Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL023W30930313540.0
YKL120W (OAC1)3243007004e-91
KLLA0B12826g3193066933e-90
Kwal_26.76533253186935e-90
CAGL0K11616g3203086891e-89
Scas_721.1293233066857e-89
Sklu_2430.103243006727e-87
CAGL0L02079g2972921753e-14
Kwal_26.79672973031701e-13
Scas_489.42973011701e-13
YBR291C (CTP1)2993071683e-13
KLLA0E18810g3773091676e-13
Scas_602.88852951661e-12
ADL049W9122631614e-12
Kwal_47.192282811501576e-12
YOR222W (ODC2)3073091578e-12
CAGL0C02013g3291401561e-11
Sklu_2432.52882741551e-11
KLLA0E13453g9062911544e-11
Scas_640.253062851514e-11
Sklu_1149.22963111505e-11
Sklu_2334.23192731506e-11
CAGL0K02365g9192671501e-10
AFR253W3441181472e-10
Kwal_47.173218812951492e-10
Kwal_26.86692962831443e-10
YPR021C (AGC1)9022911473e-10
KLLA0A00979g3431141444e-10
Sklu_2359.69022721465e-10
YJR095W (SFC1)3222771435e-10
YPL134C (ODC1)3102941427e-10
CAGL0L05742g3051661401e-09
CAGL0J02002g3611591402e-09
KLLA0D15015g3172911392e-09
Scas_709.93651571392e-09
CAGL0M09020g3482491382e-09
Sklu_2431.53701381383e-09
KLLA0E23705g3681371374e-09
ACR109W2992841355e-09
YFR045W2851611355e-09
Kwal_47.182163333051348e-09
Sklu_2433.84201231358e-09
ADL009W3792851348e-09
YEL006W3351511339e-09
Kwal_27.120813691391331e-08
Scas_691.43342951331e-08
KLLA0D07073g2972841321e-08
Sklu_2037.23101791321e-08
KLLA0F03212g3052731302e-08
ACR260W3111791302e-08
Scas_589.103162881302e-08
Scas_687.15*3281141302e-08
AGL311C3621901293e-08
Scas_379.23011661284e-08
Sklu_2363.23232851275e-08
Kwal_55.208683801891276e-08
Sklu_2117.22981701276e-08
YIL006W3731501251e-07
KLLA0F13464g3001581241e-07
CAGL0J01661g3272951241e-07
CAGL0J09790g3001581232e-07
CAGL0G01166g2952761232e-07
Kwal_33.140503141741222e-07
KLLA0D09889g3641971222e-07
AFR146W2812731213e-07
KLLA0D14036g4311711214e-07
KLLA0F04697g3071771204e-07
CAGL0K10362g3012811204e-07
KLLA0A09383g3661921205e-07
AFL196W3611771197e-07
AGR383W2931671178e-07
YBR192W (RIM2)3771401189e-07
Kwal_23.35293951771171e-06
AGL064W2961161151e-06
Scas_562.123001581152e-06
CAGL0K08250g2971751152e-06
Sklu_2075.33452911152e-06
Scas_702.103021381152e-06
YLR348C (DIC1)2981241133e-06
YER053C3001661133e-06
AAR036W3172901134e-06
AER366W2931231124e-06
Kwal_23.39653072901125e-06
Scas_632.92923061115e-06
CAGL0J04114g303711116e-06
YGR257C (MTM1)3661831116e-06
Scas_582.73291691117e-06
YDL198C (YHM1)3001581107e-06
Kwal_23.43543431891107e-06
Kwal_27.116262991581098e-06
CAGL0G08910g2891621098e-06
AFR131C3441831091e-05
YOR130C (ORT1)2921861091e-05
Kwal_14.22103153111091e-05
AGL047C3162811081e-05
AEL253W3651891081e-05
Scas_721.273741871072e-05
CAGL0G03135g3073101053e-05
CAGL0H03839g2821701044e-05
Kwal_23.57573071751044e-05
CAGL0F04213g3062621044e-05
Kwal_55.213383232561036e-05
Kwal_55.213353172661036e-05
YMR166C3682001028e-05
YPR011C3261841011e-04
Kwal_23.30425421861021e-04
KLLA0E09680g3072891001e-04
AGR191W2981581001e-04
Scas_558.22891811001e-04
Kwal_23.2913320781002e-04
YNL003C (PET8)284166992e-04
Scas_667.4308261992e-04
CAGL0K07436g307127992e-04
Scas_662.1230871982e-04
YGR096W (TPC1)314172982e-04
Scas_645.9391187992e-04
CAGL0F07711g368178983e-04
AAL014C271165973e-04
Kwal_23.4731314179973e-04
YIL134W (FLX1)311165964e-04
Scas_669.6373191965e-04
Scas_715.45305170965e-04
Sklu_2260.5302171955e-04
KLLA0E02772g284264955e-04
YNL083W545185965e-04
YKR052C (MRS4)304175956e-04
YMR241W (YHM2)314152956e-04
CAGL0M05225g381183956e-04
Kwal_33.15446305292947e-04
Scas_714.18305136930.001
CAGL0B03883g306295930.001
YBR085W (AAC3)307265930.001
KLLA0F08547g308126920.001
Sklu_2374.7513149930.001
Scas_696.9312122920.001
Scas_328.1227118910.001
CAGL0F08305g374192920.001
YMR056C (AAC1)309124910.002
Sklu_2398.4309151910.002
Sklu_2127.5278264910.002
Sklu_2435.2344263900.002
Kwal_27.11419298182890.003
KLLA0D04950g274167890.003
KLLA0C11363g517185900.003
Sklu_2127.4323174890.004
Scas_718.24337114890.004
AER419W493151880.005
CAGL0J05522g519186880.006
Scas_578.3*524167870.006
Scas_667.22306139860.007
YBL030C (PET9)318114860.008
CAGL0D01606g305151860.008
AER450C308165850.009
KLLA0D04290g188126830.011
Scas_697.4732888850.011
YPR128C (ANT1)32883850.011
KLLA0E08877g294181840.011
Kwal_0.232274166840.012
AFR542W310123840.013
Scas_718.5324176840.014
Kwal_27.12481304262830.018
KLLA0E15532g326187830.019
KLLA0E12353g305290820.021
Sklu_1926.2305157820.024
Scas_716.29316299820.027
Kwal_56.23011303153810.030
CAGL0B04543g31776810.032
Sklu_2194.3312126810.032
Kwal_33.15597305170810.033
Kwal_55.21106328172800.037
Scas_673.17314170800.040
Kwal_27.12599304153790.060
ADR036C340265780.068
AFR147C315251780.077
Sklu_1275.1311153780.078
KLLA0C13431g328170770.096
AER184W30544770.097
YJR077C (MIR1)311171760.11
ADL264C32996760.12
Scas_717.2035676760.15
KLLA0B14454g305174750.18
CAGL0F00231g307169750.19
Sklu_2115.429993740.22
KLLA0D04312g10389700.23
Scas_671.1*12369700.27
Sklu_1119.1307170730.31
KLLA0E02750g304164730.34
Scas_705.932374720.40
YHR002W (LEU5)35772700.76
YPR058W (YMC1)307172700.80
KLLA0B11319g35529681.3
CAGL0K12210g311131681.3
CAGL0K02915g34276681.5
YBR104W (YMC2)329150671.8
YDL119C30771661.9
Kwal_33.12988303157661.9
Kwal_47.1693061180662.4
YJL133W (MRS3)31450652.7
AGL065C335112643.7
Kwal_26.797235872644.5
KLLA0F17864g30762635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL023W
         (303 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...   526   0.0  
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...   274   4e-91
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...   271   3e-90
Kwal_26.7653                                                          271   5e-90
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...   270   1e-89
Scas_721.129                                                          268   7e-89
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                        263   7e-87
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    72   3e-14
Kwal_26.7967                                                           70   1e-13
Scas_489.4                                                             70   1e-13
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    69   3e-13
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    69   6e-13
Scas_602.8                                                             69   1e-12
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    67   4e-12
Kwal_47.19228                                                          65   6e-12
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    65   8e-12
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    65   1e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       64   1e-11
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    64   4e-11
Scas_640.25                                                            63   4e-11
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         62   5e-11
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         62   6e-11
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    62   1e-10
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    61   2e-10
Kwal_47.17321                                                          62   2e-10
Kwal_26.8669                                                           60   3e-10
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    61   3e-10
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    60   4e-10
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          61   5e-10
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    60   5e-10
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    59   7e-10
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    59   1e-09
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    59   2e-09
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    58   2e-09
Scas_709.9                                                             58   2e-09
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    58   2e-09
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            58   3e-09
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    57   4e-09
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    57   5e-09
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    57   5e-09
Kwal_47.18216                                                          56   8e-09
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       57   8e-09
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    56   8e-09
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    56   9e-09
Kwal_27.12081                                                          56   1e-08
Scas_691.4                                                             56   1e-08
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    55   1e-08
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         55   1e-08
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    55   2e-08
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    55   2e-08
Scas_589.10                                                            55   2e-08
Scas_687.15*                                                           55   2e-08
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    54   3e-08
Scas_379.2                                                             54   4e-08
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          54   5e-08
Kwal_55.20868                                                          54   6e-08
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            54   6e-08
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    53   1e-07
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    52   1e-07
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    52   1e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    52   2e-07
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    52   2e-07
Kwal_33.14050                                                          52   2e-07
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    52   2e-07
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    51   3e-07
KLLA0D14036g complement(1203522..1204817) some similarities with...    51   4e-07
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    51   4e-07
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    51   4e-07
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    51   5e-07
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    50   7e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    50   8e-07
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    50   9e-07
Kwal_23.3529                                                           50   1e-06
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    49   1e-06
Scas_562.12                                                            49   2e-06
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    49   2e-06
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                49   2e-06
Scas_702.10                                                            49   2e-06
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    48   3e-06
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    48   3e-06
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    48   4e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    48   4e-06
Kwal_23.3965                                                           48   5e-06
Scas_632.9                                                             47   5e-06
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    47   6e-06
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    47   6e-06
Scas_582.7                                                             47   7e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    47   7e-06
Kwal_23.4354                                                           47   7e-06
Kwal_27.11626                                                          47   8e-06
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    47   8e-06
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    47   1e-05
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    47   1e-05
Kwal_14.2210                                                           47   1e-05
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    46   1e-05
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    46   1e-05
Scas_721.27                                                            46   2e-05
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    45   3e-05
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    45   4e-05
Kwal_23.5757                                                           45   4e-05
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    45   4e-05
Kwal_55.21338                                                          44   6e-05
Kwal_55.21335                                                          44   6e-05
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    44   8e-05
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    44   1e-04
Kwal_23.3042                                                           44   1e-04
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    43   1e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    43   1e-04
Scas_558.2                                                             43   1e-04
Kwal_23.2913                                                           43   2e-04
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    43   2e-04
Scas_667.4                                                             43   2e-04
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    43   2e-04
Scas_662.12                                                            42   2e-04
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    42   2e-04
Scas_645.9                                                             43   2e-04
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    42   3e-04
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    42   3e-04
Kwal_23.4731                                                           42   3e-04
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    42   4e-04
Scas_669.6                                                             42   5e-04
Scas_715.45                                                            42   5e-04
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         41   5e-04
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    41   5e-04
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    42   5e-04
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    41   6e-04
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    41   6e-04
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    41   6e-04
Kwal_33.15446                                                          41   7e-04
Scas_714.18                                                            40   0.001
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    40   0.001
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    40   0.001
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    40   0.001
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       40   0.001
Scas_696.9                                                             40   0.001
Scas_328.1                                                             40   0.001
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    40   0.001
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    40   0.002
Sklu_2398.4 , Contig c2398 9476-10405                                  40   0.002
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         40   0.002
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         39   0.002
Kwal_27.11419                                                          39   0.003
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    39   0.003
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    39   0.003
Sklu_2127.4 , Contig c2127 6322-7293                                   39   0.004
Scas_718.24                                                            39   0.004
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    39   0.005
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    39   0.006
Scas_578.3*                                                            38   0.006
Scas_667.22                                                            38   0.007
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    38   0.008
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    38   0.008
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    37   0.009
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    37   0.011
Scas_697.47                                                            37   0.011
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    37   0.011
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    37   0.011
Kwal_0.232                                                             37   0.012
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    37   0.013
Scas_718.5                                                             37   0.014
Kwal_27.12481                                                          37   0.018
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    37   0.019
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    36   0.021
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          36   0.024
Scas_716.29                                                            36   0.027
Kwal_56.23011                                                          36   0.030
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    36   0.032
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            36   0.032
Kwal_33.15597                                                          36   0.033
Kwal_55.21106                                                          35   0.037
Scas_673.17                                                            35   0.040
Kwal_27.12599                                                          35   0.060
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    35   0.068
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    35   0.077
Sklu_1275.1 , Contig c1275 314-1249                                    35   0.078
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    34   0.096
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    34   0.097
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    34   0.11 
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    34   0.12 
Scas_717.20                                                            34   0.15 
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    33   0.18 
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    33   0.19 
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            33   0.22 
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    32   0.23 
Scas_671.1*                                                            32   0.27 
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             33   0.31 
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    33   0.34 
Scas_705.9                                                             32   0.40 
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    32   0.76 
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    32   0.80 
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    31   1.3  
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    31   1.3  
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    31   1.5  
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    30   1.8  
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    30   1.9  
Kwal_33.12988                                                          30   1.9  
Kwal_47.16930                                                          30   2.4  
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    30   2.7  
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    29   3.7  
Kwal_26.7972                                                           29   4.5  
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    29   5.7  

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/303 (88%), Positives = 269/303 (88%)

Query: 1   MSPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60
           MSPSTDTPVSKLGSF           TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV
Sbjct: 1   MSPSTDTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60

Query: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXX 120
           SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTY        
Sbjct: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVN 120

Query: 121 XXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGV 180
                          SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGV
Sbjct: 121 ATAGAAAGMIGAALGSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGV 180

Query: 181 DAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTR 240
           DAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTR
Sbjct: 181 DAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTR 240

Query: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300
           MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV
Sbjct: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300

Query: 301 ENR 303
           ENR
Sbjct: 301 ENR 303

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score =  274 bits (700), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 192/300 (64%), Gaps = 5/300 (1%)

Query: 9   VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68
           +SK GSF           T TNPIE +K R+QLQGE+ A  +++Y  P Q +++I++ EG
Sbjct: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79

Query: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXX 128
           ++GLQ+GL  AY YQI LNGSRLG Y+P+R++L      D+  +                
Sbjct: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASG 139

Query: 129 XXXXXXXSPLQLVKTRMQALAPR-RVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALL 185
                  SPL LVKTR+Q+ +   ++       G    LV +FK  GV+GL++G+DAA+L
Sbjct: 140 IIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199

Query: 186 RTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYH 243
           RTG GS+VQL +Y+ AK  L ++  + DG AL+  AS +S + V + MNP+DV +TR+Y+
Sbjct: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259

Query: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
            +G LY+GP+DCL KTVR EG +ALYKG  AQ+ RIAPHTI+CLT MEQ +++V  +E+R
Sbjct: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score =  271 bits (693), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 188/306 (61%), Gaps = 17/306 (5%)

Query: 9   VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68
           VSK GSF           T TNP + VKTR+QLQGEL A  +++Y+ P QA  +I++ EG
Sbjct: 18  VSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEG 77

Query: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXX 128
           + GLQ+GLA AY YQI LNGSRLG Y+P+R  L      +  ++                
Sbjct: 78  IAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSG 137

Query: 129 XXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRR---------LVALFKDRGVRGLYQG 179
                  SPL LVKTRMQ+ +          +G++         L  +F+  G++GL++G
Sbjct: 138 VVGAFIGSPLFLVKTRMQSYSNAI------HIGQQTHYTSAFNGLATIFRSEGIKGLFRG 191

Query: 180 VDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVA 237
           VDAA+LRTG+GSAVQL +Y+  K  L +H  + DG  L+ L+S ++   V +AMNP+DV 
Sbjct: 192 VDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVV 251

