Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL026W48046924450.0
Kwal_26.766555144313510.0
Sklu_2430.753943113081e-177
KLLA0B12760g54237612801e-173
YKL124W (SSH4)57941512811e-173
Scas_721.12657342412201e-163
CAGL0M06545g58734511781e-157
Kwal_23.34885023393128e-31
Sklu_2101.35682153069e-30
CAGL0F07799g5802123023e-29
KLLA0D10065g4661952984e-29
ADL279W4932092881e-27
YMR171C5502152731e-25
Scas_669.105851712732e-25
KLLA0F09999g64295770.25
KLLA0A01221g87267750.38
YOR018W (ROD1)83739740.54
KLLA0F15796g43434701.5
KLLA0F13706g84255664.8
Kwal_56.24206150254664.9
YGL092W (NUP145)131743656.5
CAGL0I03586g867119657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL026W
         (471 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   946   0.0  
Kwal_26.7665                                                          525   0.0  
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         508   e-177
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   497   e-173
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   498   e-173
Scas_721.126                                                          474   e-163
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   458   e-157
Kwal_23.3488                                                          124   8e-31
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           122   9e-30
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   120   3e-29
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   119   4e-29
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   115   1e-27
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   109   1e-25
Scas_669.10                                                           109   2e-25
KLLA0F09999g complement(923413..925341) similar to sp|P09620 Sac...    34   0.25 
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...    33   0.38 
YOR018W (ROD1) [4831] chr15 (364368..366881) Protein that mediat...    33   0.54 
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    32   1.5  
KLLA0F13706g complement(1269550..1272078) similar to sp|P40341 S...    30   4.8  
Kwal_56.24206                                                          30   4.9  
YGL092W (NUP145) [1891] chr7 (337907..341860) Nuclear pore prote...    30   6.5  
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...    30   7.4  

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/469 (97%), Positives = 459/469 (97%)

Query: 1   MARYLTFCHIQDEREYIEKVGGAHGLARSKRHSDLYRSPFLNLGQANVKXXXXXXXXXXP 60
           MARYLTFCHIQDEREYIEKVGGAHGLARSKRHSDLYRSPFLNLGQANVK          P
Sbjct: 1   MARYLTFCHIQDEREYIEKVGGAHGLARSKRHSDLYRSPFLNLGQANVKELAELELLELP 60

Query: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRR 120
           RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRR
Sbjct: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRR 120

Query: 121 GNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSIFS 180
           GNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSIFS
Sbjct: 121 GNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSIFS 180

Query: 181 IGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRTGT 240
           IGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRTGT
Sbjct: 181 IGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRTGT 240

Query: 241 VFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEAD 300
           VFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEAD
Sbjct: 241 VFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEAD 300

Query: 301 QKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLYGEIG 360
           QKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLYGEIG
Sbjct: 301 QKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLYGEIG 360

Query: 361 IPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGSSTESTSMYNRQGSSG 420
           IPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGSSTESTSMYNRQGSSG
Sbjct: 361 IPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGSSTESTSMYNRQGSSG 420

Query: 421 SVAPPPATERPRSLQNVPYALQGLLDDIEERSVYEPLLPKGPRPAKSGH 469
           SVAPPPATERPRSLQNVPYALQGLLDDIEERSVYEPLLPKGPRPAKSGH
Sbjct: 421 SVAPPPATERPRSLQNVPYALQGLLDDIEERSVYEPLLPKGPRPAKSGH 469

>Kwal_26.7665
          Length = 551

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 324/443 (73%), Gaps = 16/443 (3%)

Query: 1   MARYLTFCHIQDEREYIEKVGGA-HGLARSKRHSDLYRSPFLNLGQANVKXXXXXXXXXX 59
           +A Y+TFC   DE EY E+V  A   + R KR   L    FL  GQ + +          
Sbjct: 96  IAVYVTFCG-ADESEYDEEVASAIPNMFRKKRSGVLLDGSFLTPGQFDDEHALLEQEAVE 154

Query: 60  -PRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVD 118
            PRMSRFEVELY R +EFQ M PP V  FGTY    D+Q ++DRG+Q+YY LPSINDNVD
Sbjct: 155 LPRMSRFEVELYQRCREFQKMCPPNVTEFGTYTSASDKQFIKDRGVQSYYFLPSINDNVD 214

