTP 551
           I                                   L DFGL K      + TNT CGT 
Sbjct: 316 IPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTI 373

Query: 552 EYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP---- 607
            Y APEL+    Y   +D W +G +LY +L G PP+Y +    + +KI      F     
Sbjct: 374 SYAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWW 433

Query: 608 DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMS 667
           D     AKN +  LL  D  +R  YN  D++   P          W+     P  PP+ S
Sbjct: 434 DEISSGAKNCVKHLLEVDVSKR--YN-IDDLLADP----------WLNMNSSPVNPPIKS 480

Query: 668 ALDTSN 673
               +N
Sbjct: 481 IFSHTN 486

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 134/310 (43%), Gaps = 71/310 (22%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTN-------------KIYALKAIRKSYI------- 425
           + D+ L++ IG+G+F KV +     +N             K  A+K I K  +       
Sbjct: 117 LKDYTLIQKIGEGAFSKVYRGIPSTSNCSNGASSVIAQQYKEVAIKVIIKQQLPNTNKKG 176

Query: 426 -------VSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLA-FINGGELFFH 477
                   +  +V   +A   +++  +N  IV     FQ  EK Y ++   + GGE+F  
Sbjct: 177 DEKNGKTSTAEQVLKEIAIHKIVSSGEN--IVSF-IDFQESEKYYYIIQELLAGGEIFGE 233

Query: 478 LQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLD---------------- 521
           + K   F    +R    +L  A++ +H L +++RD+KPEN+L +                
Sbjct: 234 IVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSD 293

Query: 522 ------------------YQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQG 563
                               G + L DFGL K     Q  T T CGT  Y APE++  + 
Sbjct: 294 DPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIY--QTNTKTPCGTVGYTAPEVVKDER 351

Query: 564 YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAKNLLI 619
           YS  VD W +G +LY +L G PP++DE +  + +KI +    F     D     AKN + 
Sbjct: 352 YSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQISDGAKNCVR 411

Query: 620 ELLCRDPKRR 629
           +LL  DP +R
Sbjct: 412 KLLEVDPAKR 421

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score =  100 bits (250), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 115/225 (51%), Gaps = 29/225 (12%)

Query: 393 KVIGKGSFGKVMQVKKKDTN--KIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIV 450
           +++G G+FG V+  +K D N  +  A K +  +  V  +  T  + E T+L ++++P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 451 PLKFS-FQSPEKLYLVLAFINGGELFFHLQKEGRF---DLSRARFYTAELLCALETLHSL 506
            +  S   +   +Y+    I+GG+LF +L K         + +     ++L AL+ LHS 
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 507 NVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQDKTNTFCGTPEYLAPELLL-- 560
            +++RDLK +NILL   +    + L DFG+ K L+   +++ +T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 561 -----------------GQGYSKVVDWWTLGVLLYEMLTGLPPYY 588
                              GY    D W+LGV+ + MLTG+ P+Y
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFY 367

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score =  102 bits (254), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 140/290 (48%), Gaps = 22/290 (7%)

Query: 371  NITIDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSK 428
            N  +    +KN      +F  +K  +IGKGSFG V       T ++ A+K +      S+
Sbjct: 1155 NHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQ 1214

Query: 429  SE-----VTHTLAERTVLARVDNPFIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEG 482
            +E     V    +E + L  +D+  IV     F++   +Y L L ++ GG +   ++  G
Sbjct: 1215 NEAILSTVEALRSEVSTLKDLDHLNIVQY-LGFENKNNIYSLFLEYVAGGSVGSLIRMYG 1273

Query: 483  RFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD-- 540
            RFD    +  T ++L  L  LHS  +++RD+K +N+LLD  G   + DFG+ +   KD  
Sbjct: 1274 RFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR-KSKDIY 1332

Query: 541  QDKTNTFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
             +   T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + +V     KI
Sbjct: 1333 SNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKI 1392

Query: 600  LQEPLRFPDGFD------REAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
             +     P   D      +  +N L      +P++R     A+E+  HPF
Sbjct: 1393 GKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP---TANELLSHPF 1439

>Scas_668.22
          Length = 893

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 116/242 (47%), Gaps = 15/242 (6%)

Query: 395 IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 454
           IG+G+ G V    +  +N+  A+K +       K  +   + E  V+    +P IV    
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELI---INEILVMKGSRHPNIVNFID 673

Query: 455 SFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFDLSRARFYTAELLCALETLHSLNVIY 510
           S+     L++++ ++ GG L     H +  EG+           E L  L+ LHS  V++
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLQFLHSKGVLH 728

Query: 511 RDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDW 570
           RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 729 RDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 788

Query: 571 WTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIELLCRDPK 627
           W+LG+++ EM+ G PPY +E   +    I       L+ P+      +N L   L  DP+
Sbjct: 789 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPE 848

Query: 628 RR 629
           +R
Sbjct: 849 QR 850

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 109/215 (50%), Gaps = 25/215 (11%)

Query: 387 DDFDLLKVIGKGSFGKV-MQVKKKDTNKIYALKAI------RKSYIVSKSEVTHTLAERT 439
           D F+    IG+G+ G V +   + D ++  A+K +      +K  IV++  V  +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 440 VLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELF----FHLQKEGRFDLSRARFYTAE 495
           ++  +D         S+ S   L++V+ ++ GG L     + +  EG+           E
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGA-----VCRE 669

Query: 496 LLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLA 555
           +L  LE LHS  V++RD+K +N+LL   G I L DFG C        K  T  GTP ++A
Sbjct: 670 VLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMA 729

Query: 556 PELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE 590
           PE++  + Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 730 PEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 764

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score =  102 bits (253), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 86/287 (29%), Positives = 139/287 (48%), Gaps = 20/287 (6%)

Query: 373  TIDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE 430
            TI+   SKN      +F  +K  +IGKGSFG V       T ++ A+K +      +++E
Sbjct: 1133 TIEINKSKNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNE 1192

Query: 431  VTHTL-----AERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFD 485
            +   +     +E   L  +D+  IV    S        L L ++ GG +   ++  GRFD
Sbjct: 1193 LVKDMVEALKSEVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFD 1252

Query: 486  LSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
                R    ++L  L+ LHS  +++RD+K +N+LLD  G   + DFG+ K +      ++
Sbjct: 1253 EKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSD 1312

Query: 546  -TFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KIL 600
             T  GT  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + E V  M++  K  
Sbjct: 1313 MTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSK 1372

Query: 601  QEPLRFPDG----FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
              P   PD        + K+ L +    DP++R     AD++  H F
Sbjct: 1373 SAPP-IPDDTIQLISSKGKDFLSKCFEIDPEKRP---TADDLLEHSF 1415

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score =  100 bits (248), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 146/279 (52%), Gaps = 30/279 (10%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVK-KKDTNKIYALKAIR----KSYIVSKSEVTHTLAERTV 440
           ID   L + IGKGSF  V +   + D + + A+K I     +   +S+ +V   L E  +
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDV---LREVKL 68

Query: 441 LARVDNPFIVPLKF--SFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLC 498
            +R  N F+  LK      S   L++ +    GG+LF  ++ +   D   A+FY  +L+ 
Sbjct: 69  HSRCSN-FVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIK 127

Query: 499 ALETLH-SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC----GTPEY 553
           A+  LH +  V +RD+KPENILLD  G++ L DFGL  L  K +D +        G+  Y
Sbjct: 128 AISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASL-FKRKDGSKRISRDQRGSLPY 186

Query: 554 LAPELLLGQG-YSKVVDWWTLGVLLYEMLTGLPPY---YDEDVPKMYKKILQEPLRFPDG 609
           +APE++   G Y+ + D W++GVLL+ +LTG  P+   +++D  + ++  ++   +   G
Sbjct: 187 MAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDD--ETFRNFIKGEGKLDQG 244

Query: 610 ----FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
                D    NLL ++L  DP++R      D +++H ++
Sbjct: 245 SWLKIDFVELNLLRKILQPDPEKRASL---DTLRKHTWY 280

>Scas_707.34
          Length = 905

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 147/313 (46%), Gaps = 67/313 (21%)

Query: 387 DDFDLLKVIGKGSFGKV------------MQVKKKDTNKI-----YALKAIRKSYIVSKS 429
           D + + K IGKGSF  V            +     D++ I     +A+K + +S + +K 
Sbjct: 36  DRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKK 95