Query: 238 MTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
           +TR+Y+ +G LY GP+DC  KTVR EG SALYKG  AQ+LRI PHT+LCLT MEQ L++V
Sbjct: 252 LTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLV 311

Query: 298 RLVENR 303
             VE+R
Sbjct: 312 YSVESR 317

>Kwal_26.7653
          Length = 325

 Score =  271 bits (693), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 142/318 (44%), Positives = 192/318 (60%), Gaps = 21/318 (6%)

Query: 1   MSPSTDTP----VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGP 56
           ++   D P    VSK GSF           T TNPIE VKTR+QLQGE+ A   R+Y  P
Sbjct: 10  LAAEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP 69

Query: 57  AQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXX 116
            QA+ +I++ EG+RGLQ+GL+CAY YQI LNGSRLG Y+P+R+ L          +    
Sbjct: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129

Query: 117 XXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRR---------LVAL 167
                              SPL L+KTRMQ+ +         ++G++         L ++
Sbjct: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAI------QIGQQTHYTSIWNGLSSI 183

Query: 168 FKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSV 225
           ++  G +GLY+GVDAA+LRTG GS+VQL +Y+ AK  L +H  + +G  L+ +AS +S  
Sbjct: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF 243

Query: 226 AVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTIL 285
            V + MNP+DV +TR+Y+ +G LY+GPLDC  KTVR EG  ALYKG  AQ+ RIAPHTIL
Sbjct: 244 GVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTIL 303

Query: 286 CLTLMEQALRVVRLVENR 303
           CLT MEQ ++VV  VE +
Sbjct: 304 CLTFMEQTMKVVYAVEKQ 321

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score =  270 bits (689), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 1   MSPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60
           +  S    VSK GSF           T TNPIE VK R+QLQGEL+A   R+Y+ P QA+
Sbjct: 8   IQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAM 67

Query: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXX 120
            +++R EG+RGLQ+GL  AY YQI LNGSRLG Y+P+RA +      D+ ++        
Sbjct: 68  GVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN 127

Query: 121 XXXXXXXXXXXXXXXSPLQLVKTRMQALAPR-RVPPLPGRMG--RRLVALFKDRGVRGLY 177
                          SPL LVKTR+Q+ +   ++       G    L  ++   GV+GL+
Sbjct: 128 VFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187

Query: 178 QGVDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFD 235
           +G+DAA+LRTG GS+VQL +Y+ AK  L R+  + DG +L+  AS +S + V + MNP+D
Sbjct: 188 RGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWD 247

Query: 236 VAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
           V +TR+Y+ +G LY+GP+DCL KTV+ EG +ALYKG  AQ+ RI PHTILCLT +EQ ++
Sbjct: 248 VILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMK 307

Query: 296 VVRLVENR 303
           +V   E++
Sbjct: 308 LVHAFESK 315

>Scas_721.129
          Length = 323

 Score =  268 bits (685), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 187/306 (61%), Gaps = 17/306 (5%)

Query: 9   VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68
           VSK GSF           TFTNPIE VK R+QLQGEL A   ++Y  P Q + +I+R EG
Sbjct: 19  VSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEG 78

Query: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXX 128
           +RGLQ+GL  AY YQI LNGSRLG Y+P+R AL      +  ++                
Sbjct: 79  IRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSG 138

Query: 129 XXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRR---------LVALFKDRGVRGLYQG 179
                  SPL LVKTRMQ+ +         ++G +         L  + +  G +GL++G
Sbjct: 139 IIGAVIGSPLFLVKTRMQSYSDAI------KIGEQTHYRNVWNGLSTIARTEGFKGLFRG 192

Query: 180 VDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVA 237
           +DAA+LRTG GS+VQL +Y+ AK  L ++  + DG  L+  AS +S + V + MNP+DV 
Sbjct: 193 IDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVI 252

Query: 238 MTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
           +TR+Y+ +G LY+GP+DC  KTVR EG SALYKG  AQ+LRIAPHTI+CLT MEQ +++V
Sbjct: 253 LTRIYNQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLV 312

Query: 298 RLVENR 303
             VE++
Sbjct: 313 YSVESK 318

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score =  263 bits (672), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 136/300 (45%), Positives = 185/300 (61%), Gaps = 5/300 (1%)

Query: 9   VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68
           VSK+GSF           T TNP E VKTR+QLQGE+ A   R+Y  P QA+ +I++ EG
Sbjct: 21  VSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEG 80

Query: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXX 128
           ++GLQ+GL  AY YQI LNGSRLG Y+P+R  L      +   +                
Sbjct: 81  VKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSG 140

Query: 129 XXXXXXXSPLQLVKTRMQALAPR-RVPPLP--GRMGRRLVALFKDRGVRGLYQGVDAALL 185
                  SPL LVKTRMQ+ +   ++        M   L  +FK  GV GL++GVDAA+L
Sbjct: 141 IIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAIL 200

Query: 186 RTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYH 243
           RTG GS+VQL +Y+  K  L ++  + +G AL+ L+S ++ + V I MNP+DV +TR+Y+
Sbjct: 201 RTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYN 260

Query: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
            +G  Y+GP+DC+ KT++ EG  ALYKG  AQL RIAPHTILCLT MEQ +++V  VE+R
Sbjct: 261 QKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVYAVESR 320

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 107/292 (36%), Gaps = 22/292 (7%)

Query: 14  SFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQ 73
           SF           + T P E  KTRLQL    +   S+    P   +    +T+G+  + 
Sbjct: 13  SFVAGALAGAVEASITYPFEFAKTRLQL----IDKSSKASRNPLVLIYNTAKTQGVGAIY 68

Query: 74  QGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXX 133
            G             +R   YD +R      +L D++T                      
Sbjct: 69  VGCPAFIVGNTAKAATRFLGYDTIRN-----LLKDKKTGELSGPRGVLAGLGAGLLESVV 123

Query: 134 XXSPLQLVKTRM----QALAPRRVPPLPGR-MGRRLVALFKDRGVRGLYQGVDAALLRTG 188
             +P + +KT +    Q++ P+      GR M R  ++L KD G RGLY GV    +R  
Sbjct: 124 AVTPFEAIKTVLIDDKQSVRPKYQNN--GRSMARNYISLVKDEGFRGLYGGVLPVSMRQA 181

Query: 189 VGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVAVCIAMNPFDVAMTRMY 242
              AV+L  Y+  K  +  +       P    L  +  A S V    A  P D   TRM 
Sbjct: 182 ANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQ 241

Query: 243 HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
                 Y   L+C     ++EG    +KG   +L R+     +  T+ E  L
Sbjct: 242 SLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>Kwal_26.7967
          Length = 297

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 117/303 (38%), Gaps = 28/303 (9%)

Query: 9   VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68
           V  L SF           + T P E  KTRLQL       V +  +     ++LIYRT  
Sbjct: 7   VDPLHSFLAGSLAGAVEASITYPFEFAKTRLQL-------VDKSSTASRNPLTLIYRTAK 59

Query: 69  LRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXXXXXXXXX 124
           ++GL        A+ I+ N ++ G+    +D ++      +L D  T             
Sbjct: 60  VQGLGAVYVGCPAF-IVGNTAKAGVRFLGFDAIKN-----ILRDPTTGELSGPRGIVAGL 113

Query: 125 XXXXXXXXXXXSPLQLVKTRM----QALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGV 180
                      +P + +KT +    Q+ +P+      G M R   +L  D+G  GLY+GV
Sbjct: 114 GAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRG-MLRNYSSLVYDKGFSGLYRGV 172

Query: 181 DAALLRTGVGSAVQLAVYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIAMNPF 234
               +R     AV+L  Y+  K  +      ++  P    +  +  A S +       P 
Sbjct: 173 LPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPI 232

Query: 235 DVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           D   TRM       Y   ++C     R+EG    +KG   +L R+     +  T+ E+ L
Sbjct: 233 DTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVL 292

Query: 295 RVV 297
            V+
Sbjct: 293 VVL 295

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 41/101 (40%), Gaps = 6/101 (5%)

Query: 2   SPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVS 61
           + + D P+S   +F             T PI+TVKTR+Q         S  YS      +
Sbjct: 202 NSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLD------SSKYSSTINCFA 255

Query: 62  LIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALG 102
            ++R EGL+   +G        IL  G    +Y+ +   LG
Sbjct: 256 TVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLG 296

>Scas_489.4
          Length = 297

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 113/301 (37%), Gaps = 28/301 (9%)

Query: 8   PVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTE 67
           PV  L SF           + T P E  KTRLQL       + +  +     + LIY T 
Sbjct: 7   PVDPLHSFIAGALAGAIEASITYPFEFAKTRLQL-------IDKTSTASRNPLVLIYNTA 59

Query: 68  GLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXXXXXXXX 123
             +G         A+ I+ N ++ G+    +D ++      +L D  T            
Sbjct: 60  KTQGTGAIYVGCPAF-IVGNTAKAGIRFLGFDTIKN-----MLRDPVTGELSGPRGVVAG 113

Query: 124 XXXXXXXXXXXXSPLQLVKTRM----QALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQG 179
                       +P + +KT +    QAL P+      G M R   +L +D+G+ GLY+G
Sbjct: 114 LGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRG-MLRNYGSLVRDQGIMGLYRG 172

Query: 180 VDAALLRTGVGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVAVCIAMNP 233
           V    +R     AV+L  Y+  K  +  +       P    L  +  A S V       P
Sbjct: 173 VLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMP 232

Query: 234 FDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
            D   TRM       Y   ++C  K  ++EG    +KG   +L R+     +  T+ E  
Sbjct: 233 IDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENV 292

Query: 294 L 294
           L
Sbjct: 293 L 293

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 6   DTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYR 65
           D P+S   +F             T PI+TVKTR+Q         +  Y+      + I++
Sbjct: 207 DRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLD------ATKYTSTVNCFAKIFK 260

Query: 66  TEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALG 102
            EGL+   +G        IL  G    +Y+ +   LG
Sbjct: 261 EEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFLG 297

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 115/307 (37%), Gaps = 28/307 (9%)

Query: 2   SPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVS 61
           S +T + V  L SF             T P E  KTRLQL       + +        + 
Sbjct: 3   SKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQL-------IDKASKASRNPLV 55

Query: 62  LIYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXX 117
           LIY+T   +G+        A+ I+ N ++ G+    +D ++      +L D  T      
Sbjct: 56  LIYKTAKTQGIGSIYVGCPAF-IIGNTAKAGIRFLGFDTIKD-----MLRDSETGELSGT 109

Query: 118 XXXXXXXXXXXXXXXXXXSPLQLVKTRM----QALAPRRVPPLPGRMGRRLVALFKDRGV 173
                             +P + +KT +    Q+  P+      G + R   +L +D+G 
Sbjct: 110 RGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVV-RNYSSLVRDKGF 168

Query: 174 RGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVAV 227
            GLY+GV    +R     AV+L  Y+  K  +  +       P    L  L  A S +  
Sbjct: 169 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVT 228

Query: 228 CIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCL 287
             +  P D   TRM       Y   ++C     ++EG    +KG   +L R+     +  
Sbjct: 229 VYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVF 288

Query: 288 TLMEQAL 294
           T+ E+ L
Sbjct: 289 TIYEKVL 295

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 114/309 (36%), Gaps = 29/309 (9%)

Query: 4   STDTP-VSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSL 62
           S++ P V    SF           + T P E  KTRLQL       V +        + L
Sbjct: 82  SSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQL-------VDKASKASRNPLVL 134

Query: 63  IYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXXX 118
           IY T    G+        A+ I+ N ++ G+    +D ++      +L D++T       
Sbjct: 135 IYNTGKNYGISSIYVGCPAF-IVGNTAKAGIRFLGFDTIKN-----LLRDKKTGELSGFR 188

Query: 119 XXXXXXXXXXXXXXXXXSPLQLVKTRM----QALAPRRVPPLPGRMGRRLVALFKDRGVR 174
                            +P + +KT +    QA  P+      G M      L  D+G  
Sbjct: 189 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKG-MVSNYAKLLSDQGFS 247

Query: 175 GLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVAVC 228
           GLY+GV    +R     AV+L  Y+  K  +  +       P    L  +  A S +   
Sbjct: 248 GLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTV 307

Query: 229 IAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLT 288
               P D   TRM     G Y   ++C     ++EG    +KG   +L R+     +  T
Sbjct: 308 YTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 289 LMEQALRVV 297
           + E+ L V+
Sbjct: 368 IYEKVLTVL 376

>Scas_602.8
          Length = 885

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 122/295 (41%), Gaps = 46/295 (15%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL-------ACAYAYQ 83
           PI+ +KTR+Q Q  L       Y      +  I+  EG+RGL  GL       A   A +
Sbjct: 518 PIDFIKTRMQAQRSLTK-----YKNSIDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIK 572

Query: 84  ILLNGS-RLGLYDPL-RAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLV 141
           + +N   R  L D      LG  VLS                            +PL++V
Sbjct: 573 LTVNDFMRKSLVDKKGNLQLGAEVLS----------------GATAGACQVVFTNPLEIV 616

Query: 142 KTRMQALAPRRVPPLPGRMGRRLVA--LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
           K R+Q  +      +P     +L A  + K+  + GLY+GV A LLR    SA+    Y+
Sbjct: 617 KIRLQVKSEYTNAMIPKS---QLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYA 673

Query: 200 HAKEALSRHVP------DGMALYTL--ASALSSVAVCIAMNPFDVAMTRMYHHRG---GL 248
           H K+ + +  P      D +  + L  A AL+ V       PFDV  TR+    G     
Sbjct: 674 HLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETR 733

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
           Y G L  +   +++E F + +KG  A+++R +P     L   E    +  + +++
Sbjct: 734 YTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNISDDK 788

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 9/97 (9%)

Query: 202 KEALSRHV---PDGMALYTLASALSSVAVCIA---MNPFDVAMTRMYHHRG-GLYRGPLD 254
           KE+L R+    P   +++  +  L SVA CI    + P D   TRM   R    Y+  +D
Sbjct: 483 KESLYRNYYFYPIFDSIFNFS--LGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSID 540

Query: 255 CLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           CL K   +EG   LY G   QL+ +AP   + LT+ +
Sbjct: 541 CLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIKLTVND 577

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 67/263 (25%), Positives = 107/263 (40%), Gaps = 25/263 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           PI+ VKTR+Q Q +        Y      +  I   EG+RGL  GL             +
Sbjct: 544 PIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIK 598

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAP 150
           L + D +RA L G    D +                         +PL++VK R+Q  + 
Sbjct: 599 LTVNDHMRATLAG---RDGK----LSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSD 651

Query: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP 210
                   R     +++ K+ G+ GLY+G  A LLR    SA+    Y+H K  +    P
Sbjct: 652 YVADA--ARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDP 709

Query: 211 ------DGMALYTL--ASALSSVAVCIAMNPFDVAMTRMY--HHRG-GLYRGPLDCLCKT 259
                 + +  + L  +  L+ +       PFDV  TR+     +G  +Y G  D     
Sbjct: 710 KDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTI 769

Query: 260 VRQEGFSALYKGHLAQLLRIAPH 282
           +++EG  + +KG  A++LR +P 
Sbjct: 770 LKEEGIKSFFKGGPARVLRSSPQ 792

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 222 LSSVAVCIA---MNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           L SVA CI    + P D+  TRM   R    Y+  +DCL K + +EG   LY G   QL+
Sbjct: 530 LGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLI 589

Query: 278 RIAPHTILCLTL 289
            +AP   + LT+
Sbjct: 590 GVAPEKAIKLTV 601

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 17/177 (9%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           FTNP+E VK RLQ++ + VA  +R       A+S+I +  GL GL +G        I  +
Sbjct: 635 FTNPLEIVKIRLQVKSDYVADAAR---NSVNAISVI-KNLGLIGLYRGAGACLLRDIPFS 690