Query: 119 RRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSI 178
             GNFLPSF+VQDKL+V FTK+N+S+STIMNYPLP NK++AVYFEVKV+KF     SNSI
Sbjct: 215 HYGNFLPSFIVQDKLDVLFTKFNRSASTIMNYPLPQNKKEAVYFEVKVFKFP--AKSNSI 272

Query: 179 FSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRT 238
           FS GLVTCPYPYF +PGM Q+SIAYESTGKLR+NN FYA+TLLPKLQEGDV+G GYRY+T
Sbjct: 273 FSCGLVTCPYPYFRIPGMAQFSIAYESTGKLRMNNPFYANTLLPKLQEGDVIGFGYRYKT 332

Query: 239 GTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLE 298
           GT+ ITHNGKK+MDLTHN+GIDLFVGIGAMNAAYTRTYT+EGLL+D DNV LR++I   +
Sbjct: 333 GTILITHNGKKLMDLTHNVGIDLFVGIGAMNAAYTRTYTREGLLEDCDNVSLRERILASD 392

Query: 299 ADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLYGE 358
           ADQK      +N+QL   HDP    I SDEIEL VNLG +GFV+VEANVKKYAFGS+YG+
Sbjct: 393 ADQKA--PRAINDQLETIHDPHNDDITSDEIELHVNLGQLGFVYVEANVKKYAFGSVYGD 450

Query: 359 IGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFF-----GNIKVNLGNGSSTESTSMY 413
           IG+PPAYNGDE K DV+LQKG++LPP YP +EL        G I V  G G S+++   Y
Sbjct: 451 IGVPPAYNGDEIKKDVVLQKGEELPPMYPTEELAPLAPPAAGTITVREG-GPSSKNIEEY 509

Query: 414 NRQGSS---GSVAPPPATERPRS 433
             + S+       P P   +P++
Sbjct: 510 EHESSAFDREEDEPEPQAPKPKA 532

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  508 bits (1308), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 254/431 (58%), Positives = 321/431 (74%), Gaps = 17/431 (3%)

Query: 1   MARYLTFCHIQDEREYIEKVGGAHGLA------RSKRHSDLYRSPFLNLGQANVKXXXXX 54
           MA Y+TFC+  DE +Y E++G  HG        R K  S      F+  G+ + +     
Sbjct: 60  MAVYVTFCN-ADESDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFDDEQAVQE 118

Query: 55  XXXX--XPRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPS 112
                   + S+FE+ELY RAKEFQ +NPP+VK+FGTY   +D+Q ++DRGIQ+YY LPS
Sbjct: 119 QEDECFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPS 178

Query: 113 INDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNY 172
           INDN+D+ GNFLPSFL+QDKL++ FTKYNKSSS IMN+PLP+N++DAVYFEVKV+K+ + 
Sbjct: 179 INDNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPS- 237

Query: 173 LASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGL 232
             SNSIF+IGL+T PYPYF MPG  ++SIAYESTGKLRI+N FYA+TLLPKL+EGDVVG 
Sbjct: 238 -KSNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGF 296

Query: 233 GYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRK 292
           GYR+R+GT+FITHNGKK++DLT NIG+DLF+G+GAMNA YT++YT EGLL D DN  L +
Sbjct: 297 GYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHE 356

Query: 293 QIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAF 352
           Q+   +   + D T  +N QL R HD  T  I SDEIELQVNLG +GFVF+EANVKKY F
Sbjct: 357 QLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVF 416

Query: 353 GSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGSSTESTSM 412
           GS+YGEIGIPP+YNGDE K D +LQKG++LPP+YP +++ FFGNIKV    G S E  +M
Sbjct: 417 GSVYGEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVR--EGPSKEQHAM 474

Query: 413 ----YNRQGSS 419
               Y R  S+
Sbjct: 475 DVEHYERASSA 485

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  497 bits (1280), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 239/376 (63%), Positives = 296/376 (78%), Gaps = 10/376 (2%)

Query: 30  KRHSDLYRSPFLNLGQ-ANVKXXXXXXXXXXPRMSRFEVELYLRAKEFQAMNPPLVKAFG 88
           KR+S L  S F+  G+  + +          P+MS FEVELY R KEFQ M+PP+VK  G
Sbjct: 92  KRNSLLLDSSFMTPGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMVKPLG 151