Query: 430 EVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRF----- 484
            + +   E  +L ++ +P IV L    ++ +  YL++ + + G+L F ++K  +      
Sbjct: 96  LLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 485 -----------------DLSRARF--YTAELLCALETLHSLNVIYRDLKPENILL----- 520
                             L +A    Y  +L  AL+ L S N+++RD+KP+N+LL     
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 521 DYQG----H------------IALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
           +Y      H            + + DFG  +  + +     T CG+P Y+APE+L  Q Y
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNYQKY 274

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ--EPLRFPD--GFDREAKNLLIE 620
           +   D W++G +LYEM  G PP+   +  ++YKKI +  + + FP     D   K+L+ +
Sbjct: 275 NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSLISK 334

Query: 621 LLCRDPKRRLGYN 633
           LL  DP+ R+ ++
Sbjct: 335 LLTFDPQERIEFD 347

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score =  101 bits (252), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 135/281 (48%), Gaps = 20/281 (7%)

Query: 379  SKNKPLSIDDFDLLK--VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVT---- 432
            SKN      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E T    
Sbjct: 1112 SKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNA 1171

Query: 433  -HTLAERTVLARVDNPFIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEGRFDLSRAR 490
               ++E + L  +D+  IV     F++   +Y L L ++ GG +   ++  G FD    R
Sbjct: 1172 EALISEVSTLKDLDHLNIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIR 1230

Query: 491  FYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQDKTNTFCG 549
            F T ++L  L  LH   +++RD+K +N+LLD  G   + DFG+  K N    +   T  G
Sbjct: 1231 FLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRG 1290

Query: 550  TPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPD 608
            T  ++APE++   QGYS  VD W+LG ++ EM  G  P+ + +V     +I +     P 
Sbjct: 1291 TVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPI 1350

Query: 609  GFD------REAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
              D      ++ +  L +    DP+ R     AD +  HPF
Sbjct: 1351 PEDTLPHISQDGRAFLDDCFMIDPEERP---TADTLLSHPF 1388

>Scas_598.6
          Length = 790

 Score =  100 bits (250), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 127/275 (46%), Gaps = 22/275 (8%)

Query: 389 FDLLKVIGKGSFGKVMQVKK--------KDTNKIYALKAIRKSYIVSKSEVTHTLAERTV 440
           F +++  G+G+ G V   ++         +T ++    AI++  +  +      + E  V
Sbjct: 502 FQMIEKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVAIKQMILSKQPRKELIVNEILV 561

Query: 441 LARVDNPFIVP-LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA-------RFY 492
           +    +  IV  L+   ++ + L++V+ F+ GG L   ++       S +        + 
Sbjct: 562 MKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYI 621

Query: 493 TAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPE 552
             E    L+ LH  ++I+RD+K +N+LLD    + + DFG C      + K  T  GTP 
Sbjct: 622 VRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPY 681

Query: 553 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDG 609
           ++APE++  + Y + VD W+LG++  EML   PPY +ED  K    I       L+ P+ 
Sbjct: 682 WMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPYLNEDPLKALYLIATNGTPKLKNPES 741

Query: 610 FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
              E K  L   LC D + R      +E+  H FF
Sbjct: 742 LSLEIKRFLSVCLCVDVRYRA---STEELLHHGFF 773

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 129/293 (44%), Gaps = 52/293 (17%)

Query: 375 DYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHT 434
           +YK    K +S  D D+     +    +  + K+ +TN++ + + + K   + K+     
Sbjct: 181 NYKQVAVKVISKHDLDVSNKEQQAKDKRAGRDKQNNTNRMSSREQVMKEVRIHKAVAAGC 240

Query: 435 LAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTA 494
                       P+IV      ++    YL+   ++GGE+F  + +        +R    
Sbjct: 241 ------------PYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIK 288

Query: 495 ELLCALETLHSLNVIYRDLKPENIL---LDY----------------------------- 522
           ++  A+  +HSL +++RD+KPEN+L   ++Y                             
Sbjct: 289 QVALAVRHMHSLGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGG 348

Query: 523 --QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM 580
              G + L DFGL K     Q  T T CGT  Y APE++  + YS  VD W +G +LY M
Sbjct: 349 GGIGIVKLADFGLSKQIF--QKNTKTPCGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTM 406

Query: 581 LTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRR 629
           L G PP+YDE +  + +KI +    F     D     AK+ + +LL  DP++R
Sbjct: 407 LCGFPPFYDEKIDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>Kwal_23.5290
          Length = 819

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 100/203 (49%), Gaps = 13/203 (6%)

Query: 452 LKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA-------RFYTAELLCALETLH 504
           L+   ++ + L++V+ ++ GG L   ++       S +        +   E    L+ LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY 564
             ++I+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 565 SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDREAKNLLIEL 621
            + VD W+LG++  EML G PPY +ED  K    I       L+ P+    + K  L   
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVC 782

Query: 622 LCRDPKRRLGYNGADEIKRHPFF 644
           LC D K R      +E+  H FF
Sbjct: 783 LCVDVKYRA---STEELLHHSFF 802

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           +  D L ++G+G+ G V + K ++ +KI+ALK I  + I +         E        +
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 447 PFIVPL--KFSFQSPEKLYLVLAFINGGEL---FFHL-QKEGRFDLSRARFYTAELLCAL 500
            FIV     F+ +    +++ + ++ G  L   + HL  K GR            +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 501 ETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL 560
             LH   +I+RD+KP+NIL +  G I LCDFG+    +       TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 352

Query: 561 GQGYSKVVDWWTLGVLLYEMLTGLPPY 587
           GQ YS   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 135/287 (47%), Gaps = 20/287 (6%)

Query: 373  TIDYKPSKNKPLSIDDFDLLK--VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE 430
            TI    S+N      +F  +K  +IGKGSFG V       T ++ A+K +      S+ E
Sbjct: 1020 TISINKSRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDE 1079

Query: 431  VTHTL-----AERTVLARVDNPFIVPLKFSFQSPEKLY-LVLAFINGGELFFHLQKEGRF 484
               ++     +E + L  +++  IV     F+    +Y L L ++ GG +   ++  GRF
Sbjct: 1080 SAISMVEALKSEVSTLKDLNHVNIVQY-LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRF 1138

Query: 485  DLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQDK 543
            D    R  T ++L  L  LHS  +++RD+K +N+LLD  G   + DFG+  K N    + 
Sbjct: 1139 DDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNS 1198

Query: 544  TNTFCGTPEYLAPELL-LGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE 602
              T  GT  ++APE++    GYS  VD W+LG ++ EM  G  P+ + +V     +I + 
Sbjct: 1199 DMTMRGTVFWMAPEMVDTAHGYSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKS 1258

Query: 603  PLRFP------DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
                P      D      ++ L +    DP+ R     AD +  HPF
Sbjct: 1259 KTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMR---PTADSLVGHPF 1302

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 142/299 (47%), Gaps = 49/299 (16%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKI-----YALKAIR---------KSYIVSKSEVT--HTLA 436
           +V+G G+FG+V+  ++K  +       YA+K IR          S +V  + V+   T  
Sbjct: 147 QVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTG 206

Query: 437 ERTVLARVDNPFIVPLKFSF-QSPEKLYLVLAFINGGELFFHLQKE---GRFDLSRARFY 492
           E  VL R   P ++ +  +F    + +Y+    + GG+LF +L K+        + A   
Sbjct: 207 EEHVLTR-GQPNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 493 TAELLCALETLHSLNVIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQDKTNTFCG 549
             ++L AL+ LHS  +++RDLK +NILL   +    I L DFG+ K     + + +T  G
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVG 325

Query: 550 TPEYLAPEL-----------------LLGQGYSKVVDWWTLGVLLYEMLTGLPPYY-DED 591
           TPEY APE+                 +  QGY    D W+LGV+ + MLTG+ P+Y D  
Sbjct: 326 TPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGT 385

Query: 592 VPKMYKKILQEPLRFPD----GFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
              + + +    L F      G    AK+ + +LL  + ++R+      +  +HP+ ++
Sbjct: 386 EASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRM---SVQDCFKHPWIAK 441

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 446
           L  +G G+FG V       TN+  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPF------ATAVLAKRTYRELKLLKHLRH 79

Query: 447 PFIVPLKFSFQSP-EKLYLVLAFINGGELFFHLQK---EGRFDLSRARFYTAELLCALET 502
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFHYQILRGLKY 134

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT-FCGTPEYLAPELLLG 561
           +HS  V++RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSAGVVHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 562 -QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-------------------- 600
            Q Y   VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTL 250

Query: 601 --------QEPLRFPDGF---DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
                   ++P+ F + F   + +A +LL ++L  DPK+R+    AD +  HP       
Sbjct: 251 KFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRI--TAADALA-HP------- 300