Query: 88  GSRLGLYDPLRAALGGCVL------SDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLV 141
                +Y P  A +   V       SD+R                         +P  ++
Sbjct: 691 ----AIYFPTYAHIKSNVFNFDPKDSDKRN--KLNTWQLLVSGGLAGMPAAFLTTPFDVI 744

Query: 142 KTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY 198
           KTR+Q + P++   +   +      + K+ G++  ++G  A +LR+       LA Y
Sbjct: 745 KTRLQ-IDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAY 800

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 67/153 (43%), Gaps = 8/153 (5%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+ +VKTRMQA   R        +   L  L K+ GVRGLY G+   L+      A++L 
Sbjct: 544 PIDMVKTRMQA--QRDFSKYKNSIDCLLKILSKE-GVRGLYSGLGPQLIGVAPEKAIKLT 600

Query: 197 VYSHAKEALS-RHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY---HHRGGLYRGP 252
           V  H +  L+ R     +    ++ A +     +  NP ++   R+     +     R  
Sbjct: 601 VNDHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNS 660

Query: 253 LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTIL 285
           ++ +   ++  G   LY+G  A LLR  P + +
Sbjct: 661 VNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAI 692

>Kwal_47.19228
          Length = 281

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 7/150 (4%)

Query: 137 PLQLVKTRMQALAPRRVPPL-----PGRMGRRLV-ALFKDRGVRGLYQGVDAALLRTGVG 190
           P     ++ +AL PR+   L     P R     V  +++ RG+RG  QG    ++R    
Sbjct: 102 PRATFHSQKKALHPRQKWALYYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSN 161

Query: 191 SAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY-HHRGGLY 249
           SAV+   Y+  K+ +S + P           +SS AV     P DV  TRM   +    Y
Sbjct: 162 SAVRFTTYTSLKQMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNY 221

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRI 279
           +  L+C  +   +EGF+  +KG   +L+++
Sbjct: 222 KNSLNCAYRIFVEEGFTKFWKGWAPRLMKV 251

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 110/309 (35%), Gaps = 22/309 (7%)

Query: 2   SPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQ-----GELVAGVSRLYSGP 56
           S S   P+  +  F           T   P++ VKTR QL+        V      Y+G 
Sbjct: 3   SDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGV 62

Query: 57  AQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXX 116
              +  I + EG   L +G++     +     ++    D  +        ++  T     
Sbjct: 63  IDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT----- 117

Query: 117 XXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGL 176
                               P +L+K RMQ +    + P+       L    K+ G+ GL
Sbjct: 118 QKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDC-----LKKTIKNEGIMGL 172

Query: 177 YQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYT--LASALSSVAVCIAMNPF 234
           Y+G+++ + R  + +     V    + ++      G       +A A+      +   PF
Sbjct: 173 YKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPF 232

Query: 235 DVAMTRMYHHRG-----GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTL 289
           DV  +R+            Y   L  L    R+EGF ALYKG + ++ R+AP   L L +
Sbjct: 233 DVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVV 292

Query: 290 MEQALRVVR 298
               +   R
Sbjct: 293 FTGMMNFFR 301

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 4/140 (2%)

Query: 141 VKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           +++  +AL P +   LP  +      L++  G+R  ++G    L+R    S V+   ++ 
Sbjct: 165 LRSSYEALFPEK---LPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTM 221

Query: 201 AKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG-LYRGPLDCLCKT 259
            K+   +   +     TL   +SS AV  A  P DV  TRM       LYR  ++C  + 
Sbjct: 222 LKQFAPKEYQNNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRI 281

Query: 260 VRQEGFSALYKGHLAQLLRI 279
             +EGF+ L+KG L +L+++
Sbjct: 282 FVEEGFAMLWKGWLPRLMKV 301

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 109/274 (39%), Gaps = 29/274 (10%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T+P++  K RLQ        + R+        S I R EG+ GL  GL  A   Q     
Sbjct: 26  THPLDLAKVRLQTAPAPKPTLVRM-------ASQILRNEGVPGLYSGLTAAILRQCTYTT 78

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
           +R G+YD ++         +   Y                       +P  +V  RMQ  
Sbjct: 79  ARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIG-------NPADVVNIRMQND 131

Query: 149 APRRVPPLPGRMGRR-------LVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHA 201
           +      LP  + R        L  +    GV  L+ G    L+R  + ++ Q+  Y  A
Sbjct: 132 SS-----LPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIA 186

Query: 202 KEALSRHV---PDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCK 258
           K  L ++V    D  + +  +S L+ +      +P DV  TR+ +     +   +  L  
Sbjct: 187 KNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRILLD 246

Query: 259 TVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            V+QEG S +++G L   +R+ P+TIL    +EQ
Sbjct: 247 AVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQ 280

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 114/291 (39%), Gaps = 63/291 (21%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL-------------- 76
           PI+ VKTR+Q Q   V      Y      V  I++T+G+RGL  GL              
Sbjct: 524 PIDLVKTRMQAQRNSVQ-----YKNSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIK 578

Query: 77  --ACAYAYQILLNGSR-LGLYDPLR--AALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXX 131
                +  Q  +N SR +  Y  +   A  G C +                         
Sbjct: 579 LTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQV------------------------- 613

Query: 132 XXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGS 191
               +PL++VK R+Q  +         ++G   V + +  G+RGLY+G  A LLR    S
Sbjct: 614 -VFTNPLEIVKIRLQMRSDYVGENARPQLG--AVGIIRQLGLRGLYKGAAACLLRDVPFS 670

Query: 192 AVQLAVYSHAKEALSRHVPDGM----ALYT----LASALSSVAVCIAMNPFDVAMTRM-Y 242
           A+    Y+H K+ +    P+       L T    LA  ++ +       PFDV  TR+  
Sbjct: 671 AIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQI 730

Query: 243 HHRGG--LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             R G   Y G +      +++E   + +KG  A++LR +P     L   E
Sbjct: 731 DPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 5/172 (2%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           FTNP+E VK RLQ++ + V   +R   G   AV +I R  GLRGL +G A      +  +
Sbjct: 615 FTNPLEIVKIRLQMRSDYVGENARPQLG---AVGII-RQLGLRGLYKGAAACLLRDVPFS 670

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
                 Y  L+  +     +D+                          +P  ++KTR+Q 
Sbjct: 671 AIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQ- 729

Query: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
           + PR+       +      + K+  ++  ++G  A +LR+       LA + 
Sbjct: 730 IDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 221 ALSSVAVCI---AMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQL 276
            L S+A CI    + P D+  TRM   R  + Y+  +DC+ K  + +G   LY G   QL
Sbjct: 509 TLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGPQL 568

Query: 277 LRIAPHTILCLTLME 291
           + +AP   + LT+ +
Sbjct: 569 IGVAPEKAIKLTVND 583

>Scas_640.25
          Length = 306

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 113/285 (39%), Gaps = 34/285 (11%)

Query: 31  PIETVKTRLQLQGEL-VAGVSRL-YSGPAQAVSLIYRTEGLRGLQQGLACAY-------A 81
           P++ VKTR+QLQ     AG S   Y G    +S I + EG   + +G++          A
Sbjct: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92

Query: 82  YQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLV 141
            +   N   + L+   ++  G   L+ + +                         P +LV
Sbjct: 93  VKFASNDEFIKLW---KSVFGTKQLTQQISVLSGASAGITEALVIV---------PFELV 140

Query: 142 KTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHA 201
           K R+Q +  +   P+       L  + K  G++GLY GV++ + R  V +A    V    
Sbjct: 141 KIRLQDVNSKFKGPV-----EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195

Query: 202 KEAL--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL------YRGPL 253
           +E L  ++   +       A  +      +   PFDV  +R+      +      Y    
Sbjct: 196 RELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTW 255

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
             + K   +EGF ALYKG + ++LR+ P   + L +    + V R
Sbjct: 256 PSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHH--------RGGLYRGPLDCLCKTVRQEGFSALY 269
           +A A++ ++  + M P DV  TRM               Y+G +DCL + V++EG   +Y
Sbjct: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77

Query: 270 KGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300
           KG  + +L  AP   +     ++ +++ + V
Sbjct: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 28  FTNPIETVKTRLQLQG-ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           F  P + VK+R+Q  G E++ GV R Y+    +V  IY  EG R L +G 
Sbjct: 226 FNTPFDVVKSRIQSDGNEIINGV-RKYNWTWPSVMKIYHEEGFRALYKGF 274

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 117/311 (37%), Gaps = 30/311 (9%)

Query: 1   MSPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60
           MS S     SK  SF           + T P E  KTRLQL       + +        +
Sbjct: 1   MSQSKQVDPSK--SFIAGCLAGAVEASVTYPFEFAKTRLQL-------LDKASKASRNPL 51

Query: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXX 116
            LIY T   +G+        A+ I+ N ++ G+    +D ++      +L D +T     
Sbjct: 52  VLIYNTAKTQGIGSVYVGCPAF-IVGNTAKAGVRFLGFDTIKN-----LLRDPKTGELSG 105

Query: 117 XXXXXXXXXXXXXXXXXXXSPLQLVKTRM----QALAPRRVPPLPGRMGRRLVALFKDRG 172
                              +P + +KT +    Q+  P+      G M R   AL + +G
Sbjct: 106 PRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKG-MLRNYTALVRKQG 164

Query: 173 VRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVA 226
           + GLY+GV    +R     AV+L  Y+  K  +  +       P    L  +  A S + 
Sbjct: 165 LSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIV 224

Query: 227 VCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILC 286
                 P D   TRM       Y   ++C     ++EG  A +KG   +L R+     + 
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIV 284

Query: 287 LTLMEQALRVV 297
            T+ E+ L V+
Sbjct: 285 FTVYEKVLTVL 295

 Score = 34.3 bits (77), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 6   DTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYR 65
           D P+S   +F             T PI+TVKTR+Q         S+ YS      + I++
Sbjct: 206 DKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLD------SKRYSSTINCFTTIFK 259

Query: 66  TEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALG 102
            EGL+   +G         L  G    +Y+ +   LG
Sbjct: 260 EEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVLG 296

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 111/273 (40%), Gaps = 18/273 (6%)

Query: 30  NPIETVKTRLQL-QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           +P++T+K R+Q+ +   + G+     G  +    IY  EGL  L +GL       I    
Sbjct: 29  HPLDTIKVRMQIYRRSALEGIKP--PGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMA 86

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA- 147
            R   Y+  R+AL     +D++T                        +P+++VK R+QA 
Sbjct: 87  IRFSSYEFYRSAL-----ADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQ 141

Query: 148 -LAPRRVPPLPGRMGRRLVALF-KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL 205
            L P        R   +   L  K+ G+  LY+GV     R          VYS  KE L
Sbjct: 142 HLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFL 201

Query: 206 SRH-VPDGMALY-TLASALSSVAVCIAMN-PFDVAMTRMYHHRGGLYRGPLDCLC----K 258
             H   D +  + T    L S A+    N P D   TR+   +          +     +
Sbjct: 202 QEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQ 261

Query: 259 TVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
            +++EGF ALYKG   +++R+AP   +  T+ E
Sbjct: 262 LIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 73/183 (39%), Gaps = 16/183 (8%)

Query: 30  NPIETVKTRLQLQG-ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           NP+E VK RLQ Q        S  Y    QA  LI + EG+  L +G++   A Q    G
Sbjct: 129 NPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQG 188

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
           +   +Y  L+       L +                           +PL  +KTR+Q  
Sbjct: 189 ANFTVYSKLKE-----FLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK- 242

Query: 149 APRRVPPLPGR-----MGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKE 203
             +    + G      +G++L+   K+ G R LY+G+   ++R   G AV   VY   +E
Sbjct: 243 -DKSTANMSGWSRIVTIGKQLI---KEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRE 298

Query: 204 ALS 206
            L 
Sbjct: 299 HLE 301

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 68/267 (25%), Positives = 104/267 (38%), Gaps = 24/267 (8%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T   PI+ VKTR+Q Q  L       Y         I   EG+RG+  GL          
Sbjct: 559 TIVYPIDFVKTRMQAQRSLSQ-----YKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPE 613

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
              +L + D +R  L       +                          +PL++VK R+Q
Sbjct: 614 KAIKLTVNDYMRNKL-------KDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQ 666

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALS 206
            +    V           + + K  G+ GLY+G  A LLR    SA+    Y+H K  L 
Sbjct: 667 -VKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLF 725

Query: 207 RHVPDG------MALYTL--ASALSSVAVCIAMNPFDVAMTRMY--HHRG-GLYRGPLDC 255
              P+       +  + L  A AL+ +       PFDV  TR+     +G  +Y+G +  
Sbjct: 726 NFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHA 785

Query: 256 LCKTVRQEGFSALYKGHLAQLLRIAPH 282
               +R+E F + +KG  A++LR +P 
Sbjct: 786 ARTILREESFKSFFKGGAARVLRSSPQ 812

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 70/171 (40%), Gaps = 4/171 (2%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           FTNP+E VK RLQ++GE VA  +   +    A+ +I R  GL GL +G A      +  +
Sbjct: 654 FTNPLEIVKIRLQVKGEYVAENAE--NAKLTALQIIKRL-GLPGLYKGAAACLLRDVPFS 710

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
                 Y  L+  L     +D+                          +P  ++KTR+Q 
Sbjct: 711 AIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQ- 769

Query: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY 198
           + P++   +   +      + ++   +  ++G  A +LR+       LA Y
Sbjct: 770 IDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAY 820

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 221 ALSSVAVCIAMN---PFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKGHLAQL 276
           +L SVA CI      P D   TRM   R    Y+  +DC  K + +EG   +Y G   QL
Sbjct: 548 SLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQL 607

Query: 277 LRIAPHTILCLTL 289
           + +AP   + LT+
Sbjct: 608 IGVAPEKAIKLTV 620

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 13/156 (8%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  VKTRMQA   R +      +   L  L ++ G+RG+Y G+   L+      A++L 
Sbjct: 563 PIDFVKTRMQA--QRSLSQYKNSIDCFLKILSRE-GIRGVYSGLGPQLIGVAPEKAIKLT 619

Query: 197 VYSHAKEALS-RHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY------ 249
           V  + +  L  ++   G+    ++ A +     I  NP ++   R+     G Y      
Sbjct: 620 VNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRL--QVKGEYVAENAE 677

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTIL 285
              L  L + +++ G   LYKG  A LLR  P + +
Sbjct: 678 NAKLTAL-QIIKRLGLPGLYKGAAACLLRDVPFSAI 712

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 57/118 (48%), Gaps = 1/118 (0%)

Query: 164 LVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALS 223
           ++ +++ RGVRG  QG    + R    S V+   Y+   ++LS H          A ALS
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQAFAAGALS 258

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
           S AV     P DV  TRM        Y+  L+C  +   +EGF  ++KG + +L +++
Sbjct: 259 SAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVS 316

>Kwal_47.17321
          Length = 881

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 116/295 (39%), Gaps = 71/295 (24%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL-------------- 76
           PI+ VKTR+Q Q          Y         I+  EG+RG+  GL              
Sbjct: 520 PIDLVKTRMQAQRNFSQ-----YKNSIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIK 574

Query: 77  --ACAYAYQILLN-GSRLGLYDPLR----AALGGCVLSDRRTYXXXXXXXXXXXXXXXXX 129
                Y  ++L++  +RL L  PL     AA G C +                       
Sbjct: 575 LTVNDYVRKLLMDENNRLTL--PLEIISGAAAGACQV----------------------- 609

Query: 130 XXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVAL--FKDRGVRGLYQGVDAALLRT 187
                 +PL++VK R+Q  +      LP     +L AL   K  G+RGLY+G+ A L+R 
Sbjct: 610 ---IFTNPLEIVKIRLQVRS-EYADSLPKS---QLTALGVVKSLGLRGLYKGLVACLMRD 662