Query: 89  TYMCPEDRQCVRDRGIQAYYLLPSINDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIM 148
           +++  +D+Q ++DRGIQ+Y+ LPSINDNVD  G FLPSF V+DKLNV+FTK+N SSS IM
Sbjct: 152 SFLNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFFVEDKLNVSFTKFNISSSAIM 211

Query: 149 NYPLPHNKRDAVYFEVKVYKFRNYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGK 208
           NYPLP NK+DAVYFEVKVYKF+    SNSIFSIGL+TCPYPYF +PG   YSIAYESTGK
Sbjct: 212 NYPLPMNKKDAVYFEVKVYKFKT--CSNSIFSIGLMTCPYPYFRIPGTAAYSIAYESTGK 269

Query: 209 LRINNSFYASTLLPKLQEGDVVGLGYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAM 268
           LRINN+F A TLLPKL+EGDVVG GYRY +GT+FITHNGKKMMD+TH +GIDLFVG+GAM
Sbjct: 270 LRINNAFGADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKMMDVTHKVGIDLFVGLGAM 329

Query: 269 NAAYTRTYTKEGLLDDIDNVELRKQIQDLEA-------DQKRDITEVMNEQLLRPHDPRT 321
           NAAYTRTYTK+GL +D DNV  R++  +L+A           D   V+++ LL+ HDP+ 
Sbjct: 330 NAAYTRTYTKDGLFEDPDNVSFRQKWSELQAFNNGESSSDYIDARNVISKDLLQVHDPKE 389

Query: 322 RHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDD 381
             ++SD IEL VNLG +GFVF+EANVKKYAFGS+YG+IGIPPAYNGD+ K D++LQKGD+
Sbjct: 390 DTVSSDNIELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLLQKGDE 449

Query: 382 LPPKYPEDELNFFGNI 397
           LPP+YP+D ++FFG+I
Sbjct: 450 LPPEYPDDAVDFFGDI 465

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  498 bits (1281), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 254/415 (61%), Positives = 313/415 (75%), Gaps = 21/415 (5%)

Query: 1   MARYLTFCHIQDEREYIEK-------VGGAHGLARSKRHSDLYRSPFLNLGQANVKXXXX 53
           +A Y+TFC   DE EY E+        G  H L   K    L  S F + G  + +    
Sbjct: 65  IAAYVTFCG-DDESEYDEENALGTRTSGTLHSLFGKKHSGILLDSSFASPGGFDDEIVLQ 123

Query: 54  XXXXXX-PRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPS 112
                  P+MS +EVELY+RAKEFQ M+PP+VK FGTY+  +D+Q ++DRGIQ+Y+LLPS
Sbjct: 124 ERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPS 183

Query: 113 INDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNY 172
           INDN+D  GNFLPSF+VQDKL++ F+K+NKSSST+MNYPLPHN++DAVYFEVK+  FR+ 
Sbjct: 184 INDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKI--FRHI 241

Query: 173 LASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGL 232
             SNSIFSIGL T PYPYF +PGM +YSIAYESTGKLRINN F ASTLLPKL+EGD VG 
Sbjct: 242 QKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGF 301

Query: 233 GYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRK 292
           GYRY+TGT+FITHNGKK+MD+T NIGIDLF+GIGA NAAYTRTYT++GLL+D DNV  R+
Sbjct: 302 GYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFRE 361

Query: 293 QIQDLEADQKRDITEVMNEQLLRPHDP--RTRHINSDEIELQVNLGGVGFVFVEANVKKY 350
            +      + +DI EV  + L R HDP   +  + SDE+EL VNLG VGFVF+EANVKKY
Sbjct: 362 ALS-----EGKDI-EVAKD-LQRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKY 414

Query: 351 AFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGS 405
           AFGS+YG+IGIPPAYNG E K D ILQKG++LPP+Y + + NFFG++KV  G+ S
Sbjct: 415 AFGSVYGQIGIPPAYNGTEIKKDTILQKGEELPPRYADTD-NFFGSMKVKEGSSS 468

>Scas_721.126
          Length = 573

 Score =  474 bits (1220), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 247/424 (58%), Positives = 314/424 (74%), Gaps = 22/424 (5%)