Query: 650 KRLWMKGYIPPYKPPVMSALDTSNFDQEFT-REKPVDS 686
                  Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 301 -------YLAPYHDPTDEPVAEAKFDWHFNDADLPVDT 331

>Kwal_47.17263
          Length = 1127

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 151/331 (45%), Gaps = 64/331 (19%)

Query: 372 ITIDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI--------RK 422
           I+++Y P SK K L+   ++++  +G+G  GKV   +   T ++ A+K +        R 
Sbjct: 89  ISLEYDPISKRKVLNT--YEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRF 146

Query: 423 SYIVSKSEVTHTLAERTVLARVDNPFIVPLK--FSFQSPEKLYLVLAFINGGELFF---- 476
           S+  + +       E  ++ +  +  +V L       +  K+YLVL + + GE+ +    
Sbjct: 147 SFKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGD 206

Query: 477 HLQKEGR----FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFG 532
            L+ E R        RAR     ++  LE LH   +I+RD+KP N+L+   G + + DFG
Sbjct: 207 QLETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFG 266

Query: 533 LCKLNMK--------DQDKTNTFCGTPEYLAPELLLGQGYSKV----------------- 567
           +     K        D+ +     GTP + APE+ LG   S+                  
Sbjct: 267 VSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYN 326

Query: 568 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRF-------PDGFDR-------- 612
           +D W +GV L+ +L G+ P++ E   +++ KI+ + L          +G  +        
Sbjct: 327 IDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYE 386

Query: 613 EAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
            AK+LL  LL ++P +R+      EIK+HPF
Sbjct: 387 AAKDLLGRLLTKNPFKRIKIA---EIKKHPF 414

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 110/212 (51%), Gaps = 27/212 (12%)

Query: 390 DLLKVIGKGSFGKVMQVKKKDTNKIYALKAI------RKSYIVSKSEVTHTLAERTVLAR 443
           +L+K IG+G+ G V    +  TN   A+K +      +K  IV++  V        ++  
Sbjct: 700 NLIK-IGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVNF 758

Query: 444 VDNPFIVPLKFSFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFD-LSRARFYTAELLC 498
           +D+       + F+    L++V+ ++ GG L     H +  EG+   +SR      E L 
Sbjct: 759 IDS-------YLFRG--DLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLK 803

Query: 499 ALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPEL 558
            L+ LHS  VI+RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE+
Sbjct: 804 GLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEV 863

Query: 559 LLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDE 590
           +  + Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 864 VSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 895

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 119/222 (53%), Gaps = 16/222 (7%)

Query: 379 SKNKPL-SIDDFDLLKVIGKGSFGKVMQVK-KKDTNKIYALKAIR----KSYIVSKSEVT 432
           S+  PL  I D  L   +G+G+F  V     + D + I A+K I     K   +S  ++T
Sbjct: 4   SQVSPLPHIKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDKDIT 63

Query: 433 HTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFY 492
             +  ++  ++  +P ++ L     S E ++++L   +GG+LF  ++ +   D   A+FY
Sbjct: 64  KEVVLQSKCSK--HPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFY 121

Query: 493 TAELLCALETLH-SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC--- 548
             +L+ A+  LH    V +RD+KPENILLD  G++ L DFGL     + +D T       
Sbjct: 122 FQQLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGLAS-QFRRKDGTLRVSMDQ 180

Query: 549 -GTPEYLAPELLLGQG--YSKVVDWWTLGVLLYEMLTGLPPY 587
            G+P Y+APE+L  +   Y+   D W++G+LL+ +LTG  P+
Sbjct: 181 RGSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>Kwal_26.7861
          Length = 955

 Score = 98.2 bits (243), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 104/205 (50%), Gaps = 13/205 (6%)

Query: 390 DLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFI 449
           +L+K IG+G+ G V    +  TN   A+K +       K  +   + E  V+    +  I
Sbjct: 669 NLIK-IGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELI---INEILVMKASKHANI 724

Query: 450 VPLKFSFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFDLSRARFYTAELLCALETLHS 505
           V    S+     L++V+ ++ GG L     H +  EG+         + E L  L+ LHS
Sbjct: 725 VNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-----VSRETLKGLQFLHS 779

Query: 506 LNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
             VI+RD+K +N+LL   G I L DFG C    +   K  T  GTP ++APE++  + Y 
Sbjct: 780 KGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYG 839

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDE 590
             VD W+LG+++ EM+ G PPY +E
Sbjct: 840 PKVDIWSLGIMIIEMIEGEPPYLNE 864

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 98.2 bits (243), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 102/201 (50%), Gaps = 14/201 (6%)

Query: 395 IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 454
           IG+G+ G V    +  TN   A+K +       K  +   + E  V+    +  IV    
Sbjct: 689 IGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELI---INEILVMKGSRHNNIVNFID 745

Query: 455 SFQSPEKLYLVLAFINGGEL---FFH-LQKEGRFD-LSRARFYTAELLCALETLHSLNVI 509
           S+     L++++ ++ GG L     H +  EG+   +SR      E L  L  LHS  VI
Sbjct: 746 SYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAAVSR------ETLRGLHFLHSKGVI 799

Query: 510 YRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVD 569
           +RD+K +NILL   G+I L DFG C    +   K  T  GTP ++APE++  + Y   VD
Sbjct: 800 HRDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPKVD 859

Query: 570 WWTLGVLLYEMLTGLPPYYDE 590
            W+LG+++ EM+ G PPY +E
Sbjct: 860 IWSLGIMIIEMIEGEPPYLNE 880

>Kwal_55.22001
          Length = 363

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/345 (28%), Positives = 156/345 (45%), Gaps = 59/345 (17%)

Query: 377 KPSKNKPLSIDDFDLLKVIGKGSFGKVMQV-KKKDTNKIYALKAIRKSYIVSKSEVTHTL 435
           + S  +P+ + ++   K IG G+FG V+Q     D NK Y   AI+K      ++  +  
Sbjct: 17  RSSSTRPMLVKEY---KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKV----PAQTEYKS 69

Query: 436 AERTVLARVDNPFIVPLKFSFQ--SPE--KLYLVLAFINGGE---LFFHLQKEGRFDL-- 486
            E  +L   D+P +V L++ F   SP+  KLY  LA     E   L  H     + +L  
Sbjct: 70  RELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPL 129

Query: 487 SRARFYTAELLCALETLHSLNVIYRDLKPENILLD-YQGHIALCDFGLCKLNMKDQDKTN 545
              + YT ++   +  LH+L + +RD+KP N+L+D   G + +CDFG  K   ++Q   +
Sbjct: 130 KHTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSIS 189

Query: 546 TFCGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDV------------ 592
             C    Y APEL++G   Y+  +D W LG ++ EML G   +  ++             
Sbjct: 190 YICSR-FYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG 248

Query: 593 -----------PKMYKKILQEPL-------RFPDGFDR---EAKNLLIELLCRDPKRRLG 631
                      P     +  +PL       RF   F +   E  +LL+++L  +P+RRL 
Sbjct: 249 PPDKKFLFFSNPSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL- 307

Query: 632 YNGADEIKRHPFFSQLSWKRLWM-KGYIPPYKPPVMSALDTSNFD 675
                 I  HPFF  L  +R +  +G+  P   P +   D S F+
Sbjct: 308 --SPRRILAHPFFEDLKKERYFFPRGHTQPKYLPEL--FDFSPFE 348

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 119/262 (45%), Gaps = 30/262 (11%)

Query: 395  IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVDNPFIVPLK 453
            IG G+FG+V      +  +I A+K I+     +  ++   + E  TVL  +++P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 454  FSFQSPEKLYLVLAFINGGELFFHLQKEGRF-DLSRARFYTAELLCALETLHSLNVIYRD 512
                  +K+ + + +  GG L   L   GR  D    + YT ELL  L  LH   V++RD
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSLA-SLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRD 1158

Query: 513  LKPENILLDYQGHIALCDFGLCKLNMKDQDKT----------------NTFCGTPEYLAP 556
            +KPENILLD+ G I   DFG  +  +  + +T                N   GTP Y+AP
Sbjct: 1159 IKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAP 1218

Query: 557  ELLLG---QGYSKVVDWWTLGVLLYEMLTGLPPY--YDEDVPKMYK----KILQEPLRFP 607
            E + G   +G     D W LG ++ EM TG  P+   D +   MY     +I Q P R  
Sbjct: 1219 ETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNR-- 1276