Query: 188 GVGSAVQLAVYSHAKEALSRHVPDGMA----LYTL----ASALSSVAVCIAMNPFDVAMT 239
              SA+    Y+H K  +  + P        L+T     A  L+ +       PFDV  T
Sbjct: 663 VPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKT 722

Query: 240 RM-YHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           R+    R G   Y G L      +++E F + +KG  A++LR +P     L   E
Sbjct: 723 RLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE 777

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 222 LSSVAVCI---AMNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           L SVA CI   A+ P D+  TRM   R    Y+  +DC  K   +EG   +Y G   QL+
Sbjct: 506 LGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQLV 565

Query: 278 RIAPHTILCLTLMEQALRVVRLVENR 303
            +AP   + LT+ +   +++    NR
Sbjct: 566 GVAPEKAIKLTVNDYVRKLLMDENNR 591

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 74/194 (38%), Gaps = 16/194 (8%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSL-IYRTEGLRGLQQGLACAYAYQILL 86
           FTNP+E VK RLQ++ E    + +     +Q  +L + ++ GLRGL +GL       +  
Sbjct: 611 FTNPLEIVKIRLQVRSEYADSLPK-----SQLTALGVVKSLGLRGLYKGLVACLMRDVPF 665

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
           +      Y  L+  +      D+                          +P  ++KTR+Q
Sbjct: 666 SAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQ 725

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS------- 199
            + PR+       +      + K+   +  ++G  A +LR+       LA Y        
Sbjct: 726 -IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMFP 784

Query: 200 --HAKEALSRHVPD 211
             H++   SR   D
Sbjct: 785 LQHSENNESRETND 798

>Kwal_26.8669
          Length = 296

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 113/283 (39%), Gaps = 35/283 (12%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++ VKTR+QLQ  +  G+   Y G    +  I   EG   L +G++           S 
Sbjct: 29  PLDVVKTRMQLQ--VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS-----------SP 75

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXX------XXSPLQLVKTR 144
           + +  P RA    C    ++ Y                              P +LVK R
Sbjct: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIR 135

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK-- 202
           +Q ++     P+   + R+++A     GV  +Y G+++ L R GV +A    +    +  
Sbjct: 136 LQDVSSSYKGPID--VVRKIIA---QEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRAL 190

Query: 203 --EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR---GGL--YRGPLDC 255
             EA S+       L  +A ++      +   PFDV  +R+ +     GG   Y      
Sbjct: 191 LPEAKSKSQQTRNDL--IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPS 248

Query: 256 LCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
           +    ++EGF ALYKG + ++LR+ P   + L +    +   R
Sbjct: 249 IFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 219 ASALSSVAVCIAMNPFDVAMTRM-YHHRGGL---YRGPLDCLCKTVRQEGFSALYKGHLA 274
           A A++ ++  + M P DV  TRM     GGL   Y+G +DC+ + V +EG S LYKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 275 QLLRIAPH 282
            +L  AP 
Sbjct: 75  PVLMEAPK 82

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           + P + VK+R+Q    +VAG +R Y+    ++  IY+ EG R L +G 
Sbjct: 219 STPFDVVKSRIQ-NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 114/291 (39%), Gaps = 62/291 (21%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL-------ACAYAYQ 83
           PI+ +KTR+Q Q  L       Y      +  I   EG++GL  GL       A   A +
Sbjct: 550 PIDFIKTRMQAQRSLAQ-----YKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIK 604

Query: 84  ILLN----------GSRLGLYDPLR--AALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXX 131
           + +N            +L L+  +   A+ G C +                         
Sbjct: 605 LTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQV------------------------- 639

Query: 132 XXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGS 191
               +PL++VK R+Q  +   V     +       + K  G+RGLY GV A L+R    S
Sbjct: 640 -IFTNPLEIVKIRLQVQSDY-VGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFS 697

Query: 192 AVQLAVYSHAKEALSRHVPDG------MALYTL--ASALSSVAVCIAMNPFDVAMTRM-Y 242
           A+    Y+H K+ L    P+       +  + L  A A++ +       PFDV  TR+  
Sbjct: 698 AIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQI 757

Query: 243 HHRGG--LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             R G   Y G    +   +++E F + +KG  A++LR +P     L   E
Sbjct: 758 DPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 214 ALYTLASALSSVAVCI---AMNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALY 269
           +LY  +  L S+A CI    + P D   TRM   R    Y+  +DCL K + +EG   LY
Sbjct: 530 SLYNFS--LGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLY 587

Query: 270 KGHLAQLLRIAPHTILCLTLME 291
            G   QL+ +AP   + LT+ +
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVND 609

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 67/173 (38%), Gaps = 6/173 (3%)

Query: 28  FTNPIETVKTRLQLQGELV-AGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           FTNP+E VK RLQ+Q + V   + +      Q V  +    GLRGL  G+A      +  
Sbjct: 641 FTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GLRGLYNGVAACLMRDVPF 696

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
           +      Y  L+  L     +D+                          +P  ++KTR+Q
Sbjct: 697 SAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ 756

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
            + PR+       +   +  + K+   R  ++G  A +LR+       LA Y 
Sbjct: 757 -IDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 1/114 (0%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVA 226
           + + RG    +QG    + R    SAV+   Y+  K+ +S + P            SS A
Sbjct: 200 MVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLSEYYAFGIGVFSSCA 259

Query: 227 VCIAMNPFDVAMTRMY-HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRI 279
           V     P DV  TRM   +   LYR  L+C+ +T  +EG ++L+KG + +L ++
Sbjct: 260 VVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKV 313

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 109/272 (40%), Gaps = 25/272 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           PI+ VKTR+Q Q          Y       + I+  EG+RG+  GL             +
Sbjct: 538 PIDLVKTRMQAQRSFSQ-----YKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIK 592

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAP 150
           L + D +R  L          +                       +PL++VK R+Q  + 
Sbjct: 593 LTVNDYMRGRLMD-------KHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSE 645

Query: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP 210
                L  ++    + + K  G++GLY+G+ A L+R    SA+    Y+H K+ + ++ P
Sbjct: 646 YAGDVLKSQVT--ALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDP 703

Query: 211 ------DGMALYTL--ASALSSVAVCIAMNPFDVAMTRM-YHHRGGL--YRGPLDCLCKT 259
                 + +  + L  A  L+ +       PFDV  TR+    R G   Y G        
Sbjct: 704 KDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTI 763

Query: 260 VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           +++E F + +KG  A++LR +P     L   E
Sbjct: 764 LKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 221 ALSSVAVCI---AMNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKGHLAQL 276
            L S+A CI    + P D+  TRM   R    Y+  +DC  K   +EG   +Y G   QL
Sbjct: 523 TLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQL 582

Query: 277 LRIAPHTILCLTLME 291
           + +AP   + LT+ +
Sbjct: 583 IGVAPEKAIKLTVND 597

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 69/173 (39%), Gaps = 7/173 (4%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSL-IYRTEGLRGLQQGLACAYAYQILL 86
           FTNP+E VK RLQ++ E    V +     +Q  +L + +  G++GL +G+A      +  
Sbjct: 629 FTNPLEVVKIRLQVRSEYAGDVLK-----SQVTALGVIKQLGIKGLYKGIAACLMRDVPF 683

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
           +      Y  L+  +      D++                         +P  ++KTR+Q
Sbjct: 684 SAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQ 743

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
            + PR+       +      + K+   +  ++G  A +LR+       LA Y 
Sbjct: 744 -IDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 111/277 (40%), Gaps = 22/277 (7%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYS-GPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           +P++T+K R+Q+    VAG+  +   G  +    IY+ EG   L +GL       I    
Sbjct: 29  HPLDTIKVRMQIY-RRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMA 87

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
            R   Y+  R      +L ++ +                        +P+++VK R+QA 
Sbjct: 88  IRFSSYEFYR-----TLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQ 142

Query: 149 APRRVPPLPGRMGRRLV----ALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
                 P  G      +     + K+ GV  LY+GV     R          VYS  KE 
Sbjct: 143 HLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEF 202

Query: 205 LSR-HVPDGMALY-TLASALSSVAVCIAMN-PFDVAMTRMYHHRG-------GLYRGPLD 254
           L   H  D +  + T    L S A+    N P D   TR+   +        G+ +  + 
Sbjct: 203 LQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGM-KKIIT 261

Query: 255 CLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
              + +++EGF ALYKG   +++R+AP   +  T+ E
Sbjct: 262 IGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 73/187 (39%), Gaps = 19/187 (10%)

Query: 30  NPIETVKTRLQLQ----GELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQIL 85
           NP+E VK RLQ Q     E  AG    Y+    A   I + EG+  L +G++   A Q  
Sbjct: 130 NPMEVVKIRLQAQHLTPSEPNAGPK--YNNAIHAAYTIVKEEGVSALYRGVSLTAARQAT 187

Query: 86  LNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM 145
             G+   +Y  L+       L +                           +PL  +KTR+
Sbjct: 188 NQGANFTVYSKLKE-----FLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRL 242

Query: 146 QALAPRRVPPLPGRMGRRLV-----ALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           Q     +   L  + G + +      L K+ G R LY+G+   ++R   G AV   VY +
Sbjct: 243 QK---DKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEY 299

Query: 201 AKEALSR 207
            +E L  
Sbjct: 300 VREHLEN 306

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 113/294 (38%), Gaps = 42/294 (14%)

Query: 31  PIETVKTRLQLQ--------GELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL------ 76
           P++ VKTR+QLQ                  Y+G    ++ I + EG   L +G+      
Sbjct: 31  PLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILM 90

Query: 77  -ACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXX 135
            A   A +   N +    Y  +     G +      Y                       
Sbjct: 91  EAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVEAFVV---------- 140

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRG----LYQGVDAALLRTGVGS 191
           +P +LVK R+Q +  +   P         + + K+  V+G    L+ G++A + R  + +
Sbjct: 141 APFELVKIRLQDVNSQFKTP---------IEVVKNSVVKGGVLSLFNGLEATIWRHVLWN 191

Query: 192 AVQLAVYSHAKEAL--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL- 248
           A    +    ++ L  ++   +      +A A+     C+   PFDV  +R+    G L 
Sbjct: 192 AGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLR 251

Query: 249 -YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVE 301
            Y   L  +    R+EGF ALYKG   +++R+AP   L L +    +   R V+
Sbjct: 252 KYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFREVK 305

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 37/77 (48%), Gaps = 14/77 (18%)

Query: 219 ASALSSVAVCIAMNPFDVAMTRM--------------YHHRGGLYRGPLDCLCKTVRQEG 264
           A A++ V+  + M P DV  TRM                     Y G +DCL K V++EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 265 FSALYKGHLAQLLRIAP 281
           FS LYKG  + +L  AP
Sbjct: 77  FSHLYKGITSPILMEAP 93

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 65/166 (39%), Gaps = 10/166 (6%)

Query: 137 PLQLVKTRMQALAPRRVP---PLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           PL  +KTR+QA+         P+P  M R+L ++    G   L++GV + LL  G   AV
Sbjct: 38  PLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAV 97

Query: 194 QLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIA----MNPFDVAMTRMYHHRGGLY 249
             A Y   K  L          +   +A S     IA    MNPFDV   R+  +     
Sbjct: 98  YFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTN--- 154

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
               D   +   +EGF A Y  +   L    P       + + A R
Sbjct: 155 ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATR 200

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 75/159 (47%), Gaps = 14/159 (8%)

Query: 137 PLQLVKTRMQA--LAPRRVPPL--PGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
           PL + KTR+QA  L  R    L   G +G  +  + +D GVRGLY+G+   ++       
Sbjct: 88  PLDVAKTRLQAQGLQTRTTENLYYRGSIGT-MTTIVRDEGVRGLYKGLVPIIMGYFPTWM 146

Query: 193 VQLAVYSHAKEALSRHVPDGMALYTLASALSSVAV-CIAMNPFDVAMTRMY--HHRGG-- 247
           +  +VY   K+ L  +  +   +    SA+++ AV  +  NP  V  TR+    H G   
Sbjct: 147 IYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNT 206

Query: 248 -LYRGPLDCLCKTVRQEGFSALYKG---HLAQLLRIAPH 282
             Y+G  D   K + QEG  ALY G    L  LL +A H
Sbjct: 207 THYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLHVAIH 245

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 74/184 (40%), Gaps = 14/184 (7%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNPI  VKTRL LQ  + +  +  Y G   A   I   EG++ L  GL  +    +L   
Sbjct: 186 TNPIWVVKTRLMLQTHIGSNTTH-YQGTYDAFKKIINQEGVKALYAGLVPS-LLGLLHVA 243

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS-PLQLVKTRMQA 147
               +Y+ L+ +   C   D  +                        S P ++++TR+Q 
Sbjct: 244 IHFPVYERLKVSF-KCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQL 302

Query: 148 LAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKE 203
            +      LP    RRL+ L K      G+ G Y G    L RT   SA+ L  + + + 
Sbjct: 303 KS-----DLPSHQ-RRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRN 356

Query: 204 ALSR 207
            L++
Sbjct: 357 FLNK 360

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 97/279 (34%), Gaps = 32/279 (11%)

Query: 31  PIETVKTRLQLQGELVAGVSRLY-SGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89
           P++  KTRLQ QG        LY  G    ++ I R EG+RGL +GL             
Sbjct: 88  PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMI 147

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR--MQA 147
              +Y+  +  L       R                          +P+ +VKTR  +Q 
Sbjct: 148 YFSVYEFCKDNL-------RTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQT 200

Query: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR 207
                     G        +    GV+ LY G+  +LL   +  A+   VY   K +   
Sbjct: 201 HIGSNTTHYQGTYD-AFKKIINQEGVKALYAGLVPSLLGL-LHVAIHFPVYERLKVSFKC 258

Query: 208 HVPD--------GMALYTLASALSSVAVCIAMNPFDVAMTRMY-------HHRGGLYRGP 252
           +  D         +    LAS++S +   +   P ++  TR+        H R  +   P
Sbjct: 259 YQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLI---P 315

Query: 253 LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           L  +  T  QEG    Y G    L R  P + + L   E
Sbjct: 316 L--IKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHH-------RGGLYRGPLDCLCKTVRQEGFSALYK 270
           LA  LS + VC    P DVA TR+              YRG +  +   VR EG   LYK
Sbjct: 77  LAGLLSGIVVC----PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 271 GHLAQLLRIAPHTILCLTLME 291
           G +  ++   P  ++  ++ E
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYE 153

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 105/291 (36%), Gaps = 47/291 (16%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T P++TVK R QLQ          Y G A  V  I + EGLR L +G   A A  ++   
Sbjct: 36  TAPMDTVKIRYQLQ----PVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGA 91

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
            + G Y               +                          PL L++TR+  +
Sbjct: 92  VQFGSYSWFNNVWSA------KFPRFSQQGQTLTVGALAGMTSSVVSYPLDLLRTRL--I 143

Query: 149 APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY--------SH 200
           A R        +      ++ + GVRG + G+  A+    + +A+    Y        +H
Sbjct: 144 ANR--TSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETVNIVCENH 201

Query: 201 AKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRM-----------------YH 243
            KE  SR V     +  +A  +S   V     P D    RM                 YH
Sbjct: 202 EKEFWSRPVSASSGI--IAGFVSKTMVF----PIDTLRRRMQVMNSKRTVHFTKFPAVYH 255

Query: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
                Y+     + K +RQEG SALY+G    L +  P T + L + E+ +
Sbjct: 256 EY--RYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTM 304

>Scas_709.9
          Length = 365

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 73/157 (46%), Gaps = 12/157 (7%)

Query: 137 PLQLVKTRMQALAPRRV--PPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           PL + KTR+QA   + +  P   G +G  +  +  D GVRGLY+G+   +L       + 
Sbjct: 84  PLDVTKTRLQAQGIQSIENPYYRGVLGT-MSTIVVDEGVRGLYKGLIPIILGYFPTWMIY 142