Query: 1   MARYLTFCHIQDEREYIEKVGGA------HGLARSKRHSD-LYRSPFLNLGQANVK-XXX 52
           MA Y+TFC   DE EY E+ G          +  SKRH   L  S F + GQ + +    
Sbjct: 64  MAAYITFCG-ADEAEYDEESGQRPRGPPRFNILFSKRHDGILLDSSFTSPGQFDDECEHQ 122

Query: 53  XXXXXXXPRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPS 112
                   RMS FE+ELY R+ EFQ + PP +  FGTY+   D Q ++DRGIQ+Y+LLPS
Sbjct: 123 EREHTELNRMSPFELELYKRSNEFQEVAPPHIDEFGTYLKATDLQVIKDRGIQSYFLLPS 182

Query: 113 INDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNY 172
           INDNV+++GNFLPSFL+QDKL++ FTKYNKSSST+MNYPLP+ KRDAVYFEVKV+K +  
Sbjct: 183 INDNVNKQGNFLPSFLIQDKLDMVFTKYNKSSSTVMNYPLPYTKRDAVYFEVKVFKHQP- 241

Query: 173 LASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGL 232
             SN+IFSIGLVT PYPYF +PGM ++SIAYESTGKLRINN F ASTLLPKL EGDVVG 
Sbjct: 242 -VSNTIFSIGLVTVPYPYFRIPGMAKFSIAYESTGKLRINNPFMASTLLPKLVEGDVVGF 300

Query: 233 GYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRK 292
           GYRY +GT+FITHNGKK+MD+T N+G+DLFVG+GA NA+YTR+YTK+GLL+D DN+ELR+
Sbjct: 301 GYRYSSGTIFITHNGKKLMDVTQNVGVDLFVGLGAFNASYTRSYTKDGLLEDPDNIELRE 360

Query: 293 QIQDLEADQKRDITEVMNEQLLRPHDPRTRH--INSDEIELQVNLGGVGFVFVEANVKKY 350
            +      + R+I  V+ ++L R  DP   +  I+S+E+EL VNLG VGFVF+EANVKKY
Sbjct: 361 ALS-----EGREI--VLPDELQRVRDPHNENDQIDSEEVELHVNLGQVGFVFIEANVKKY 413

Query: 351 AFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPE--DELNFFGNIKVNLGNGSSTE 408
           AFG++YG IGIPP+YNG+E K D +LQKGD+LPP Y    D   FFG+I +N G+ ++ E
Sbjct: 414 AFGTVYGNIGIPPSYNGEEIKNDKLLQKGDELPPNYGTLLDSNGFFGDIHINEGHRNNEE 473

Query: 409 STSM 412
           + ++
Sbjct: 474 NANI 477

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  458 bits (1178), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/345 (62%), Positives = 281/345 (81%), Gaps = 15/345 (4%)

Query: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRR 120
           +MS FEV+ Y+RAKEFQ ++PP V+ FGTY+  +D Q ++DRGIQ+YY +PSINDNVD+ 
Sbjct: 128 KMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKS 187

Query: 121 GNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNYLASNSIFS 180
           G+FLPSFLVQDKL V FT++NKSSS ++NYPLP+NK+DAVYFEVKVY  +    SNSIFS
Sbjct: 188 GHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKP--NSNSIFS 245

Query: 181 IGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGLGYRYRTGT 240
           IGLVT PYPYF +PGMC++SIAYESTGKLRIN+ F+ STLLPKL EGDVVG GYR++TGT
Sbjct: 246 IGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGT 305

Query: 241 VFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEAD 300
           +FITHNGKK+MD+T N+ ++LF+ +GAMNA+YTRTYTK+GLL+D DN+ELR  +      
Sbjct: 306 IFITHNGKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALA----- 360

Query: 301 QKRDITEVMNEQLLRPHDP----RTRHINSDEIELQVNLGGVGFVFVEANVKKYAFGSLY 356
           + R++   +++ +  PH+P    +   I+SDEIEL VNLG  GFVF+EANVKKY FGS++
Sbjct: 361 EGRELK--LSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVF 418

Query: 357 GEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNF--FGNIKV 399
           GEIGIPPAYN ++ + D ++QKG++LPP+YPED  NF  FGN+K+
Sbjct: 419 GEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLFGNLKI 463

>Kwal_23.3488
          Length = 502

 Score =  124 bits (312), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 147/339 (43%), Gaps = 86/339 (25%)