Query: 608  DGFDREAKNLLIELLCRDPKRR 629
            D      +  L   L +DP  R
Sbjct: 1277 DEMTAAGRAFLERCLVQDPTMR 1298

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 100/207 (48%), Gaps = 9/207 (4%)

Query: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 446
           D  + L V+G+G+ G V + K +  +KI+ALK I  +    +        E        +
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQFNKSCKS 292

Query: 447 PFIVPLKFSFQSPEK--LYLVLAFINGGEL---FFHLQKEGRFDLSRARFYTAE-LLCAL 500
            +IV     F   E   +Y+ + ++ G  L   + HL K G     +     AE +L  L
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGL 352

Query: 501 ETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLL 560
             LH   +I+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + 
Sbjct: 353 SYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 410

Query: 561 GQGYSKVVDWWTLGVLLYEMLTGLPPY 587
           GQ YS   D W+LG+ L E+     P+
Sbjct: 411 GQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>Kwal_56.23841
          Length = 432

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 446
           L  +G G+FG V       TN+  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 447 PFIVPLKFSFQSP-EKLYLVLAFINGGELFFHLQK---EGRFDLSRARFYTAELLCALET 502
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT-FCGTPEYLAPELLLG 561
           +HS  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 562 -QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-------------------- 600
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTL 250

Query: 601 --------QEPLRFPDGF---DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
                   ++P+ F + F   + +A +LL ++L  DP +R+    AD +  HP       
Sbjct: 251 KFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRI--TAADALS-HP------- 300

Query: 650 KRLWMKGYIPPYKPPVMSALDTSNFDQEFT-REKPVDS 686
                  Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 301 -------YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 148/325 (45%), Gaps = 60/325 (18%)

Query: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420
           ++  +G+ R+  T  Y P K      ++F +L+ IG+GSFG V +V    T+K+   K I
Sbjct: 1   MSQSRGIRRLQ-TSSY-PQKLGHSQPNEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEI 58

Query: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPL------------KFSFQSPEKLYLVLAF 468
           +  ++ SK E    +AE T+LA + +  IV                 + + E LYL + +
Sbjct: 59  KYGHMNSK-ERQQLIAECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEY 117

Query: 469 INGGEL---FFHLQKEGRFDLSRARFYTA-ELLCALETLHS------------------- 505
            + G+L     H +   ++   R  +  A +LL AL   H+                   
Sbjct: 118 CSCGDLSQMIKHYKGMRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAI 177

Query: 506 -------LNVIYRDLKPENILLDYQG------------HIALCDFGLCKLNMKDQDKTNT 546
                   +VI+RDLKP NI L   G             + L DFGL K      +   T
Sbjct: 178 ESEAGKVTSVIHRDLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATT 237

Query: 547 FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLR- 605
           + GTP Y++PE+L+ Q YS + D W+LG ++YE+     P+   +  ++ + I +  ++ 
Sbjct: 238 YVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQP 297

Query: 606 FPDGFDREAKNLLIELLCRDPKRRL 630
            PD + +E + L+I   C +P  +L
Sbjct: 298 LPDYYSKELQQLVIS--CINPNEKL 320

>Kwal_26.8703
          Length = 444

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 104/205 (50%), Gaps = 9/205 (4%)

Query: 394 VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL- 452
           V+G+G+ G V + K K  + ++ALK I  +    +++    L E        + +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQ-KQVLRELQFNRSCSSEYIVRYY 220

Query: 453 -KFSFQSPEKLYLVLAFINGGEL---FFHL-QKEGRFDLSRARFYTAELLCALETLHSLN 507
             F+ +S   +Y+ + ++ G  L   + HL ++ GR            +L  L  L    
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 508 VIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKV 567
           +I+RD+KP+NILL+  G + LCDFG+  + +       TF GT  Y+APE + GQ YS  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAVNSL--ATTFTGTSFYMAPERIQGQPYSVT 338

Query: 568 VDWWTLGVLLYEMLTGLPPYYDEDV 592
            D W+LG+ L E+  G  P+  +++
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNM 363

>Scas_619.5*
          Length = 510

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 86/297 (28%), Positives = 143/297 (48%), Gaps = 55/297 (18%)

Query: 393 KVIGKGSFGKVMQVKKKD--------TNKIYALKAIR-KSYIVSKSEVTHTLAERTVLAR 443
           ++IG G+FG V+   KK         +   +A+K I+ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 444 VDNPFIVPLKFSFQS--PEKLYLVLAFINGGELFFHLQK-EGRFDLSRAR--FYTAELLC 498
           +++  I+ + ++F       LY+    I GG+LF +L K E    +S         ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 499 ALETLHSLNVIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQDKTNTFCGTPEYL 554
           AL  +H   +++RDLK +NILL   +    I L DFG+ K L++K+  + NT  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNT-RMNTIVGTPEYC 342

Query: 555 APEL-------LLGQ-------------GYSKVVDWWTLGVLLYEMLTGLPPYY-DEDVP 593
           APE+       ++ Q             GY    D W+LGV+ + MLTG+ P+Y D    
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 594 KMYKKILQEPLRFP----DGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQ 646
            + + + +  L F     +  +  AK  + +LL  D  +RL    + +  +HP+ S+
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRL---DSKQSFQHPWISR 456

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 129/308 (41%), Gaps = 69/308 (22%)

Query: 389 FDLLKVIGKGSFGKVMQ-VKKKDTNKIY--------ALKAIRKSYIVSKSEVT------- 432
           + LL  IG+G+F +V + V  KD    Y        A+K I K  + + +  T       
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 433 ------------HTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLA-FINGGELFFHLQ 479
                         L E T+   V +   +     FQ  E  Y ++   + GGE+F  + 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIV 210

Query: 480 KEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENIL---LDY-------------- 522
           +   F    +R    +L  A++ +HSL +++RD+KPEN+L   +D+              
Sbjct: 211 RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDP 270

Query: 523 -----------------QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS 565
                             G I L DFGL K        T T CGT  Y APE++  + YS
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATN--TTTPCGTVGYTAPEVVKDERYS 328

Query: 566 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDREAKNLLIEL 621
             VD W +G +LY +L G PP+YDE +  + + I +    F     D     AKN +  L
Sbjct: 329 MKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRL 388

Query: 622 LCRDPKRR 629
           L  DP +R
Sbjct: 389 LEVDPDKR 396

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 131/287 (45%), Gaps = 69/287 (24%)

Query: 380 KNKP--LSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAE 437
           KN+P   +  D+ ++K IG+GSFG V +V    T ++   K I+  ++ SK E    +AE
Sbjct: 3   KNQPQHYARSDYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAE 61

Query: 438 RTVLARVDNPFIVPLKFSF---QSPEKLYLVLAFINGGEL---FFHLQKEGRFDLSRARF 491
            T+L+++ +  IV   +S+   +  E LYL + + + G+L     H ++E ++   +  +
Sbjct: 62  CTILSQLKHENIVEF-YSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVW 120

Query: 492 -YTAELLCALETLH------SLNVIY---------------RDLKPENILLDY------- 522
              A++L AL   H      SL  IY               RDLKP NI L Y       
Sbjct: 121 GILAQMLTALYKCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDS 180

Query: 523 ------------------------------QGHIALCDFGLCKLNMKDQDKTNTFCGTPE 552
                                         Q  + + DFGL K      D   T+ GTP 
Sbjct: 181 TDKADIAQSNWYRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPY 240

Query: 553 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 599
           Y++PE+L+ Q YS + D W+LG ++YEM +  PP+  ++  ++  KI
Sbjct: 241 YMSPEVLMDQPYSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 124/255 (48%), Gaps = 49/255 (19%)

Query: 372 ITIDYKPSKNKPLSIDDFDLLK-VIGKGSFGKVM-----------QVKKKDTNKIYALKA 419
           ITI+Y  +      +D++++   V+G G+FG V+           +  +K T K YA+K 
Sbjct: 141 ITINYTEN------VDNWNISNIVVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVKI 194

Query: 420 IRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL-KFSFQSPEKLYLVLAFINGGELFFHL 478
           +       K +++    E  +L ++++P I+ + K        LY+    I GG+LF +L
Sbjct: 195 V-------KMKLSKLDKEAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYL 247

Query: 479 QKEGRF---DLSRARFYTAELLCALETLHSLNVIYRDLKPENILL---DYQGHIALCDFG 532
            K         + A  +  ++L AL+ LH+  +++RDLK +NILL   +    I L DFG
Sbjct: 248 AKGDCLMPISQTEALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFG 307