Query: 195 LAVYSHAKEALSRHVPDGMALYTLASALSS-VAVCIAMNPFDVAMTRMY-----HHRGGL 248
            +VY  AK+   R +P+   +    SA+++  A  +  NP  V  TR+            
Sbjct: 143 FSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTH 202

Query: 249 YRGPLDCLCKTVRQEGFSALYKG---HLAQLLRIAPH 282
           YRG +D   K + QEG   LY G    +  LL +A H
Sbjct: 203 YRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLHVAIH 239

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 73/181 (40%), Gaps = 7/181 (3%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRL-YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
            TNPI  VKTRL LQ  L  G SR  Y G   A   I   EG+R L  GL  +  + +L 
Sbjct: 179 LTNPIWVVKTRLMLQTPL--GESRTHYRGTIDAFKKIITQEGVRTLYTGLVPS-MFGLLH 235

Query: 87  NGSRLGLYDPLRAALGGCVLS--DRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
                 +Y+ L+  L    ++                               P ++++TR
Sbjct: 236 VAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTR 295

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
           MQ L   ++     ++   +   ++  G+ G Y G    LLRT   SA+ L  + + + A
Sbjct: 296 MQ-LKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRNA 354

Query: 205 L 205
           L
Sbjct: 355 L 355

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 100/282 (35%), Gaps = 37/282 (13%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++  KTRLQ QG + +  +  Y G    +S I   EG+RGL +GL              
Sbjct: 84  PLDVTKTRLQAQG-IQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPII---------- 132

Query: 91  LGLYDPLRAALGGCVLSDR---RTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
           LG +            +     R                         +P+ +VKTR+  
Sbjct: 133 LGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAITAGAASTVLTNPIWVVKTRLML 192

Query: 148 LAPRRVPPLPGRMGRR-LVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK 202
               + P    R   R  +  FK      GVR LY G+  ++    +  A+   VY   K
Sbjct: 193 ----QTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHVAIHFPVYEKLK 247

Query: 203 EALS------RHVPDGMALY----TLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGP 252
             L        H     +L+     +AS+ S +   I   P ++  TRM      L    
Sbjct: 248 NRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISK 307

Query: 253 ---LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
              LD + +T R EG    Y G    LLR  P + + L   E
Sbjct: 308 HKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 9/81 (11%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHH-----RGGLYRGPLDCLCKTVRQEGFSALYKGH 272
           LA  LS + VC    P DV  TR+            YRG L  +   V  EG   LYKG 
Sbjct: 73  LAGFLSGIIVC----PLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 273 LAQLLRIAPHTILCLTLMEQA 293
           +  +L   P  ++  ++ E A
Sbjct: 129 IPIILGYFPTWMIYFSVYEFA 149

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 95/249 (38%), Gaps = 32/249 (12%)

Query: 63  IYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXX 122
           IY  EG   L +GL       I     R   Y+  R      +L+D++T           
Sbjct: 89  IYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYR-----TLLADKQTGVVSTSNTFIA 143

Query: 123 XXXXXXXXXXXXXSPLQLVKTRMQA--LAPRR--VPPLPGRMGRRLVALFKDRGVRGLYQ 178
                        +P+++VK R+QA  L P      P      +    + K+ G+  LY+
Sbjct: 144 GVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYR 203

Query: 179 GVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCI-----AMNP 233
           GV     R          VYS  +E L  +        TL S  +S   CI     A+ P
Sbjct: 204 GVSLTAARQATNQGANFTVYSKLREFLQEY----HGTETLPSWETS---CIGLISGAIGP 256

Query: 234 F-----DVAMTRMYHHRGGLYRGPLDCL------CKTVRQEGFSALYKGHLAQLLRIAPH 282
           F     D   TR+   +   ++G            + +++EGF ALYKG   +++R+AP 
Sbjct: 257 FSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPG 316

Query: 283 TILCLTLME 291
             +  T+ E
Sbjct: 317 QAVTFTVYE 325

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 74/190 (38%), Gaps = 21/190 (11%)

Query: 30  NPIETVKTRLQLQGELVAG---VSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           NP+E VK RLQ Q  L          Y+   QA   I + EG+  L +G++   A Q   
Sbjct: 157 NPMEVVKIRLQAQ-HLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATN 215

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
            G+   +Y  LR       L +                           +PL  +KTR+Q
Sbjct: 216 QGANFTVYSKLRE-----FLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 270

Query: 147 ALAPRRVPPLPGRMGRRLVA-----LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHA 201
                +     G  G + +A     L K+ G R LY+G+   ++R   G AV   VY   
Sbjct: 271 K---DKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVY--- 324

Query: 202 KEALSRHVPD 211
            E + RH+ +
Sbjct: 325 -EFVRRHLEN 333

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 66/138 (47%), Gaps = 7/138 (5%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG---MALYTLASALS 223
           ++++ G R L++G+   L+      ++    Y   KE  S+ + +G   + ++ +A+A +
Sbjct: 121 VYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATA 180

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGGL---YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
             A   A NP  +  TR+   + G    Y+   DCL   V++EG   LYKG  A  L  +
Sbjct: 181 GWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLG-S 239

Query: 281 PHTILCLTLMEQALRVVR 298
              IL   L EQ   +++
Sbjct: 240 VEGILQWVLYEQMKHIIK 257

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 111/307 (36%), Gaps = 45/307 (14%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYS-GPAQA----------------VSLIYRTEGLRG 71
           T P + VKTRLQ      A  S   S GP QA                +S +YR EG R 
Sbjct: 70  TCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRS 129

Query: 72  LQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXX 131
           L +GL       I         Y   +      + S                        
Sbjct: 130 LFKGLGPNLVGVIPARSINFFTYGTTKE-----IYSKTLNNGQEAVWIHLMAAATAGWAT 184

Query: 132 XXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGS 191
               +P+ LVKTR+Q L               L  + +  G+ GLY+G+ A+ L + V  
Sbjct: 185 STATNPIWLVKTRLQ-LDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGS-VEG 242

Query: 192 AVQLAVYSHAKEAL--------------SRHVPDGMALY---TLASALSSVAVCIAMNPF 234
            +Q  +Y   K  +               +   D +  +   + ++ L+     I   P 
Sbjct: 243 ILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPH 302

Query: 235 DVAMTRMYH---HRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLM 290
           +V  TR+       G L Y G +  +   +++EG +++Y G    LLR  P++I+     
Sbjct: 303 EVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTW 362

Query: 291 EQALRVV 297
           E  +R++
Sbjct: 363 ELVIRLL 369

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY 80
           T TNPI  VKTRLQL     AG ++ Y      +  + + EG+ GL +GL+ +Y
Sbjct: 186 TATNPIWLVKTRLQLDK---AGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASY 236

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMA---LYTLASALS 223
           +++  G R L++G+   L+      ++    Y   K+  SR + +G     ++ LA+A +
Sbjct: 120 VYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATA 179

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
             A     NP  +  TR+   + G   Y+  LDC+   V+ EG   LYKG  A  L  + 
Sbjct: 180 GWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLG-SV 238

Query: 282 HTILCLTLMEQALRVVR 298
             IL   L EQ  R+++
Sbjct: 239 EGILQWILYEQMKRIIK 255

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 24/183 (13%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +P+ LVKTR+Q L           +   + ++ K+ GV GLY+G+ A+ L + V   +Q 
Sbjct: 188 NPIWLVKTRLQ-LDKAGTKTYKNSLDC-IKSVVKNEGVLGLYKGLSASYLGS-VEGILQW 244

Query: 196 AVYSHAKEAL--------------SRHVPDGMALY---TLASALSSVAVCIAMNPFDVAM 238
            +Y   K  +              ++   D +  +   + ++ L+     I   P +V  
Sbjct: 245 ILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVR 304

Query: 239 TRMYH---HRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           TR+       G L Y G +      +++EG  ++Y G    LLR  P++I+     E  +
Sbjct: 305 TRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWELVI 364

Query: 295 RVV 297
           +++
Sbjct: 365 KLL 367

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 76/191 (39%), Gaps = 34/191 (17%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T TNPI  VKTRLQL     AG ++ Y      +  + + EG+ GL +GL+ +Y      
Sbjct: 185 TVTNPIWLVKTRLQLDK---AG-TKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL----- 235

Query: 87  NGSRLG-----LYDPLRAALG-------GCVLSDRRTYXXXXXXXXXXXXXX--XXXXXX 132
            GS  G     LY+ ++  +        G +  D ++                       
Sbjct: 236 -GSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVAS 294

Query: 133 XXXSPLQLVKTRMQALAPRRVPPLPGRMG-----RRLVALFKDRGVRGLYQGVDAALLRT 187
               P ++V+TR+     R+ P   G++      +    + K+ G+  +Y G+   LLRT
Sbjct: 295 IVTYPHEVVRTRL-----RQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRT 349

Query: 188 GVGSAVQLAVY 198
              S +    +
Sbjct: 350 VPNSIIMFGTW 360

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 114/284 (40%), Gaps = 31/284 (10%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++ VKTR+QLQ +   G    Y+G    +  I   EG+  L +G++           S 
Sbjct: 31  PLDVVKTRMQLQVQ--GGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS-----------SP 77

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXX------XXXXXXXXXXXXXSPLQLVKTR 144
           + +  P RA    C    ++ Y                              P +LVK R
Sbjct: 78  ILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIR 137

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
           +Q  +     P+   + R++VA     GV  +Y G+++ L R  + +     +   A+  
Sbjct: 138 LQDASSSYKGPV--DVVRKIVA---REGVLAMYNGLESTLWRHALWNGGYFGIIFQARAL 192

Query: 205 L--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR--GGL---YRGPLDCLC 257
           L  + +    +    ++ ++     C+   PFDV  +R+ +     G+   Y   L  L 
Sbjct: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252

Query: 258 KTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVE 301
              R+EGF ALYKG + ++LR+ P   + L +    L   R + 
Sbjct: 253 TIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAIH 296

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRM-YHHRGGL---YRGPLDCLCKTVRQEGFSALYKGHL 273
            A A++ V+  + M P DV  TRM    +GG    Y G +DCL K V  EG   LYKG  
Sbjct: 16  FAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGIS 75

Query: 274 AQLLRIAP 281
           + +L  AP
Sbjct: 76  SPILMEAP 83

 Score = 34.7 bits (78), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           + P + VK+R+Q    ++ GV R Y+    ++  IYR EG R L +G 
Sbjct: 221 STPFDVVKSRIQ-NTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGF 267

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 72/161 (44%), Gaps = 10/161 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVA---LFKDRGVRGLYQGVDAALLRTGVGSAV 193
           P+   K     +A +  P    R+ + L A   +++ RG     QG  A + R    +++
Sbjct: 119 PVVNAKATFHKVATKSTPV--ARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSI 176

Query: 194 QLAVYSHAKEAL-SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL-YRG 251
           Q   Y+  K  L +R+      +  LA++ + VA+     P DV  TRM        Y+ 
Sbjct: 177 QFTAYTAFKRLLQARNDKASSVITGLATSFTLVAMT---QPIDVVKTRMMSQNAKTEYKN 233

Query: 252 PLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            L+C+ +   QEG +  +KG + + +++     L  T+ EQ
Sbjct: 234 TLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQ 274

>Kwal_47.18216
          Length = 333

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 114/305 (37%), Gaps = 56/305 (18%)

Query: 30  NPIETVKTRLQL------QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQ 83
           +P++T+K R+Q+      QG+   G    + G A+ +S     EG   L +GL       
Sbjct: 29  HPLDTIKVRMQIYSRAREQGQRARG----FIGTARDIST---QEGFLALYKGLGAVVIGI 81

Query: 84  ILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKT 143
           I     R   Y+  R      +L+DR+T                        +P+++VK 
Sbjct: 82  IPKMAIRFTSYEFFR-----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKI 136

Query: 144 RMQALAPRRVP---PLPGRMG--------------------------RRLVALFKDRGVR 174
           R+QA   R VP    L G +                           +    + K+ G R
Sbjct: 137 RLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPR 196

Query: 175 GLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR-HVPDGMALY--TLASALSSVAVCIAM 231
            LY+GV     R          VYS  K  L   H  D +  +  +L   +S      + 
Sbjct: 197 ALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSN 256

Query: 232 NPFDVAMTRMYHHRG-----GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILC 286
            P D   TR+   +      G  R  L    + +R+EGF ALYKG   +++R+AP   + 
Sbjct: 257 APLDTIKTRLQKDKSTSKDSGWSR-ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315

Query: 287 LTLME 291
            T+ E
Sbjct: 316 FTVYE 320

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 76/208 (36%), Gaps = 40/208 (19%)

Query: 30  NPIETVKTRLQLQ----------------------------GELVAGVSRLYSGPAQAVS 61
           NP+E VK RLQ Q                             E VA   + Y    QA  
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPK-YRNAIQAAY 187

Query: 62  LIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXX 121
           +I + EG R L +G++   A Q    G+   +Y  L++ L     +D             
Sbjct: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD-----MLPSWETS 242

Query: 122 XXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRM---GRRLVALFKDRGVRGLYQ 178
                         +PL  +KTR+Q            R+   GR+L+   ++ G R LY+
Sbjct: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI---REEGFRALYK 299

Query: 179 GVDAALLRTGVGSAVQLAVYSHAKEALS 206
           G+   ++R   G AV   VY   ++ L 
Sbjct: 300 GITPRVMRVAPGQAVTFTVYELIRKKLE 327

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 1/123 (0%)

Query: 158 GRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYT 217
            R    +  ++  RG+RG  QG    + R    SAV+   Y+  K+ +S + P       
Sbjct: 268 SRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYYAF 327

Query: 218 LASALSSVAVCIAMNPFDVAMTRMY-HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQL 276
           +   +SS AV     P DV  TRM   +    Y+  L+C  +   +EG    +KG   +L
Sbjct: 328 VLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRL 387

Query: 277 LRI 279
           +++
Sbjct: 388 MKV 390

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 109/285 (38%), Gaps = 31/285 (10%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLA---CAYAYQILLN 87
           P++  KTRLQ QG       R Y G    +S I R EG+ GL +GLA     Y    +L 
Sbjct: 104 PLDVAKTRLQAQG--AGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLY 161

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM-- 145
            S   +Y+  +            +Y                       +P+ +VKTR+  
Sbjct: 162 FS---VYEKCK--------QRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMI 210

Query: 146 QALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL 205
           Q+   R        +      +++  G++  Y G+  +L       A+   VY   K  L
Sbjct: 211 QSDVSRDSTNYRSTLDA-FRKMYRSEGLKVFYSGLVPSLFGL-FHVAIHFPVYEKLKIWL 268

Query: 206 SRHVP--DGMAL---------YTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLD 254
            R+ P  DG  L           +AS LS V   +   P ++  TRM     G+    L+
Sbjct: 269 HRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLN 328

Query: 255 CLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRL 299
            L +    EG+   Y G    L+R  P +++ L   E   + +R+
Sbjct: 329 LLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYLRM 373

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 69/180 (38%), Gaps = 9/180 (5%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNPI  VKTRL +Q + V+  S  Y     A   +YR+EGL+    GL  +  + +    
Sbjct: 198 TNPIWVVKTRLMIQSD-VSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSL-FGLFHVA 255

Query: 89  SRLGLYDPLRAAL---GGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM 145
               +Y+ L+  L          R  +                        P ++++TRM
Sbjct: 256 IHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM 315

Query: 146 QALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL 205
           Q       P L   +GR    +    G  G Y G    L+RT   S + L  + + ++ L
Sbjct: 316 QVRHSGVPPSLLNLLGR----IRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRKYL 371

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGG----LYRGPLDCLCKTVRQEGFSALYKGHL 273
           LA  +S + VC    P DVA TR+     G     YRG +  L   +R EG + LYKG  
Sbjct: 93  LAGFVSGIMVC----PLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLA 148

Query: 274 AQLLRIAPHTILCLTLMEQ 292
             +L   P  +L  ++ E+
Sbjct: 149 PIVLGYFPTWMLYFSVYEK 167

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 68/151 (45%), Gaps = 11/151 (7%)