Query: 61  RMSRFEVELYLRAKEFQAMNPPLV---------KAFGTYMCPEDRQCVRDRGIQAYYLLP 111
           RMS  E   Y + +EF   NPPL+         +     +  +  Q + + G  A+   P
Sbjct: 124 RMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHAWEFQP 183

Query: 112 SI---NDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYK 168
                ND+V          LV++K  +TF  YN   S + N P+P   R   Y E K+++
Sbjct: 184 DPKLPNDSV----------LVENKSEITFLNYNYDVSVMTNLPIPRLNR-VYYCEFKIFE 232

Query: 169 FR-----NYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS----T 219
                  N  + N + S GL T PYPYF +PG   +SIAY+STG  R N+SF  S    +
Sbjct: 233 LNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSPELAS 292

Query: 220 LLPKLQEGDVVGLGYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKE 279
           + P+ ++GDV+G+GYR  +GTVF T NGKK+ + +          IG     +   Y   
Sbjct: 293 IFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKS----------IGGHIKGWKFKYVYP 342

Query: 280 GLLDDIDNVELRKQIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVG 339
            +  +I                                 P   H+N          G  G
Sbjct: 343 IVGSNI---------------------------------PCKVHVN---------FGTYG 360

Query: 340 FVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQK 378
           FVF+EANVKK+ +    G    PP+Y  ++   DV+L+ 
Sbjct: 361 FVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLES 397

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  122 bits (306), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 113/215 (52%), Gaps = 39/215 (18%)

Query: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQ-------------CVRDRGIQAY 107
           ++S  E   Y + +E+   NPPL+    +    ED Q              + + G+ A+
Sbjct: 172 KLSPEEQFYYKQGEEYIKQNPPLLIPHRS----EDSQGMLDPIINDQTIRFIEEEGVHAW 227

Query: 108 YLLPSINDNVDRRGNFLP--SFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVK 165
              P  N         LP  + L+++K  +TF  YN  +S + N P+P   R   YFE K
Sbjct: 228 EFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNR-VYYFECK 277

Query: 166 VYKFR------NYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS- 218
           +++        NYL+ N + S GL + PYPYF +PG   +SIAY+STG  R N+SF  S 
Sbjct: 278 IFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSA 337

Query: 219 ---TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250
              ++ P+ Q+GD++G+GYR  +GTVF T NGKK+
Sbjct: 338 ELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKKL 372

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  120 bits (302), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 111/212 (52%), Gaps = 32/212 (15%)

Query: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGT-----------YMCPEDRQCVRDRGIQAYYL 109
           ++S  E   Y + +E+   NPPL+ + G+            +  + RQ + + G  A+  
Sbjct: 149 KLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEF 208

Query: 110 LPSINDNVDRRGNFLP--SFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVY 167
            P+ N         LP  + +V++K  ++F  YN  +S   N P+P   R   Y E K++
Sbjct: 209 QPNPN---------LPNDTIIVENKTEISFLNYNYDASVTTNLPIPCINR-VYYCEFKIF 258

Query: 168 KF-----RNYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFY----AS 218
           +      +  L  N I S GL T PYPYF +PG   +SIAY+S G  R N+SF      +
Sbjct: 259 ELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPELA 318

Query: 219 TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250
            L PK Q+GD++G+GYR R+GTVF T NGKK+
Sbjct: 319 DLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKI 350

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 330 ELQVNLGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKG 379
           ++ VN G  GFVF+EANVKK+ +    G    PP+Y  D+   D +L+ G
Sbjct: 378 KIHVNFGSYGFVFIEANVKKWGYAKPNGIKLPPPSY--DDYVQDTLLESG 425

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  119 bits (298), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 112/195 (57%), Gaps = 16/195 (8%)

Query: 70  YLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPSINDNVDRRGNF-----L 124
           Y + +E+   NPPL+  +     PE+R+ V    I     L  I +       F     L
Sbjct: 115 YKQGEEYVKQNPPLLVPYLP-NDPENREEVIPDPIVNEQTLQFIEEEGAAAWEFQADPNL 173

Query: 125 P--SFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKF---RNYLASNSIF 179
           P  + ++Q++  +TF  ++  +S +   P+P   +   Y+E K+++    +N+L+ N + 
Sbjct: 174 PNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMI 232

Query: 180 SIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS----TLLPKLQEGDVVGLGYR 235
           SIGL T PYPYF +PG   +SI+Y+S G  R+N+SF  S    TL P+ ++GDV+G+GYR
Sbjct: 233 SIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYR 292