Query: 533 LCKLNMKDQDKTNTFCGTPEYLAPEL-----------------LLGQGYSKVVDWWTLGV 575
           + +     + +  T  GTPEY APE+                 L  QGY    D W+LGV
Sbjct: 308 IARTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGV 367

Query: 576 LLYEMLTGLPPYYDE 590
           + + MLTG+ P+Y +
Sbjct: 368 ITHIMLTGISPFYGD 382

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 130/272 (47%), Gaps = 16/272 (5%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVK-KKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR- 443
           I + +L + IG+G+F  V     + D   I A+K +      ++      L    VL   
Sbjct: 12  IKELELGETIGQGTFAFVKTASLRADPQTIVAVKFVHVERCKARGMTDEDLTREVVLQTR 71

Query: 444 -VDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
              +  +V +     S E L++ +   +GG+LF  ++ +   D   ARFY  +L+ AL  
Sbjct: 72  CAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQQLVRALTH 131

Query: 503 LH-SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK---TNTFCGTPEYLAPEL 558
           LH +  V +RD+KPEN+LLD  G++ + DFGL     +            GT  YLAPE+
Sbjct: 132 LHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLARDRRGTLPYLAPEV 191

Query: 559 LLGQGY-SKVVDWWTLGVLLYEMLTGLPPYYDEDVPK-MYKKILQEPLRFPDG----FDR 612
           +  + Y +   D W+ GVL++ +LTG  P+ +  V   M++  + +     DG       
Sbjct: 192 VGERAYHADTADIWSAGVLVFVLLTGETPWSEPSVDDGMFRAFVADGGNLSDGPWGKIGL 251

Query: 613 EAKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
              NLL ++L + P  R       ++++HP+F
Sbjct: 252 VELNLLRKMLQQRPAARATLA---QLRQHPWF 280

>Scas_713.38
          Length = 432

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 151/338 (44%), Gaps = 75/338 (22%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 446
           L  +G G+FG V       T++  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 447 PFIVPLKFSFQSP-EKLYLVLAFINGGELFFHLQK---EGRFDLSRARFYTAELLCALET 502
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT-FCGTPEYLAPELLLG 561
           +HS+ VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSVGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 562 -QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-------------------- 600
            Q Y   VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTL 250

Query: 601 --------QEPLRFPDGF---DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
                   ++P+ F + F   + +A +LL ++L  DPK+R+    A E   HP       
Sbjct: 251 KFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRV---TAAEALAHP------- 300

Query: 650 KRLWMKGYIPPYKPPVMSALDTSNFDQEFT-REKPVDS 686
                  Y+ PY  P    +    FD  F   + PVD+
Sbjct: 301 -------YLAPYHDPTDEPVADCKFDWHFNDADLPVDT 331

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 149/314 (47%), Gaps = 57/314 (18%)

Query: 381 NKPLSIDD-FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVT-HTLAER 438
           N+  +ID  F+L+K IG G++G V   +  + ++   +   + + I SK+ +   +L E 
Sbjct: 12  NQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLREL 71

Query: 439 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQ--------KEGRFDLSRAR 490
            +L        +   +     + ++     ING  L+  L         K G+  L+ A 
Sbjct: 72  KLLRHFRGHKNITCLYDM---DIVFYPDGSINGLYLYEELMECDMHQIIKSGQ-ALTDAH 127

Query: 491 F--YTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTF- 547
           +  +T ++LC L+ +HS +V++RDLKP N+L++    + +CDFGL +   ++ ++ N F 
Sbjct: 128 YQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFL 187

Query: 548 ---CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-- 601
                T  Y APE++L  QGY+K +D W+ G +L E L G P +  +D      +ILQ  
Sbjct: 188 TEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVL 247

Query: 602 -----EPLR-------------------------FPDGFDREAKNLLIELLCRDPKRRLG 631
                E LR                         FP+  + +A +LL  +L  DP++R+ 
Sbjct: 248 GTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNA-NEDALDLLEGMLAFDPQKRIT 306

Query: 632 YNGADEIKRHPFFS 645
            + A E   HP+ +
Sbjct: 307 VDKALE---HPYLT 317

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 446
           L  +G G+FG V       T++  A+K I K +       T  LA+RT     +L  + +
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STSVLAKRTYRELKLLKHLRH 78

Query: 447 PFIVPLKFSFQSP-EKLYLVLAFINGGELFFHLQK---EGRFDLSRARFYTAELLCALET 502
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 79  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 133

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT-FCGTPEYLAPELLLG 561
           +HS  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 134 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 189

Query: 562 -QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-------------------- 600
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 190 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTL 249

Query: 601 --------QEPLRFPDGF---DREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
                   ++P+ F   F   + +A +LL ++L  DPK+R+    AD +  HP+ S    
Sbjct: 250 KFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRI--TAADALA-HPYLS---- 302

Query: 650 KRLWMKGYIPPYKPPVMSALDTSNFDQEFT-REKPVDS 686
                     PY  P    +  + FD  F   + PVD+
Sbjct: 303 ----------PYHDPTDEPIAEAKFDWNFNDADLPVDT 330

>Scas_602.11
          Length = 1186

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 167/397 (42%), Gaps = 105/397 (26%)

Query: 348 NSATSIRLYNHQWLNMEKGLGRVN--------ITIDYKP-SKNKPLSIDDFDLLKVIGKG 398
           N       +N+++  +++ LGR +        I++ Y P SK K L+   ++++K +G G
Sbjct: 124 NRTAPFNTFNNKFATLDEKLGRTSTKVKETNRISLTYDPISKRKVLNT--YEIIKELGHG 181

Query: 399 SFGKVMQVKKKDTNKIYALKAIRK----------SYIVSKSEVTHTLA-ERTVLARVDNP 447
             GKV   K   T+++ A+K + +           +   K +    +  E  ++ ++ + 
Sbjct: 182 QHGKVKLAKDLLTSQLVAIKIVDRHEKLRLTNFFKFNKRKQQNDDRIKREIAIMKKLHHK 241

Query: 448 FIVPLKFSFQS--PEKLYLVLAFINGGELFFH----LQKEGR----FDLSRARFYTAELL 497
            +V L          K+YLVL +   GE+ +     L+ E +         AR     ++
Sbjct: 242 HVVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGVI 301

Query: 498 CALETLHSLNVIYRDLKPENILLDYQGHIALCDFG------------------------- 532
             LE LH   +I+RD+KP N+L+D +G + + DFG                         
Sbjct: 302 LGLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPRN 361

Query: 533 LCKLNMKDQDKTNT-------------FCGTPEYLAPELLLG-QGYSK------------ 566
           L + + +  + TN                GTP + APE+ LG + + K            
Sbjct: 362 LSRSSTESMNTTNNNDDESIDEVELAKTAGTPAFFAPEICLGEEAFDKFSLRKNEMFKGS 421

Query: 567 ----VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRE--------- 613
               ++D W LG+  Y +L G+ P+  +   ++++KI+ EPL FP   + +         
Sbjct: 422 CISFMIDIWALGITFYCLLFGMLPFISDFELELFEKIVGEPLTFPSYEELQANRVSNVCS 481

Query: 614 ------AKNLLIELLCRDPKRRLGYNGADEIKRHPFF 644
                 AKN+L  LL ++P +R       E+K HPF 
Sbjct: 482 IEEYEAAKNVLQRLLEKNPSKRCSI---LELKYHPFI 515

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 122/274 (44%), Gaps = 43/274 (15%)

Query: 395 IGKGSFGKVMQVKKKDTNKIYALK-------------------------------AIRKS 423
           IG GSFG V      +T ++ A+K                               A++ +
Sbjct: 445 IGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTAVKNT 504

Query: 424 YIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGR 483
             + +  +     E  +L  + +  IV    S Q    L + L ++ GG +   L   G 
Sbjct: 505 SQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGP 564

Query: 484 FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCK----LNMK 539
           FD    + +T ++L  L  LH  N+I+RD+K  NIL+D +G + + DFG+ K    LN K
Sbjct: 565 FDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSPLN-K 623

Query: 540 DQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYD----EDVPKM 595
            Q+K  +  G+  ++APE++     ++  D W++G ++ EM TG  P+ D    + + K+
Sbjct: 624 QQNKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTGKHPFPDFSQMQAIFKI 683

Query: 596 YKKILQEPLRFPDGFDREAKNLLIELLCRDPKRR 629
              I+ E    P     EAK  L +    D ++R
Sbjct: 684 GTNIIPE---IPSWVSEEAKAFLFKSFELDYRKR 714