Query: 137 PLQLVKTRMQALAPRRVPP----LPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
           P  + KTR+QA   + +        G  G     +FKD G  GLY+G+   +L       
Sbjct: 58  PFDVAKTRLQAQGLQNMTHQSQHYKGFFGT-FATIFKDEGAAGLYKGLQPTVLGYIPTLM 116

Query: 193 VQLAVYSHAKEALSRHVPDGMALYTLASALSSVAV-CIAMNPFDVAMTRMYHHRG----- 246
           +  +VY   ++      P    L   +SA+++ A+  +A NP  V  TR+    G     
Sbjct: 117 IYFSVYDFCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYS 176

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
             Y+G +D   K ++QEG  ALY G +  LL
Sbjct: 177 THYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 105/281 (37%), Gaps = 34/281 (12%)

Query: 31  PIETVKTRLQLQG-ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL---ACAYAYQILL 86
           P +  KTRLQ QG + +   S+ Y G     + I++ EG  GL +GL      Y   +++
Sbjct: 58  PFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMI 117

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM- 145
                 +YD        C       +                       +P+ +VKTR+ 
Sbjct: 118 ---YFSVYD-------FCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLM 167

Query: 146 -QALAPRRVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY---- 198
            Q    +      G +   R+++   +  G + LY G+  ALL   +  A+Q  +Y    
Sbjct: 168 LQTGIGKYSTHYKGTIDTFRKII---QQEGAKALYAGLVPALLGM-LNVAIQFPLYENLK 223

Query: 199 -----SHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR---GGLYR 250
                S + +  +           LAS LS +       P ++  TRM         + R
Sbjct: 224 IRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQR 283

Query: 251 GPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             L  +  T RQEGF+  Y G    L+R  P  ++ L   E
Sbjct: 284 HLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFE 324

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 73/183 (39%), Gaps = 12/183 (6%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNPI  VKTRL LQ   +   S  Y G       I + EG + L  GL  A    +L   
Sbjct: 156 TNPIWVVKTRLMLQTG-IGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL-GMLNVA 213

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS-PLQLVKTRMQA 147
            +  LY+ L+   G    +D  T                        + P ++++TRMQ 
Sbjct: 214 IQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL 273

Query: 148 LAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKE 203
            +      LP  + R L+ L K      G  G Y G    L+RT   + V L  + ++K+
Sbjct: 274 KSD-----LPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKK 328

Query: 204 ALS 206
            L+
Sbjct: 329 YLT 331

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRM-------YHHRGGLYRGPLDCLCKTVRQEGFSALYK 270
           L+ ALS++ VC    PFDVA TR+         H+   Y+G         + EG + LYK
Sbjct: 47  LSGALSAMLVC----PFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 271 GHLAQLLRIAPHTILCLTLME 291
           G    +L   P  ++  ++ +
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD 123

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLAC 78
           T T P E ++TR+QL+ +L   V R        + + YR EG  G   G A 
Sbjct: 259 TVTYPHEILRTRMQLKSDLPNTVQRHL---LPLIKITYRQEGFAGFYSGFAT 307

>Kwal_27.12081
          Length = 369

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 66/139 (47%), Gaps = 7/139 (5%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMA---LYTLASALS 223
           L+K  G R L++G+   L+      ++    Y   K+  SR   +G     ++ +++A +
Sbjct: 118 LYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATA 177

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGG---LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
             A   A NP  +  TR+   + G    Y+   DCL   +++EGF  LYKG  A  L  +
Sbjct: 178 GWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-S 236

Query: 281 PHTILCLTLMEQALRVVRL 299
              IL   L EQ  +++++
Sbjct: 237 VEGILQWLLYEQMKQMIKM 255

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY 80
           T TNPI  +KTRLQL     AG +R Y      +  I + EG  GL +GL+ +Y
Sbjct: 183 TATNPIWLIKTRLQLDK---AGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASY 233

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 76/186 (40%), Gaps = 23/186 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +P+ L+KTR+Q                 L  + +  G  GLY+G+ A+ L + V   +Q 
Sbjct: 186 NPIWLIKTRLQLDKAGHTRQYKNSWDC-LKHIIQKEGFFGLYKGLSASYLGS-VEGILQW 243

Query: 196 AVYSHAKEALSR-------HVPDGMALYTL----------ASALSSVAVCIAMNPFDVAM 238
            +Y   K+ +         H+ +G    +           ++ L+     I   P +V  
Sbjct: 244 LLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVR 303

Query: 239 TRM----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           TR+      +    Y G +      +++EG +++Y G    LLR  P++I+     E  +
Sbjct: 304 TRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVI 363

Query: 295 RVVRLV 300
           +++  V
Sbjct: 364 KLLSDV 369

>Scas_691.4
          Length = 334

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 109/295 (36%), Gaps = 50/295 (16%)

Query: 30  NPIETVKTRLQL---------QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY 80
           +P++T+K R+Q+          G +  G +            IY  EG   L +GL    
Sbjct: 32  HPLDTIKVRMQIAKRTEGMRPHGFITTGRN------------IYSHEGFLALYKGLGAVV 79

Query: 81  AYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQL 140
              I     R   Y+  R AL     +D+ T                        +P+++
Sbjct: 80  IGIIPKMAIRFSSYEFYRNAL-----TDKETRTITTGNTFLAGVGAGITEAVLVVNPMEV 134

Query: 141 VKTRMQALAPRRVPPLPGRMGRRLVA-----------------LFKDRGVRGLYQGVDAA 183
           VK R+QA     + P P  +     A                 + K+ G   LY+GV   
Sbjct: 135 VKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLT 194

Query: 184 LLRTGVGSAVQLAVYSHAKEALSR-HVPDGMALY-TLASALSSVAVCIAMN-PFDVAMTR 240
             R          VYS+ K+ L + H  + +  + T    L S A+    N P D   TR
Sbjct: 195 AARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTR 254

Query: 241 MYHHR----GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           +   +       ++       + +++EGF ALYKG   +++R+AP   +  T+ E
Sbjct: 255 LQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 309

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 70/192 (36%), Gaps = 20/192 (10%)

Query: 30  NPIETVKTRLQLQ--GELV---AGVSRL----------YSGPAQAVSLIYRTEGLRGLQQ 74
           NP+E VK RLQ Q   +L+   AGVS            Y+    A   I + EG   L +
Sbjct: 130 NPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYR 189

Query: 75  GLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXX 134
           G++   A Q    G+   +Y  L+       L                            
Sbjct: 190 GVSLTAARQATNQGANFTVYSYLKD-----YLQKYHNRESLPSWETSCIGLISGAIGPFS 244

Query: 135 XSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
            +PL  +KTR+Q            ++      L K+ G R LY+G+   ++R   G AV 
Sbjct: 245 NAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVT 304

Query: 195 LAVYSHAKEALS 206
             VY   ++ L 
Sbjct: 305 FTVYEFVRKHLE 316

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/284 (20%), Positives = 110/284 (38%), Gaps = 27/284 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++ VKT +QLQ  +  G    Y G    +  I   EG   L +G++     +     ++
Sbjct: 29  PLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATK 86

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAP 150
               D  +        +++ T                         P +LVK R+Q ++ 
Sbjct: 87  FACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVV-----PFELVKIRLQDVSS 141

Query: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL----- 205
           +   P+       +  + +  G+  +Y G+++ + R G+ +A    +    +  L     
Sbjct: 142 KFTSPI-----AVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKAST 196

Query: 206 -SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR--GGL---YRGPLDCLCKT 259
            S    + +   T+   LSS    +   PFDV  +R+ +     G+   Y      L   
Sbjct: 197 KSEQTRNDLLAGTVGGTLSS----LLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATI 252

Query: 260 VRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
            ++EGF ALYKG + ++LR+ P   + L +    +   R V  +
Sbjct: 253 YKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHEK 296

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 205 LSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG----LYRGPLDCLCKTV 260
           +S   P       +A A++ V+  + M P D+  T M     G     Y+G  DCL +  
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 261 RQEGFSALYKGHLAQLLRIAPH 282
            +EG S LYKG  + +L  AP 
Sbjct: 61  AKEGPSRLYKGISSPILMEAPK 82

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           + P + VK+R+Q    ++ GV R Y+    A++ IY+ EG + L +G 
Sbjct: 219 STPFDVVKSRVQ-NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGF 265

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 73/179 (40%), Gaps = 8/179 (4%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNPI  +KTR+ +    V   SR Y      +  +YR EGL G  +GL  +  + +    
Sbjct: 138 TNPIWVIKTRI-MSTSFVD--SRSYRSTVDGIKKLYRIEGLAGFWRGLVPS-LFGVSQGA 193

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
               +YD L+         D++                          PLQL+K+ +Q+ 
Sbjct: 194 IYFTVYDTLKYHYFAAKHVDKK--KKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSF 251

Query: 149 APRRV--PPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL 205
               V  P    R+ + +  ++   GV GLY+G+ A L+R    + +   VY + +  L
Sbjct: 252 EVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFRHWL 310

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 69/163 (42%), Gaps = 19/163 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGV-RGLYQGVDAALLRTGVGSAVQL 195
           PL LVK R+Q LA  + P     + +R+V   K     R  Y+G+   LL   V   +  
Sbjct: 28  PLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGLGVNLLGNSVAWGLYF 87

Query: 196 AVYSHAKEALSRHVPDGMA---------------LYTLASALSSVAVCIAMNPFDVAMTR 240
            +Y  +K+ + +     +                +Y LA+A+S VA  +  NP  V  TR
Sbjct: 88  GLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTR 147

Query: 241 MYHHR---GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
           +          YR  +D + K  R EG +  ++G +  L  ++
Sbjct: 148 IMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGVS 190

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 70/173 (40%), Gaps = 22/173 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLV----ALFKDRGVRGLYQGVDAALLRTGVGS 191
           +P+ ++KTR+ + +      +  R  R  V     L++  G+ G ++G+  +L     G 
Sbjct: 139 NPIWVIKTRIMSTSF-----VDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGVSQG- 192

Query: 192 AVQLAVYSHAKEAL--SRHVPDGMAL----YTLASALSSVAVCIAMNPFDVAMTRMYHHR 245
           A+   VY   K     ++HV     L    Y   ++LS +    A+ P  +  + +    
Sbjct: 193 AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFE 252

Query: 246 GGLYRGP------LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
                 P         +     ++G + LYKG LA L+R  P T +   + E 
Sbjct: 253 VSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYEN 305

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 19/273 (6%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89
           +P++T+K R+Q+    V G      G  +    IYR EG     +GL             
Sbjct: 29  HPLDTIKVRMQIYKNAV-GSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI 87

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA-- 147
           R   Y+  R      +L+D+ T                        +P+++VK R+QA  
Sbjct: 88  RFSSYEFYR-----TLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQH 142

Query: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR 207
           L P    P      +    + K+ G   LY+GV     R          VYS  KE L  
Sbjct: 143 LNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG 202

Query: 208 HVPDGM--ALYTLASALSSVAVCIAMN-PFDVAMTRMYHHRG-----GLYRGPLDCLCKT 259
           +    M  +  T    L S A+    N P D   TR+   +      GL R  +  + K 
Sbjct: 203 YHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR--ITIIGKQ 260

Query: 260 -VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
            +++EGF ALYKG   +++R+AP   +  T  E
Sbjct: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 72/179 (40%), Gaps = 23/179 (12%)

Query: 137 PLQLVKTRMQALA---PRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           P+  +KTRMQA++         LP  M  ++  +    G   L++GV + +L  G   AV
Sbjct: 37  PIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAV 96

Query: 194 QLAVYSHAK------EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247
             A Y   K      E    H P   A   L+  L++VA    MNPFD    R+  H   
Sbjct: 97  YFATYEMCKSRLIDPEDRQTHQPLKTA---LSGTLATVAADALMNPFDTIKQRLQLH--- 150

Query: 248 LYRGPLD----CLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVEN 302
               P D    C  +  ++EG +A +  +   +    P   L   + E + ++     N
Sbjct: 151 ----PSDSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNN 205

>Scas_589.10
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 107/288 (37%), Gaps = 26/288 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQ--------AVSLIYRTEGLRGLQQGLACAYAY 82
           P++ VKTR QLQ    A  +   + P Q         +S I + EG + L +G++     
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 83  QILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVK 142
           ++     +    +  +      ++  +                           P +LVK
Sbjct: 93  EVPKRAVKFASNEQFQQ-----IMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVK 147

Query: 143 TRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK 202
            R+Q        P+  R  R ++   +++G+ G+Y G ++ + R  + +A    +    K
Sbjct: 148 IRLQDAQSDYRSPI--RCTRTII---ENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVK 202

Query: 203 EALSRHVP----DGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR----GGLYRGPLD 254
           + + R        G+    L  A++    C    PFDV  TRM   +    G  Y     
Sbjct: 203 KFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQ 262

Query: 255 CLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVEN 302
            +    R EG   +YKG L  + R  P   L L +      + R+ ++
Sbjct: 263 SVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELFRMSDH 310

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 14/94 (14%)

Query: 218 LASALSSVAVCIAMNPFDVAMTR--MYHHRGGL------------YRGPLDCLCKTVRQE 263
           ++ A++ ++  I M P DV  TR  +  ++  L            +   L CL K +++E
Sbjct: 18  ISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEE 77

Query: 264 GFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
           GF  LYKG    LL   P   +     EQ  +++
Sbjct: 78  GFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIM 111

>Scas_687.15*
          Length = 328

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 1/114 (0%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVA 226
           ++  RG+RG  QG    + R    S V+   Y+  K+ +S   P            SS A
Sbjct: 187 IYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYAFGIGLFSSCA 246

Query: 227 VCIAMNPFDVAMTRMYHHRGG-LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRI 279
           V     P DV  TRM        Y+  L+C  +   +EG  +L+KG L +L ++
Sbjct: 247 VVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKV 300

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 79/190 (41%), Gaps = 16/190 (8%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89
           NP+E VK RLQ Q    A   + Y    QA  LI + EG+  L +G++   A Q    G+
Sbjct: 175 NPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGA 234

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALA 149
              +Y  L   L      +                           +PL  +KTR+Q   
Sbjct: 235 NFTVYSKLMERL-----QEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289

Query: 150 PRRVPPLPGRM---GRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALS 206
             R      R+   GR+LV   ++ G R LY+G+   ++R   G AV   VY    E + 
Sbjct: 290 STRNLSNWVRITTIGRQLV---QEEGFRALYKGITPRVMRVAPGQAVTFTVY----EFVR 342

Query: 207 RHVPDGMALY 216
           RH+ +G+ L+
Sbjct: 343 RHL-EGLGLF 351

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 105/275 (38%), Gaps = 24/275 (8%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89
           +P++T+K R+Q+      G      G  +  + IY  EGL    +GL       I     
Sbjct: 76  HPLDTIKVRMQIYRRANEGTKP--PGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAI 133

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALA 149
           R   Y+  R      +L+DR+T                        +P+++VK R+QA  
Sbjct: 134 RFSSYEFYR-----TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQH 188

Query: 150 PRRVPPLPGRMGRRLVA--LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL-- 205
                           A  + K+ G+  LY+GV     R          VYS   E L  
Sbjct: 189 LHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQE 248

Query: 206 ---SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKT--- 259
              S+++P      +L   +S      +  P D   TR+   +    R   + +  T   
Sbjct: 249 YHGSQNLPSWET--SLIGLVSGAIGPFSNAPLDTIKTRLQKDKS--TRNLSNWVRITTIG 304

Query: 260 ---VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
              V++EGF ALYKG   +++R+AP   +  T+ E
Sbjct: 305 RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

>Scas_379.2
          Length = 301

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 66/166 (39%), Gaps = 12/166 (7%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+Q+ + +    +  +M +   A     G   L++GV + +L  G   AV  A
Sbjct: 43  PIDALKTRIQSTSAKSTSNMLSQMAKISTA----EGSLALWKGVQSVILGAGPAHAVYFA 98