Query: 236 YRTGTVFITHNGKKM 250
            R+GT+F THNGKK+
Sbjct: 293 TRSGTIFFTHNGKKL 307

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  115 bits (288), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 109/209 (52%), Gaps = 37/209 (17%)

Query: 70  YLRAKEFQAMNPPLVKAF------GTYMCPED----------RQCVRDRGIQAYYLLPSI 113
           Y + +EF   NPP +  +      G++  P D           + + + G QA+   PS 
Sbjct: 117 YKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPS- 175

Query: 114 NDNVDRRGNFLPSFL-VQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRN- 171
                   +  P F+ V+++  +TF   N   S   N P+P   +   YFE K+++  + 
Sbjct: 176 -------PSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANK-VYYFECKIFELCDR 227

Query: 172 ------YLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFY----ASTLL 221
                 +L+ N I S GL T PYPYF +PG   +S+AY+S G  R+NNSF      S+L 
Sbjct: 228 LGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLF 287

Query: 222 PKLQEGDVVGLGYRYRTGTVFITHNGKKM 250
           P+ ++GDV+G+GYR R+GTVF T NGKK+
Sbjct: 288 PRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 109/215 (50%), Gaps = 33/215 (15%)

Query: 61  RMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPED----------------RQCVRDRGI 104
           ++S  E   Y + +E+   NPP +   G     ED                RQ +++ G 
Sbjct: 131 QLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGA 190

Query: 105 QAYYLLPSINDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEV 164
            A+   P    N D   +   + +V++K  V+F  YN  +S   N P+P   +   Y E 
Sbjct: 191 YAWEFSP----NPDMPNH---TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEF 242

Query: 165 KVYKFRNYLASNS-----IFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYAS- 218
           K+++    L S+      + S GL T PYPYF +PG   +SIAY+S G  R N+SF  + 
Sbjct: 243 KIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNE 302

Query: 219 ---TLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250
              TL P+ ++GD+VG+GYR R+GTVF T NGKK+
Sbjct: 303 QLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKKL 337

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 49/98 (50%), Gaps = 10/98 (10%)

Query: 330 ELQVNLGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPED 389
           ++ VN G  GFV++EANVKK+ +    G I +PP    D  K  ++   G+D    + ED
Sbjct: 365 QIHVNFGTYGFVYIEANVKKWGYAKSNG-IKLPPPSYEDYGKDTLLESGGED--NDFDED 421

Query: 390 ELNFFGNIKVNLGNGSSTE-STSMYNRQGSSGSVAPPP 426
              F      N+  GS+T  +  +  R   +G + PPP
Sbjct: 422 ---FSDGDSDNIAAGSTTNLNDDIIIR---NGEILPPP 453

>Scas_669.10
          Length = 585

 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 92/171 (53%), Gaps = 21/171 (12%)

Query: 91  MCPEDRQCVRDRGIQAYYLLPSINDNVDRRGNFLP--SFLVQDKLNVTFTKYNKSSSTIM 148
           M  + +Q + + G  A+      N         LP  + L+++K  +TF  YN  +S + 
Sbjct: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239

Query: 149 NYPLPHNKRDAVYFEVKVYKFRNY-----LASNSIFSIGLVTCPYPYFVMPGMCQYSIAY 203
           N P+P   R   Y E K+++  N      L+ N + S+GL T PYPYF +PG   +SIAY
Sbjct: 240 NLPIPCINR-VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAY 298

Query: 204 ESTGKLRINNSF----YASTLLPKLQEGDVVGLGYRYRTGTVFITHNGKKM 250
           +S G  R N+SF      + L P  + GD++G+GYR R+GT F T NGKK+
Sbjct: 299 DSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 330 ELQVNLGGVGFVFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDL 382
           ++ VN G  GFV++EANVKK+ +   +G    PP+Y  +E   D ++    DL
Sbjct: 377 KVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY--EEYGKDALVGSYQDL 427

>KLLA0F09999g complement(923413..925341) similar to sp|P09620
           Saccharomyces cerevisiae YGL203c KEX1 carboxypeptidase
           (YSC-alpha), start by similarity
          Length = 642

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 16/95 (16%)