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 120/250 (48%), Gaps = 28/250 (11%)

Query: 386 IDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI-----RKSYIVS-KSEVTHTLAERT 439
           +++F++L  +G G +GKV   +   T  + A+K +     R  Y +  K E      E  
Sbjct: 47  LNNFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIE 106

Query: 440 VLARVDNPFIVPLKFSFQSPE--KLYLVLAFINGG------ELFFHLQKEGRFDLS--RA 489
           V+ R  +  +V L      PE  K+YLVL + + G      E    ++  G   L+  ++
Sbjct: 107 VMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQS 166

Query: 490 RFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC------KLNMK---D 540
           R    +++  LE LHS  + +RD+KP N+L+   G + + DFG+         N++   +
Sbjct: 167 RKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHE 226

Query: 541 QDKTNTFCGTPEYLAPELLLGQ---GYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYK 597
           Q   +   GTP + APEL   +     S  +D W+LGV +Y +L G  P+      +++ 
Sbjct: 227 QLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFD 286

Query: 598 KILQEPLRFP 607
            I+ +PL FP
Sbjct: 287 SIINKPLEFP 296

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 104/211 (49%), Gaps = 16/211 (7%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLA------ 442
           + L+ +IG+G++G V     K T    A+K I+         VT TL E  +L       
Sbjct: 13  YKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQP--FTRPMFVTRTLRELKLLKFFHSHE 70

Query: 443 RVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALET 502
            + +   +    S+Q  E +YLV   +         Q          +++T ++L AL++
Sbjct: 71  NIISVLDIVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKS 130

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQDKTNT------FCGTPEYLA 555
           LHS  VI+RDLKP N+LL+    + LCDFGL + L   D+ + N       +  T  Y A
Sbjct: 131 LHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRA 190

Query: 556 PELLLG-QGYSKVVDWWTLGVLLYEMLTGLP 585
           PE++L  Q Y+  +D W+ G +L EM++G P
Sbjct: 191 PEIMLSFQEYTTAMDIWSCGCILAEMISGKP 221

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 139/313 (44%), Gaps = 69/313 (22%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF L  ++G+G++G V     K T +I A+K I             TL E  +L R  + 
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVP--FDKPLFALRTLREIKILRRFQHE 69

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA-----------RFYTAEL 496
            I+ + F  Q PE      +F    E++  +Q+  + DL R            +++  + 
Sbjct: 70  NIISI-FDIQKPE------SFEKFNEVYI-IQELMQTDLHRVIATQTLTDDHIQYFIYQT 121

Query: 497 LCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL--------NMKDQDKTNTFC 548
           L A++TLH  NVI+RDLKP NIL++    + +CDFGL ++        N  D+     + 
Sbjct: 122 LRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYV 181

Query: 549 GTPEYLAPELLLGQG-YSKVVDWWTLGVLLYEM---------------------LTGLPP 586
            T  Y APE++L    YS+ +D W+ G +L E+                     L G P 
Sbjct: 182 ATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPD 241

Query: 587 YYDEDV-------PKMYKKILQE--PLR-----FPDGFDREAKNLLIELLCRDPKRRLGY 632
             D+ +        + Y   LQ+  P+R     FP G +    +LL  +L  DP+ R+  
Sbjct: 242 SSDKSMECIESRRARQYIASLQKYPPVRPLQKAFP-GVNPVGVDLLSRMLVFDPRERI-- 298

Query: 633 NGADEIKRHPFFS 645
             AD+   HP+ S
Sbjct: 299 -SADDALAHPYLS 310

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 114/228 (50%), Gaps = 40/228 (17%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVDNP 447
           + L+ ++G+G++G V     K TN   A+K I+     S+S  VT TL E  +L      
Sbjct: 13  YQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQP---FSRSMFVTRTLRELKLL------ 63

Query: 448 FIVPLKFSFQSPEKLYLVLAFI-----NGGELFFHLQKEGRFDLSRA-----------RF 491
                KF F S E +  VL  +     +  E  + +Q+    DL +            ++
Sbjct: 64  -----KF-FHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQNLSEDHIQY 117

Query: 492 YTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQDKTNT---- 546
           +  ++L AL++LHS  VI+RDLKP N+LL+    + +CDFGL + L   DQ + N     
Sbjct: 118 FVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFM 177

Query: 547 --FCGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDED 591
             +  T  Y APE++L  Q Y+  +D W+ G +L EM+ G P +  +D
Sbjct: 178 TEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPGKD 225

>Kwal_14.2497
          Length = 418

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 101/189 (53%), Gaps = 12/189 (6%)

Query: 466 LAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHS-LNVIYRDLKPENILLDYQG 524
           +   +GG+LF  ++ +   D   ARFY  +L+ A++ LH+   V +RD+KPEN+LLD +G
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 525 HIALCDFGLC-KLNMKDQDK--TNTFCGTPEYLAPELLLGQG-YSKVVDWWTLGVLLYEM 580
           ++ L DFGL  +   KD  K   +   G+  Y+APE++  +  Y+   D W+ GVL++ +
Sbjct: 61  NLKLADFGLASQFKRKDGSKRIMSDTRGSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVL 120

Query: 581 LTGLPPYYDEDVPKMYKKILQEPLRFPDG----FDREAKNLLIELLCRDPKRRLGYNGAD 636
           LTG  P+        +   L+       G     D    NLL ++L  DP RR     A+
Sbjct: 121 LTGETPWDSPSDDSRFDDFLENSGGIASGSWAKIDISQLNLLRKMLHPDPARRA---TAE 177

Query: 637 EIKRHPFFS 645
           ++K H ++S
Sbjct: 178 QLKSHNWYS 186

>Kwal_33.13222
          Length = 148

 Score = 85.1 bits (209), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/112 (35%), Positives = 69/112 (61%), Gaps = 1/112 (0%)

Query: 456 FQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKP 515
           +++   LY+VL ++  GELF  L + G    + A  +  +++  +   H+L +++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 516 ENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKV 567
           EN+LLD++ +I + DFG+  L  KD+    T CG+P Y APE++ G   S++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKDK-LLETSCGSPHYAAPEIVSGTALSRL 126

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 94/338 (27%), Positives = 150/338 (44%), Gaps = 75/338 (22%)

Query: 392 LKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 446
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  + +
Sbjct: 32  LNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 85

Query: 447 PFIVPLKFSFQSP-EKLYLVLAFINGGELFFHLQK---EGRFDLSRARFYTAELLCALET 502
             ++ L+  F SP E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 86  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----LQYFLYQILRGLKY 140

Query: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNT-FCGTPEYLAPELLLG 561
           +HS  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 141 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 196

Query: 562 -QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-------------------- 600
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 197 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTL 256

Query: 601 --------QEPLRFPDGFDR---EAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSW 649
                   ++P+ F + F     +A +LL ++L  DPK+R+    A +   HP       
Sbjct: 257 KFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRI---TAGDALTHP------- 306

Query: 650 KRLWMKGYIPPYKPPVMSALDTSNFDQEFT-REKPVDS 686
                  Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 307 -------YLAPYHDPTDEPVADAKFDWNFNDADLPVDT 337

>Kwal_55.20326
          Length = 750

 Score = 92.4 bits (228), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 112/229 (48%), Gaps = 10/229 (4%)

Query: 408 KKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLA 467
           KK  N+     A++ S  V +  V     E  +L  + +  IV    S Q    L + L 
Sbjct: 508 KKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLE 567

Query: 468 FINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIA 527
           ++ GG +   L   G F+    R +T ++L  L  LH  ++I+RD+K  NIL+D +G + 
Sbjct: 568 YVPGGSVSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVK 627

Query: 528 LCDFGLCK----LNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTG 583
           + DFG+ K    LN + Q+K  +  G+  ++APE++     +K  D W++G ++ EM TG
Sbjct: 628 ITDFGISKKLSPLNQQ-QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTG 686

Query: 584 LPPYYDEDVPKMYKKILQEPLRFPDG---FDREAKNLLIELLCRDPKRR 629
             P+ D    +   KI      FPD       EAK+ L++    D ++R
Sbjct: 687 KHPFPDFSQMQAIFKIGTNT--FPDSPSWSSNEAKDFLLKTFELDYRKR 733

>Scas_623.11
          Length = 378

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 129/251 (51%), Gaps = 22/251 (8%)

Query: 349 SATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKK 408
           S  S  + N Q L + K + R +  ++   S N P++I  F   ++IGKGSFG V     
Sbjct: 8   SGPSPVITNPQDLLVRKQVYRGHPLLNADDSNNDPITIT-FPTTEIIGKGSFGLVFCTTI 66