Query: 197 VYSHAKEALSRHVPDGMALYTLASALSSVAVCIA----MNPFDVAMTRMYHHRGGLYRGP 252
            Y + K+ L     D      L +ALS     IA    MNPFD    RM  +        
Sbjct: 99  TYEYTKKYLIDE-KDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTTV--- 154

Query: 253 LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
            +   +  + EGFSA Y  +   L    P       + E A +   
Sbjct: 155 WNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFFN 200

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 106/285 (37%), Gaps = 28/285 (9%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLACAYAYQI 84
           T  +P E VK  LQ+Q    A       G   AV  +YR EG  GL    GL C   +  
Sbjct: 38  TVVSPFERVKILLQVQNSTTA----YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFP- 92

Query: 85  LLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
             +  +  +Y+  +        S  R                          PL LV+TR
Sbjct: 93  -YSAVQFVVYEACKKHFFHVDGSKGRE--QLQNWQRLFSGALCGGCSVLATYPLDLVRTR 149

Query: 145 MQ-------ALAPRRVPPL--PGRMGRRLVALFKDRG-VRGLYQGVDAALLRTGVGSAVQ 194
           +         L+  R   +  P  +   L   +K+ G ++GLY+GV    L      A+ 
Sbjct: 150 LSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209

Query: 195 LAVYSHAKEALSRHVPDGMA-LYTLA-SALSSVAVCIAMNPFDVAMTRMY------HHRG 246
            AVY   KE +     + +A  Y L+  ALS         PFD+   R        +  G
Sbjct: 210 FAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG 269

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             Y+  +D L    + EGF   YKG  A L ++ P T +   + E
Sbjct: 270 FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 22/147 (14%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASA--LSS 224
           ++++ G  GL++G     +R    SAVQ  VY   K+    HV        L +   L S
Sbjct: 70  VYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF-HVDGSKGREQLQNWQRLFS 128

Query: 225 VAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-GF 265
            A+C     +A  P D+  TR+      L +             G  D LC+T ++E G 
Sbjct: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188

Query: 266 SALYKGHLAQLLRIAPHTILCLTLMEQ 292
             LY+G     L + P+  L   + EQ
Sbjct: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQ 215

>Kwal_55.20868
          Length = 380

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 80/189 (42%), Gaps = 16/189 (8%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYA--YQILL 86
           TNP+  VKTRL LQ   V   S  Y+    A   +Y TEGLR    GL  +    + + +
Sbjct: 191 TNPVWVVKTRLMLQTH-VNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFHVAI 249

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS-PLQLVKTRM 145
           +     +Y+ L+  L  C  S  RT                        + P ++++TRM
Sbjct: 250 H---FPIYEKLKVWLH-CTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM 305

Query: 146 QALAPRRVPPLPG-----RMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY 198
           Q L      PL       R G  R +   +K  G+RG Y G  A L RT   SA+ L  +
Sbjct: 306 Q-LKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF 364

Query: 199 SHAKEALSR 207
            + ++ L++
Sbjct: 365 EYFRKYLTK 373

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 62/149 (41%), Gaps = 9/149 (6%)

Query: 137 PLQLVKTRMQALAPRRVPP--LPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           PL + KTR+QA      P     G +G  L  + +D G RGLY+G+   ++       + 
Sbjct: 95  PLDVAKTRLQAQGLHSNPSNYYKGILGT-LTTIIRDEGARGLYKGLVPIIMGYFPTWMIY 153

Query: 195 LAVYSHAKEALSRHVPDGMALYTLASALSSVAV-CIAMNPFDVAMTRMY-----HHRGGL 248
            +VY  +K+   R  P    +   ASAL++  V  I  NP  V  TR+      +     
Sbjct: 154 FSVYERSKKLYPRIFPSFDFISHSASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTH 213

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           Y    D   K    EG    Y G L  LL
Sbjct: 214 YTSTFDAFHKMYTTEGLRTFYAGLLPSLL 242

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 99/285 (34%), Gaps = 38/285 (13%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++  KTRLQ QG L +  S  Y G    ++ I R EG RGL +GL              
Sbjct: 95  PLDVAKTRLQAQG-LHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPII---------- 143

Query: 91  LGLYDPLRAALGGCVLSDR---RTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR--M 145
           +G +            S +   R +                       +P+ +VKTR  +
Sbjct: 144 MGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVSTILTNPVWVVKTRLML 203

Query: 146 QALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALL---RTGVGSAV--QLAVYSH 200
           Q    +               ++   G+R  Y G+  +LL      +   +  +L V+ H
Sbjct: 204 QTHVNKNSTHYTSTFD-AFHKMYTTEGLRTFYAGLLPSLLGLFHVAIHFPIYEKLKVWLH 262

Query: 201 AKEALSRHVPDGMAL--YTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCK 258
              ++SR     + L    +AS+ S +       P ++  TRM          PL  L K
Sbjct: 263 CTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM--QLKAYPTDPLAALQK 320

Query: 259 TVRQ------------EGFSALYKGHLAQLLRIAPHTILCLTLME 291
           T R             EG    Y G  A L R  P + + L   E
Sbjct: 321 TSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRM-----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGH 272
           +A  L+ V VC    P DVA TR+     + +    Y+G L  L   +R EG   LYKG 
Sbjct: 84  MAGFLAGVTVC----PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 273 LAQLLRIAPHTILCLTLMEQALRV 296
           +  ++   P  ++  ++ E++ ++
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKL 163

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYS----GPAQAVSLIYRTEGLRGLQQGLACAYA 81
           T T P E ++TR+QL+      ++ L      G  + +   Y++EGLRG   G     A
Sbjct: 293 TLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLA 351

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 12/170 (7%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K +      R+  P   + GR  V + KD G+ GLY+G      R   GS     
Sbjct: 137 PLDVLKIK------RQTNPEAFK-GRGFVKILKDEGL-GLYRGWGWTAARNAPGSFALFG 188

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +     +   ++S + + A  I   P DV  TR+ +          
Sbjct: 189 GNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGF 248

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV-RLVEN 302
             +  T++ EGFSA +KG   +LL   P  +    L +  + V   LV+N
Sbjct: 249 TIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFALAQTLIPVFDNLVKN 298

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 67/150 (44%), Gaps = 10/150 (6%)

Query: 137 PLQLVKTRMQA--LAPR-RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           PL + KTR+QA  L  R   P   G MG  L  + +D G RGLY+G+   +L       +
Sbjct: 97  PLDVAKTRLQAQGLQTRFENPYYRGIMGT-LSTIVRDEGPRGLYKGLVPIVLGYFPTWMI 155

Query: 194 QLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAM-NPFDVAMTRMYHHRG-----G 247
             +VY  +K+      P    +    +A+++ A    + NP  V  TR+           
Sbjct: 156 YFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPT 215

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
            Y+G  D   K   QEGF ALY G +  LL
Sbjct: 216 HYKGTFDAFRKLFYQEGFKALYAGLVPSLL 245

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 73/188 (38%), Gaps = 19/188 (10%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T TNPI  VKTRL LQ  L    +  Y G   A   ++  EG + L  GL  +     LL
Sbjct: 192 TLTNPIWVVKTRLMLQSNLGEHPTH-YKGTFDAFRKLFYQEGFKALYAGLVPS-----LL 245

Query: 87  NGSRLGLYDPLRAALG---GCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKT 143
               + ++ P+   L     C   +  T                         P ++++T
Sbjct: 246 GLFHVAIHFPIYEDLKVRFHCYSRENNT-NSINLQRLIMASSVSKMIASAVTYPHEILRT 304

Query: 144 RMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
           RMQ  +      +P  + RRL  L K      G++G Y G    L+RT   SA+ L  + 
Sbjct: 305 RMQLKS-----DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

Query: 200 HAKEALSR 207
           + +  L  
Sbjct: 360 YFRNRLEN 367

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/273 (21%), Positives = 95/273 (34%), Gaps = 22/273 (8%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++  KTRLQ QG      +  Y G    +S I R EG RGL +GL              
Sbjct: 97  PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIY 156

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAP 150
             +Y+  +    G        +                       +P+ +VKTR+   + 
Sbjct: 157 FSVYEFSKKFFHGI-------FPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSN 209

Query: 151 RRVPPLPGR-MGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS--------HA 201
               P   +        LF   G + LY G+  +LL      A+   +Y         ++
Sbjct: 210 LGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHVAIHFPIYEDLKVRFHCYS 268

Query: 202 KEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR---GGLYRGPLDCLCK 258
           +E  +  +   +    +AS++S +       P ++  TRM         + R     +  
Sbjct: 269 RENNTNSI--NLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKA 326

Query: 259 TVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           T  QEG    Y G    L+R  P + + L   E
Sbjct: 327 TYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMY------HHRGGLYRGPLDCLCKTVRQEGFSALYKG 271
            A  LS VAVC    P DVA TR+             YRG +  L   VR EG   LYKG
Sbjct: 86  FAGFLSGVAVC----PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 272 HLAQLLRIAPHTILCLTLME 291
            +  +L   P  ++  ++ E
Sbjct: 142 LVPIVLGYFPTWMIYFSVYE 161

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 65/158 (41%), Gaps = 11/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K + Q   P          GR  + + KD G  GLY+G      R   GS     
Sbjct: 138 PLDVLKIKRQT-NPESFK------GRGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALFG 189

Query: 197 VYSHAKEALSRHVPDGMALYT---LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE +      G A ++   ++S + + A  I   P DV  TR+ +          
Sbjct: 190 GNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGF 249

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T++ EGF+A +KG   +LL   P  +    L +
Sbjct: 250 KIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQ 287

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 110/295 (37%), Gaps = 45/295 (15%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLAC--AYAY 82
           T  +P E VK  LQ+Q    A    L+     A+  +Y+ E ++GL    GL C   + Y
Sbjct: 39  TVVSPFERVKILLQVQSSTTAYNKGLF----DAIGQVYKEENIKGLFRGNGLNCIRVFPY 94

Query: 83  Q----ILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPL 138
                ++  G +  ++       G  + + +R +                        PL
Sbjct: 95  SAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY----------PL 144

Query: 139 QLVKTRMQA-------LAPRRVPPL---PGRMGRRLVALFKDRGVRGLYQGVDAALLRTG 188
            LV+TR+         L+  R   +   PG       A  ++ G+ GLY+GV    L   
Sbjct: 145 DLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIV 204

Query: 189 VGSAVQLAVYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY 242
              A+  AVY   KE +      +  + D +   ++ +    VA  I   PFD+   R  
Sbjct: 205 PYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY-PFDLLRRRFQ 263

Query: 243 ------HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
                 +  G  Y    D L    + EGF   YKG  A L ++ P T +   + E
Sbjct: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 61/158 (38%), Gaps = 24/158 (15%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP---DGMALYTLASALS 223
           ++K+  ++GL++G     +R    SAVQ  V+   K+ +  HV     G  L       S
Sbjct: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIF-HVDTKGKGEQLNNWQRLFS 129

Query: 224 SVAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-G 264
             A+C     +A  P D+  TR+      L +             G    L K   +E G
Sbjct: 130 G-ALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGG 188

Query: 265 FSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVEN 302
              LY+G     L I P+  L   + EQ    +   EN
Sbjct: 189 IMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDEN 226

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 65/158 (41%), Gaps = 10/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K +      R+  P   + GR  + + KD G+  LY+G      R   GS     
Sbjct: 138 PLDVLKIK------RQTNPEAFK-GRGFLKILKDEGIFNLYRGWGWTAARNAPGSFALFG 190

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +     +   ++S + + A  I   P DV  TR+ +          
Sbjct: 191 GNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGF 250

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T++ EGF+A +KG   +LL   P  +    L +
Sbjct: 251 KIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQ 288

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 108/276 (39%), Gaps = 29/276 (10%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T+P++  K RLQ      A + +      Q +  I + EG+ GL  GL+ +   Q     
Sbjct: 24  THPLDLTKVRLQ-----AAPIPK--PTIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTT 76

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
           +R G+YD L+  +   +  D+ T                            L+  RMQ  
Sbjct: 77  ARFGMYDALKEHV---IPRDKLTNMWYLLGASMVSGALGGLAGNFA----DLINIRMQN- 128

Query: 149 APRRVPPLPGRMGRR-----LVALFKDRGVRGLY-QGVDAALLRTGVGSAVQLAVYSHAK 202
                 PL  R   +     +V ++K  G + L+  G    ++R  + +A Q+  Y   K
Sbjct: 129 --DSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFK 186

Query: 203 EALSRHV---PDGMALYTLASALSSVAVCIAMNPFDVAMT-RMYHHR--GGLYRGPLDCL 256
             L       P   + +  +S L+        +P DV  T  M  H+  G  +      L
Sbjct: 187 NFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKIL 246

Query: 257 CKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            + + +EG S +++G +    R+AP T+L    MEQ
Sbjct: 247 MEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQ 282

>Kwal_33.14050
          Length = 314

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 68/174 (39%), Gaps = 17/174 (9%)

Query: 137 PLQLVKTRMQALAP-----RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGS 191
           P+  +KTRMQAL+           LP  + +++  +    G   L++GV + +L  G   
Sbjct: 36  PIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILGAGPAH 95

Query: 192 AVQLAVYSHAK------EALSRHVPDGMALYTLASAL-SSVAVCIAMNPFDVAMTRMYHH 244
           AV  A Y   K      +    H P    L T AS + ++VA  + MNPFD    RM   
Sbjct: 96  AVYFATYEMCKSYLIDPQDFQTHQP----LKTAASGIAATVAADLLMNPFDTIKQRMQLR 151

Query: 245 RGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
                R       +  R EG +A +  +   +    P       + E A +   
Sbjct: 152 TFSKDRM-WSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFN 204

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 75/197 (38%), Gaps = 14/197 (7%)

Query: 31  PIETVKTRLQLQGELVAGVSRL---YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           P E +KTRLQLQG       R    Y     AV+ I R EG   L  G     +  +  +
Sbjct: 170 PSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFS 229

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
           G +   Y+  R       + ++                          +PL +VKTR+Q 
Sbjct: 230 GLQFAFYEKFRQL--AFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQT 287

Query: 148 LAPR---------RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY 198
             P          +   L   + + ++ ++K  G+ GL+ GV    + T + S++ L +Y
Sbjct: 288 QLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

Query: 199 SHAKEALSRHVPDGMAL 215
             A + L   + D   L
Sbjct: 348 QVALKTLDSKLSDEKKL 364

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 14/177 (7%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAV 197
           L  VKTR Q  AP  V      +G     + ++   +GLY G   A+L +   +A+  A 
Sbjct: 76  LDTVKTRQQG-APSTVK-YKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFAT 133

Query: 198 YSHAKEAL--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRM---------YHHRG 246
           Y + K  +     + +  +  T A  L          P +V  TR+         +   G
Sbjct: 134 YEYTKRKMIGEWGINETFSHLT-AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSG 192

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
             Y+   D +   VR+EG+  L+ G+ A L R  P + L     E+  ++   VEN+
Sbjct: 193 YNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENK 249

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 29  TNPIETVKTRLQLQGELVAGVSR-------LYSGPAQAVSLIYRTEGLRGLQQGLACAYA 81
           T P++ VKTR+Q Q   +   S        L +   + +  +Y+TEGL GL  G+   + 
Sbjct: 275 TTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFI 334

Query: 82  YQILLNGSRLGLY 94
           +  + +   L LY
Sbjct: 335 WTSIQSSIMLLLY 347

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 102/273 (37%), Gaps = 36/273 (13%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGS 89
           P +TVK RLQ Q       + L+      VS  Y+ EGL RG  QG+A       L +  
Sbjct: 28  PFDTVKVRLQTQS------AALFPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAV 81