Query: 295 QDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNL-------GGVGFVFVEANV 347
           ++L ADQK+D  E         +  + RH NSD+ E+ V L       G + + F+    
Sbjct: 520 EELSADQKQDEDE---------NSHKDRHRNSDKFEIAVILLVVFSITGTIAYYFLRERF 570

Query: 348 KKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDL 382
           +K     L      PP+ N      D I  +GDD 
Sbjct: 571 RKQIHAILIDPENRPPSSNKSVAWADDIENQGDDF 605

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 228 DVVGLGYRYRTGTVFITHNGKKMMDLTHN-IGIDL--FVGIGAMNAAYTRTYTKEGLLDD 284
           D+VG G  +  G++F T NG  + +   +   IDL  FV I + N+  T     E  L D
Sbjct: 461 DIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFD 520

Query: 285 IDNVELR 291
           ID  +L+
Sbjct: 521 IDQYQLQ 527

>YOR018W (ROD1) [4831] chr15 (364368..366881) Protein that mediates
           resistance to o-dinitrobenzene (O-DNB) [2514 bp, 837 aa]
          Length = 837

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query: 363 PAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNL 401
           P+Y+    K+D+I   G+DLPP YPE+EL    N K+ L
Sbjct: 640 PSYDK-AMKSDMI---GEDLPPAYPEEELGVQENKKIEL 674

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 100 RDRGIQAYYLLPSINDNVDRRGNFLPSFLVQDKL 133
           R+  +Q   +L S+ND ++RR N LP +L Q K+
Sbjct: 213 REEALQKNNILNSLNDFIERRSNELPQYLDQIKI 246

>KLLA0F13706g complement(1269550..1272078) similar to sp|P40341
           Saccharomyces cerevisiae YMR089c YTA12 protease of the
           SEC18/CDC48/PAS1 family of ATPases (AAA), start by
           similarity
          Length = 842

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 266 GAMNAAYTRTYTKEGLLDDIDNV--ELRKQIQDLEADQKRDITE---VMNEQLLR 315
           G +N    R + KE   +D+D V  E+RK I DL  DQK D+ E    + EQL R
Sbjct: 44  GKLNLMQNR-FEKEPTDEDVDKVRKEVRKFIDDLNKDQKLDMEERKKKIEEQLQR 97

>Kwal_56.24206
          Length = 1502

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%)

Query: 264  GIGAMNAAYTRTYTKEGLLDDIDNVELRKQIQDLEADQKRDITEVMNEQLLRPH 317
            G   +N +Y+   TKE  +DD+  ++L ++      DQ+  + EV N+ +   H
Sbjct: 1169 GRFGINDSYSLLLTKENAIDDLFKLDLIQKFDGSATDQRLTLLEVPNKSIFSRH 1222

>YGL092W (NUP145) [1891] chr7 (337907..341860) Nuclear pore protein
           (nucleoporin) required for nuclear envelope structure,
           contains GLFG repeat motifs [3954 bp, 1317 aa]
          Length = 1317

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 23/43 (53%)

Query: 385 KYPEDELNFFGNIKVNLGNGSSTESTSMYNRQGSSGSVAPPPA 427
           ++P+     FGN+ VN    + + S  ++N   ++ S++  PA
Sbjct: 32  QFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPA 74

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
           cerevisiae YDL154w MSH5 meiosis-specific protein,
           hypothetical start
          Length = 867

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 52/119 (43%), Gaps = 7/119 (5%)

Query: 289 ELRKQIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVK 348
           + +K    LEA  K  + +++ E+LL     R  H+N  E    + +  +GF+    N +
Sbjct: 396 QFKKVYTRLEAMLKTIVDDII-EELLSDSKNRLDHLNLAEGLNALYIPQLGFLVTIENTR 454

Query: 349 KYAFGSLYGEIGIPPAYNGDET---KTDVILQKGD---DLPPKYPEDELNFFGNIKVNL 401
            + +G ++G +     +  +     K  ++    D   DL  K  E +L    N++ NL
Sbjct: 455 VHYWGEVWGSLNWQLVFKDNSHHYYKNSMVTSLDDEFGDLMTKIFELKLEILANVRENL 513

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,901,049
Number of extensions: 718826
Number of successful extensions: 2120
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2115
Number of HSP's successfully gapped: 41
Length of query: 471
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 366
Effective length of database: 12,961,219
Effective search space: 4743806154
Effective search space used: 4743806154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)