Query: 409 KDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPE-----KLY 463
           ++T+++ A+K + +       E+        ++  + +P ++ LK+ F   +      L 
Sbjct: 67  RETDEVVAIKKVLQDRRFKNREL-------EIMKLIQHPNVINLKYYFYEKDVDDEVYLN 119

Query: 464 LVLAFINGGELFFHLQK--EGRFDLSR--ARFYTAELLCALETLHSL-NVIYRDLKPENI 518
           L+L ++    L+  L+     R  +SR   +FY  +L  +L  LH+  NV +RD+KP+NI
Sbjct: 120 LILDYMPQS-LYQRLRHFVHQRQSMSRLEIKFYMFQLFKSLNYLHNAKNVCHRDIKPQNI 178

Query: 519 LLDYQG-HIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVL 576
           L+D    ++ LCDFG  K  +K  +   ++  +  Y APEL+ G   YS  +D W+ G +
Sbjct: 179 LVDPNSWNLKLCDFGSAK-QLKPTEPNVSYICSRYYRAPELIFGATNYSNQIDIWSSGCV 237

Query: 577 LYEMLTGLPPY 587
           + E+L G P +
Sbjct: 238 MAELLLGQPMF 248

>Scas_688.14
          Length = 479

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 141/317 (44%), Gaps = 63/317 (19%)

Query: 381 NKPLSIDD-FDLLKVIGKGSFGKVMQVK------------KKDTNKIYALKAIRKSYIVS 427
           N+  ++D  F L+K IG G++G V   +            KK TN +++   + K  +  
Sbjct: 14  NQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTN-VFSKSLLCKRSLRE 72

Query: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487
              + H    + +    D   +     +F     LYL    +   E   H   +    L+
Sbjct: 73  LKLLRHFRGHKNITCLYDMDIVFYPDGTFNG---LYLYEELM---ECDMHQIIKSSQPLT 126

Query: 488 RARF--YTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
            A +  +  ++LC L+ +HS +V++RDLKP N+L++    + +CDFGL +   ++  + N
Sbjct: 127 DAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENN 186

Query: 546 TF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600
            F      T  Y APE++L  QGY+K +D W+ G +L E L G P +  +D      +IL
Sbjct: 187 QFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRIL 246

Query: 601 Q-------EPLR-------------------------FPDGFDREAKNLLIELLCRDPKR 628
           Q       E LR                         +PD  + +A +LL ++L  DP++
Sbjct: 247 QVLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDPQK 305

Query: 629 RLGYNGADEIKRHPFFS 645
           R+     DE   HP+ S
Sbjct: 306 RI---TTDEALEHPYLS 319

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 143/317 (45%), Gaps = 63/317 (19%)

Query: 381 NKPLSIDD-FDLLKVIGKGSFGKVMQVK------------KKDTNKIYALKAIRKSYIVS 427
           N+  S+D  F L+K IG G++G V   +            KK TN +++   + K  +  
Sbjct: 14  NQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTN-VFSKTLLCKRSLRE 72

Query: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487
              + H    + +    D   +    +   S   LYL    +        + K G+  L+
Sbjct: 73  LKLLRHFRGHKNITCLYDMDIVF---YPDGSINGLYLYEELMECD--MHQIIKSGQ-PLT 126

Query: 488 RARF--YTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
            A +  +T ++LC L+ +HS +V++RDLKP N+L++    + +CDFGL +   ++  + +
Sbjct: 127 DAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENS 186

Query: 546 TF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600
            F      T  Y APE++L  QGY+K +D W+ G +L E L G P +  +D      +IL
Sbjct: 187 QFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQIL 246

Query: 601 Q-------EPLR-------------------------FPDGFDREAKNLLIELLCRDPKR 628
           Q       E LR                         +P+  + +A +LL ++L  DP++
Sbjct: 247 QVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNA-NSQALDLLEQMLAFDPQK 305

Query: 629 RLGYNGADEIKRHPFFS 645
           R+     DE   HP+ S
Sbjct: 306 RI---TVDEALEHPYLS 319

>Scas_720.94
          Length = 1683

 Score = 92.0 bits (227), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 95/360 (26%), Positives = 153/360 (42%), Gaps = 45/360 (12%)

Query: 313  VYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQWLNMEKGLGRVNI 372
            V  A+  E +   ++   N+D+Q D  +  + L+ NS   +R       + ++   ++  
Sbjct: 1277 VMGARSNEAEKTNQQTRLNIDIQDDVDEDSM-LELNSQFRLRAIKELEKSSKRNPHQIGK 1335

Query: 373  TIDYKPSKNKPLS-----IDDFDLL----KVIGKGSFGKVMQVKKKDTNKIYALKAIRKS 423
             +D     NK LS     I +  +       IG G+FG V      D  +I A+K I+  
Sbjct: 1336 VLDDTDKGNKYLSSLASSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQ 1395

Query: 424  YIVSKSEVTHTLAER-TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEG 482
               +  ++   + E  TVL  +++P IV         +K+ + + +  GG +   L + G
Sbjct: 1396 DSKTMKKIFPLVKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSMA-SLLEHG 1454

Query: 483  RF-DLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ 541
            R  D    + YT ELL  L  LH   V++RD+KPENILLD+ G I   DFG  +   K+ 
Sbjct: 1455 RIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNG 1514

Query: 542  DK-------------------------TNTFCGTPEYLAPELLLGQGYSKVV---DWWTL 573
             K                          +   GTP Y+APE + G          D W+ 
Sbjct: 1515 TKVTNINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSF 1574

Query: 574  GVLLYEMLTGLPPY--YDEDVPKMYKKIL-QEP-LRFPDGFDREAKNLLIELLCRDPKRR 629
            G ++ EM+TG  P+   D +   +Y     Q P L +P+      +  L   L +DP +R
Sbjct: 1575 GCVVLEMITGRRPWANLDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 121/237 (51%), Gaps = 21/237 (8%)

Query: 393 KVIGKGSFGKVMQVKKKDTNKIYALKAIRKSY-----IVSKSEVTHTLAERTVLARVD-N 446
           ++I  GSF  V   +   T +  ALK +RK +     +   + + H   E  +L R+  +
Sbjct: 11  RLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHN--EYAILRRLGTH 68

Query: 447 PFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTA--ELLCALETLH 504
             I  L   ++  +    VL +   G+L+  ++        R  F++   +L  A+   H
Sbjct: 69  RNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYCH 128

Query: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFC-GTPEYLAPELLLGQG 563
           S +V +RD+KPEN+L+D +G + L DFGL ++    +D    +C GT +YLAPE  L + 
Sbjct: 129 SKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKD----YCIGTEKYLAPETFLREY 184

Query: 564 YSK-VVDWWTLGVLLYEMLTGLPPY--YDEDVPKM---YKKILQEPLRFPDGFDREA 614
           ++    D+W+LG+ ++ ++ G  P+     D PK    +++ +++P RF + +  +A
Sbjct: 185 HNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFIRDPHRFVESYYLDA 241

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 97/201 (48%), Gaps = 11/201 (5%)

Query: 394 VIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR-VDNPFIVPL 452
           V+G+G+ G V + K +   K++ALK I  + +    E    L       +   + +IV  
Sbjct: 185 VLGEGAGGSVAKCKLRTGKKVFALKTI--NILNGDPEFQKQLLRELQFNKSFKSEYIVRY 242

Query: 453 --KFSFQSPEKLYLVLAFINGGELFF----HLQKEGRFDLSRARFYTAELLCALETLHSL 506
              F+ +    +Y+ + ++ G  L       L + GR         +  +L  L  LH  
Sbjct: 243 FGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEK 302

Query: 507 NVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSK 566
            VI+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + GQ YS 
Sbjct: 303 KVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQGQPYSV 360

Query: 567 VVDWWTLGVLLYEMLTGLPPY 587
             D W+LG+ + E+  G  P+
Sbjct: 361 TCDVWSLGLTILEVAQGHFPF 381

>Scas_710.28
          Length = 352

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 108/226 (47%), Gaps = 32/226 (14%)

Query: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447
           DF L  ++G+G++G V     K T +I A+K I             TL E  +L    + 
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEP--FDKPLFALRTLREIKILKHFQHE 69

Query: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRA-----------RFYTAEL 496
            I+ + F  Q PE      +F N  E++  +Q+  + DL R            +++  + 
Sbjct: 70  NIISI-FDIQRPE------SFENFNEVYI-IQELMQTDLHRVISTQNLTDDHIQYFIYQT 121

Query: 497 LCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKL----------NMKDQDKTNT 546
           L A++ LH  NVI+RDLKP N+L++    + +CDFGL ++          N + Q+    
Sbjct: 122 LRAVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTE 181

Query: 547 FCGTPEYLAPELLLGQG-YSKVVDWWTLGVLLYEMLTGLPPYYDED 591
           +  T  Y APE++L    YSK +D W+ G +L E+    P +  +D
Sbjct: 182 YVATRWYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKD 227

>Scas_683.6
          Length = 377

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 139/307 (45%), Gaps = 56/307 (18%)

Query: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVDN- 446
           + L+ +IG+G++G V     K +    A+K I+     SK+  VT TL E  +L   +N 
Sbjct: 13  YQLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQP---FSKAMFVTRTLREIKLLTYFNNH 69

Query: 447 ----PFIVPLK-FSFQSPEKLYLVLAFINGG--ELFFHLQKEGRFDLSRARFYTAELLCA 499
                 +  +K  S    + +YLV   +      +  +            +++T ++L A
Sbjct: 70  ENIISILDKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRA 129

Query: 500 LETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCG-------TPE 552
           L+++HS  VI+RDLKP N+LL+    + +CDFGL +      D   T  G       T  
Sbjct: 130 LKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRW 189

Query: 553 YLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLP--PYYD-----------------EDV 592
           Y APE++L  Q Y+  +D W++G +L EM+TG P  P  D                 ED 
Sbjct: 190 YRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDF 249

Query: 593 PKMYKKILQE-----PLRFPDGFDREAKN---------LLIELLCRDPKRRLGYNGADEI 638
            ++  K  +E     PL+ P  +D    N         LL ++L  +P +R+    A E 
Sbjct: 250 EQIKSKRAREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRI---SAAEA 306

Query: 639 KRHPFFS 645
            +HP+ S
Sbjct: 307 LQHPYLS 313

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 158/363 (43%), Gaps = 78/363 (21%)

Query: 372 ITIDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI-------RKS 423
           I++ Y P SK K L+   ++++K +G G  GKV   +   + ++ A+K +       RK 
Sbjct: 117 ISLTYDPVSKRKVLNT--YEIIKELGHGQHGKVKLARDILSKQLVAIKIVDRHEKKQRKF 174

Query: 424 YIVSKS----EVTHTLAERTVLARVDNPFIVPLKFSFQS--PEKLYLVLAFINGGELFFH 477
           +   KS    E      E  ++ +  +  +V L          K+YLVL + + GE+ + 
Sbjct: 175 FTFIKSSKISENDKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWC 234

Query: 478 ----LQKEGR----FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALC 529
               ++ + +          R     ++  LE LH   +I+RD+KP N+L+   G + + 
Sbjct: 235 PPDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKIS 294

Query: 530 DFGLC----------KLNMKDQDKTNTFCGTPEYLAPELLLGQG---------------- 563
           DFG+                D+ +     GTP + APE+ LG+                 
Sbjct: 295 DFGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGS 354

Query: 564 -YSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELL 622
             S ++D W +GV LY +L G+ P++ +   K+++KI+ +PL+FP  F     N + ++ 
Sbjct: 355 CISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP-TFKEIQSNKVSKVS 413

Query: 623 CRD----------------PKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVM 666
           C +                P++R+       IK+HPF S       W   ++P     ++
Sbjct: 414 CEEEYEMAKDLLLKLLEKNPQKRMTIPA---IKKHPFVS-------WDFDHVPENDEKLL 463

Query: 667 SAL 669
           S++
Sbjct: 464 SSV 466

>Kwal_23.4276
          Length = 521

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 128/308 (41%), Gaps = 56/308 (18%)

Query: 395 IGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSK-----------SEVTHTLAE-RTVLA 442
           +G G F  V +     T   YA+K I K  +  K            EV+  + E      
Sbjct: 32  LGDGCFSVVKECMNILTRDRYAMKLISKKTVQGKLWLIQRELKLLKEVSCKIRELEQSQV 91

Query: 443 RVDNPF-----IVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSR-ARFYTAEL 496
              + F     ++ L   F++P+ + LV    + G+L+  + + G  D+S+  + YTA L
Sbjct: 92  NCKDTFEGHHHVLQLFDYFETPKNIVLVTQLCSHGDLYEKIIEAGSLDISKQVKSYTACL 151

Query: 497 LCALETLHSLNVIYRDLKPENILL-----------------DYQGH-IALCDFGLCKLNM 538
           L AL+ LH   V++RD+K EN+L                  D+  H + L DFGL     
Sbjct: 152 LSALDFLHENKVVHRDVKAENVLFRCRVSELSEFSRRGSHYDHTSHDLILADFGLATRCD 211

Query: 539 KDQDKTNTFCGTPEYLAPELLLGQG--------------YSKVVDWWTLGVLLYEMLTGL 584
              D+     GT  Y+APE++   G              Y   +D W LGVL Y M+TG 
Sbjct: 212 SKDDERRECVGTISYIAPEVVRCSGIARLAPSQAKLIKPYGASIDIWALGVLAYFMMTGY 271

Query: 585 PPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGAD-----EIK 639
            P +D D  +  KK + E   + D   R  +NL  +            + +D     ++K
Sbjct: 272 MP-FDCDTDEETKKCITEGDYYVDEDLRRGQNLDTKHFWNFVHLCFTVDSSDRPTSGDLK 330

Query: 640 RHPFFSQL 647
           +HPF  + 
Sbjct: 331 KHPFVQEF 338

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 151/336 (44%), Gaps = 71/336 (21%)

Query: 372 ITIDYKP-SKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKS------- 423
           ++++Y P SK K L+   +++++ +G G  GKV   +   T ++ A+K + +        
Sbjct: 99  VSLEYDPISKRKVLNT--YEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFND 156

Query: 424 -----YIVSKSEVTHTLAER--TVLARVDNPFIVPL--KFSFQSPEKLYLVLAFINGGEL 474
                +   +S +     +R   ++ +  +  +V L          K+YLVL + + GE+
Sbjct: 157 KFSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKGEI 216

Query: 475 FFH----LQKEGR----FDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHI 526
            +     ++ + R        R R     +L  LE LH   +I+RD+KP N+LL   G +
Sbjct: 217 KWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDGIV 276

Query: 527 ALCDFGLCKLNMKDQDKTNTF--------CGTPEYLAPELLLGQGYSKV----------- 567
            + DFG+  L       T++          GTP + APE+ L +   K            
Sbjct: 277 KISDFGVS-LAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPI 335

Query: 568 ----VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDR----------- 612
                D W +G+ L+ +L G+ P+  +   +++ KI+ EPL F + + +           
Sbjct: 336 ISFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVF-EPYQKIEQCQVSQVEC 394

Query: 613 -----EAKNLLIELLCRDPKRRLGYNGADEIKRHPF 643
                EA+NLL +LL ++PK+R+    A   K+HP+
Sbjct: 395 KEEYEEAQNLLNKLLEKNPKKRMAIQDA---KKHPW 427

>Kwal_23.5576
          Length = 504

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 117/241 (48%), Gaps = 27/241 (11%)

Query: 381 NKPLSIDD-FDLLKVIGKGSFGKVMQVK------------KKDTNKIYALKAIRKSYIVS 427
           N+  ++D  F L+K IG G++G V   +            KK TN +++   + K  +  
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTN-VFSKTLLCKRSLRE 72

Query: 428 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLS 487
              + H    + +    D   +     +F     LYL    +        + K G+  L+
Sbjct: 73  LKLLRHFRGHKNITCLYDMDIVFSPNNTFNG---LYLYEELMECD--IHQIIKSGQ-PLT 126

Query: 488 RARF--YTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTN 545
            A +  +  +LLCAL+ +HS +V++RDLKP N+L++    + +CDFGL +   ++  + N
Sbjct: 127 DAHYQSFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENN 186

Query: 546 TF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600
            F      T  Y APE++L  QGY+K +D W+ G +L E+L G P +  +D      +IL
Sbjct: 187 QFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRIL 246

Query: 601 Q 601
           Q
Sbjct: 247 Q 247

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,633,707
Number of extensions: 1089698
Number of successful extensions: 5190
Number of sequences better than 10.0: 702
Number of HSP's gapped: 4291
Number of HSP's successfully gapped: 787
Length of query: 708
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 599
Effective length of database: 12,822,747
Effective search space: 7680825453
Effective search space used: 7680825453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)