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ--- 146
               ++  +A L  C       Y                       +P++LVK ++Q   
Sbjct: 82  LFVSFNRAQAVLENC-------YSCGPLEKVVFAGAIAGACTSYVLTPVELVKCKLQVSN 134

Query: 147 ---ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKE 203
                 PR    LP      L A+ K  G+ GL+QG     +R   G AV    Y   K 
Sbjct: 135 LTGVSGPRYTAVLP-----TLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKG 189

Query: 204 ALSRHVPDGMALYTLASALSSVAVCI-----AMNPFDVAMTRMYHHRGGLYRGPLDCLCK 258
            L+R    G    T+   L+S A        ++ P D   + M     GL  GP   +  
Sbjct: 190 WLARR--RGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGL--GP--AVRT 243

Query: 259 TVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
            +++ G +  Y+G    LLR  P   +   + E
Sbjct: 244 VLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 25/171 (14%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGR---------------RLVALFKDRGVRGLYQGVD 181
           PL + KTR+QA   +   P+   +G                 L  + +D  +RGLY+G+ 
Sbjct: 123 PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKGIV 182

Query: 182 AALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAM-NPFDVAMTR 240
             +L       +  +VY   K +  R+  +   L    SAL++ A+   + NP  V  TR
Sbjct: 183 PIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALTAGAISTTLTNPIWVVKTR 242

Query: 241 MYHHRG----GL--YRGPLDCLCKTVRQEGFSALYKG---HLAQLLRIAPH 282
           +    G    G+  Y+  LD   K  + EG  + Y G    L  LL +A H
Sbjct: 243 LMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLFGLLHVAIH 293

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 73/194 (37%), Gaps = 25/194 (12%)

Query: 27  TFTNPIETVKTRLQLQ-GELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQIL 85
           T TNPI  VKTRL LQ G+ + G++  Y     A   IY+ EG++    GL  +  + +L
Sbjct: 231 TLTNPIWVVKTRLMLQSGKNIKGMTH-YKNTLDAFIKIYKVEGIKSFYSGLIPSL-FGLL 288

Query: 86  LNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXX----------------XXX 129
                  +Y+ L+  L  C  S R                                    
Sbjct: 289 HVAIHFPVYEKLKKVL-HCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKM 347

Query: 130 XXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGV 189
                  P ++++TR+Q L     P +       +   +   G+RG Y G    + RT  
Sbjct: 348 IASTLTYPHEILRTRLQ-LKSDMKPSIK----SIIRTTYAKEGIRGFYSGFLTNMFRTVP 402

Query: 190 GSAVQLAVYSHAKE 203
            SA+ L  + + ++
Sbjct: 403 ASAITLVSFEYFRK 416

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/314 (19%), Positives = 110/314 (35%), Gaps = 55/314 (17%)

Query: 31  PIETVKTRLQLQG-ELVAGVSR------------LYSGPAQAVSLIYRTEGLRGLQQG-- 75
           P++  KTRLQ QG +L   V+R             YSG    ++ I R E +RGL +G  
Sbjct: 123 PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKGIV 182

Query: 76  -LACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXX 134
            +   Y    ++      +Y+        C LS  R +                      
Sbjct: 183 PIVLGYFPTWMI---YFSVYER-------CKLSYPRYFNNSEFLSHSMSALTAGAISTTL 232

Query: 135 XSPLQLVKTRMQALAPRRVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
            +P+ +VKTR+   + + +  +          + ++K  G++  Y G+  +L    +  A
Sbjct: 233 TNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLFGL-LHVA 291

Query: 193 VQLAVYSHAKEALSRHVPDG------------------------MALYTLASALSSVAVC 228
           +   VY   K+ L  + P G                        +    +AS  S +   
Sbjct: 292 IHFPVYEKLKKVLHCY-PSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKMIAS 350

Query: 229 IAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLT 288
               P ++  TR+   +  +       +  T  +EG    Y G L  + R  P + + L 
Sbjct: 351 TLTYPHEILRTRL-QLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLV 409

Query: 289 LMEQALRVVRLVEN 302
             E   +  +L  +
Sbjct: 410 SFEYFRKHFKLWND 423

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 71/177 (40%), Gaps = 14/177 (7%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNP+  +KTR+     +    S+ Y+    A++ IY  EGL+   +GL  +  + +    
Sbjct: 141 TNPMWVIKTRI-----MSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPS-LFGVTQGA 194

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS--PLQLVKTRMQ 146
               +YD L+       L DR                          S  PLQL+KT +Q
Sbjct: 195 LYFAIYDTLKLKY----LHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQ 250

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKE 203
               R       +M   + +++   G+ G Y+G+ A L+R    + +   VY H K 
Sbjct: 251 TF--RTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFKH 305

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 65/154 (42%), Gaps = 22/154 (14%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKD-RGVRGL----YQGVDAALLRTGVGS 191
           PL L+K R+Q  A    P       +R++   KD  G + L    Y+G+   ++   V  
Sbjct: 32  PLDLIKLRLQLAAIDLKPSSYYNQVQRII---KDGSGTQQLLKEAYRGLGINIIGNAVAW 88

Query: 192 AVQLAVYSHAKEAL----------SRHVPD---GMALYTLASALSSVAVCIAMNPFDVAM 238
            +   +Y  +K+ +          ++ + D     ++Y +++  S +A  +  NP  V  
Sbjct: 89  GLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGASGLATALLTNPMWVIK 148

Query: 239 TRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKG 271
           TR+   +    Y   L+ + +   +EG    ++G
Sbjct: 149 TRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRG 182

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 104/281 (37%), Gaps = 37/281 (13%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGS 89
           P +TVK RLQ QG  V      +      ++  Y+ EG+ +G  QG+A   A   + N +
Sbjct: 33  PFDTVKVRLQTQGRHV------FPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAA 86

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALA 149
               Y+        C    +                          +P++L+K ++Q   
Sbjct: 87  LFLSYNQ-------CSKFLQHYTNVSDLTNILISGAFAGSCASFVLTPVELIKCKLQVSN 139

Query: 150 PRRVP-------PLPGRMGR---RLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
            + +P        +  R  R    + A+ K+RG  GL+QG     +R   G     A Y 
Sbjct: 140 LQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYE 199

Query: 200 HAKEAL-SRH------VPDGMALYTL--ASALSSVAVCIAMNPFDVAMTRMYHHRGGLYR 250
             K+ L SRH      +P+    + L  + A + +A   ++ P D   + M     GL  
Sbjct: 200 LMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTEHLGLK- 258

Query: 251 GPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
                + K   ++G    Y+G    L+R  P       + E
Sbjct: 259 ---TAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYE 296

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 81/192 (42%), Gaps = 31/192 (16%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDR----GVRGLYQGVDAALLRTGVGS 191
           +PL+L+KTR+Q++   R       M + L+   ++     G + L++G++  L R    S
Sbjct: 172 APLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFS 231

Query: 192 AVQLAVYSHAKEALSRHVPDGMALYTLA------------SALSSVAVCIAMNPFDVAMT 239
           A+    Y   K+       +    + L+             ++S  +  +  +PFDV  T
Sbjct: 232 AIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKT 291

Query: 240 RM-------YHHRGGLY--------RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTI 284
           RM          R  L         RG    L    + EG+ ALY G + ++++IAP   
Sbjct: 292 RMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCA 351

Query: 285 LCLTLMEQALRV 296
           + ++  E + R+
Sbjct: 352 IMISTYELSKRL 363

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 77/177 (43%), Gaps = 14/177 (7%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVR-GLYQGVDAALLRTGVGSAVQLA 196
           L  VKTR Q  AP  V         R +AL  + GVR GLY G  AA+L +   +AV   
Sbjct: 74  LDTVKTRQQG-APGEVKYRHMISAYRTLAL--EEGVRRGLYGGYGAAMLGSFPSAAVFFG 130

Query: 197 VYSHAKEALSRHVPDGMALYTLASA-LSSVAVCIAMNPFDVAMTRM-----YHHR----G 246
            Y   K  +            LA+  L  +   +   P +V  TR+     Y++R    G
Sbjct: 131 TYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSG 190

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
             YRG  D +   VR EG SAL+ G+ A L R  P + L     E+  +   L+E +
Sbjct: 191 YNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERK 247

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 78/193 (40%), Gaps = 23/193 (11%)

Query: 31  PIETVKTRLQLQG-----ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQIL 85
           P E +KTRLQLQG        +G +  Y G + AV  I RTEG+  L  G     +  + 
Sbjct: 168 PSEVLKTRLQLQGCYNNRHFQSGYN--YRGLSDAVRTIVRTEGVSALFFGYKATLSRDLP 225

Query: 86  LNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM 145
            +  +   Y+  R      +L  +                          +PL +VKTR+
Sbjct: 226 FSALQFAFYERFRKW--AFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRI 283

Query: 146 Q-----------ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           Q           A AP R   L G + R L+ + +  G+ G + GV    + T + S++ 
Sbjct: 284 QTQPRGSAGTPDASAPAR---LNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIM 340

Query: 195 LAVYSHAKEALSR 207
           L +Y  A   L+R
Sbjct: 341 LLLYQTALRTLAR 353

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 75/167 (44%), Gaps = 21/167 (12%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL L+KTR+Q      +  +          L + R  R L++G   + LRT +GSA+ L+
Sbjct: 28  PLDLLKTRLQQAQASSLRSV----------LREVRTTRELWRGTLPSALRTSIGSALYLS 77

Query: 197 VYSHAKEALSRH---------VPDGMALYTLAS-ALSSVAVCIAMNPFDVAMTRMYHHRG 246
           + ++++ AL+R          +P   +   L + ALS  AV +   P  V   R Y    
Sbjct: 78  LLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVR-YESTL 136

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
             Y G  +      R EG    +KG  A  LR AP+  L + L EQA
Sbjct: 137 YAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQA 183

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 61/146 (41%), Gaps = 17/146 (11%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGM------------- 213
           +++  G RG ++G  A  LR    + + + +Y  AKE L R +P  +             
Sbjct: 149 IWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPA 208

Query: 214 -ALYTLASALSSVAVCIAMN-PFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKG 271
            A+    SA  S ++   +  PFD   TRM      +  G +  L   V +E    L+ G
Sbjct: 209 SAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPV--GFVQTLRHIVCEERARTLFDG 266

Query: 272 HLAQLLRIAPHTILCLTLMEQALRVV 297
              +L R A    +   + E+ L+++
Sbjct: 267 LSLRLCRKAMSACIAWGIYEELLKLL 292

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 67/180 (37%), Gaps = 22/180 (12%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACA------YA- 81
           T PI  +K R +    L A     Y+G A+A   I+R+EG RG  +G A        YA 
Sbjct: 122 TMPITVIKVRYE--STLYA-----YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAG 174

Query: 82  -YQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQL 140
            Y +L   ++  L   L A L G   S + T                        +P   
Sbjct: 175 LYVLLYEQAKEMLPRALPATLLGADESGKLT-APASAMVNGVSAFLSASLATTLTAPFDT 233

Query: 141 VKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           +KTRMQ      +   P    + L  +  +   R L+ G+   L R  + + +   +Y  
Sbjct: 234 IKTRMQ------LQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEE 287

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRL 52
           T T P +T+KTR+QLQ   V  V  L
Sbjct: 226 TLTAPFDTIKTRMQLQSHPVGFVQTL 251

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 9/140 (6%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMA---LYTLASALS 223
           ++K  G R L++G+   L+      ++    Y   K+  ++   +G     ++ +A+A +
Sbjct: 126 VYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLMAAATA 185

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGGL-----YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
             A   A NP  +  TR+   + G      Y+   DCL   +R EGF+ LYKG  A  L 
Sbjct: 186 GWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG 245

Query: 279 IAPHTILCLTLMEQALRVVR 298
            +   IL   L EQ  R+++
Sbjct: 246 -SVEGILQWLLYEQMKRLIK 264

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 79/184 (42%), Gaps = 23/184 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRR-LVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           +P+ L+KTR+Q     +      +     L ++ ++ G  GLY+G+ A+ L + V   +Q
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGS-VEGILQ 252

Query: 195 LAVYSHAKEAL--------------SRHVPDGMALY---TLASALSSVAVCIAMNPFDVA 237
             +Y   K  +              ++   + +  +   + ++ L+     IA  P +V 
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVV 312

Query: 238 MTRMYH--HRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
            TR+       G   Y G +      +++EG  ++Y G    L+R  P++I+     E  
Sbjct: 313 RTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372

Query: 294 LRVV 297
           +R++
Sbjct: 373 IRLL 376

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY 80
           NPI  +KTR+QL       V R Y      +  + R EG  GL +GL+ +Y
Sbjct: 194 NPIWLIKTRVQLDKAGKTSV-RQYKNSWDCLKSVIRNEGFTGLYKGLSASY 243

>Kwal_23.3529
          Length = 395

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 71/177 (40%), Gaps = 14/177 (7%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVR-GLYQGVDAALLRTGVGSAVQLA 196
           L  VKTR Q  AP    P    M      +F + G+R GLY G  AA+L +   +A+   
Sbjct: 106 LDTVKTRQQG-APN--APKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFG 162

Query: 197 VYSHAKEALSRHVPDGMALYTLASALS-SVAVCIAMNPFDVAMTRM---------YHHRG 246
            Y   K  L         L  L + LS  +   +   P +V  TR+         + H G
Sbjct: 163 TYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSG 222

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
             YR   D +   VR EG+  L+ G+ A L R  P +       E+  +    +E +
Sbjct: 223 YNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGK 279

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 71/189 (37%), Gaps = 16/189 (8%)

Query: 31  PIETVKTRLQLQG-----ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQIL 85
           P E +KTRLQLQG        +G +  Y     A++ I R EG + L  G        + 
Sbjct: 200 PSEVLKTRLQLQGCYNNPHFHSGYN--YRNLRDAITAIVRLEGWQTLFFGYKATLCRDLP 257

Query: 86  LNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRM 145
            +  +   Y+  R       L  +                          +P+ ++KTR+
Sbjct: 258 FSAFQFAFYEKFRQW--AFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRI 315

Query: 146 QALAPRRVPPLPGRMGR-------RLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVY 198
           Q   P  V     R+ R        L A+++  G  G + GV    + T + S++ L +Y
Sbjct: 316 QTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

Query: 199 SHAKEALSR 207
               ++L R
Sbjct: 376 QVTLKSLDR 384

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 29  TNPIETVKTRLQLQ-GELVAGVS----RLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQ 83
           T P++ +KTR+Q Q    VA  S    R+ +   + ++ +YR+EG  G   G+   + + 
Sbjct: 305 TTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWT 364

Query: 84  ILLNGSRLGLY 94
            + +   L LY
Sbjct: 365 SIQSSIMLLLY 375

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 6/116 (5%)

Query: 185 LRTGVGSAVQLAVYSHAKEALSRHV------PDGMALYTLASALSSVAVCIAMNPFDVAM 238
           LR     AV+   Y+  K+A+ R+       P G     L  ALS +    A  P D   
Sbjct: 177 LRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVK 236

Query: 239 TRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           TRM       Y   + C    VR+EG  AL++G   +L R+     +  T  E+ L
Sbjct: 237 TRMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

>Scas_562.12
          Length = 300

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 63/158 (39%), Gaps = 10/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K +      R+  P   + GR  V + KD G+  LY+G      R   GS     
Sbjct: 138 PLDVLKIK------RQTNPEAFK-GRGFVKILKDEGIFNLYRGWGWTAARNAPGSFALFG 190

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +     +   ++S + +    I   P DV  TR+ +         L
Sbjct: 191 GNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGL 250

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T + EG +A +KG   +LL   P  +    L +
Sbjct: 251 TIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 288

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 73/175 (41%), Gaps = 29/175 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+Q+ +          + +++  +    G   L++GV + +L  G   AV  A
Sbjct: 36  PVDAIKTRIQSSSSGAAT---QGLIKQISKITTAEGSLALWKGVQSVILGAGPAHAVYFA 92

Query: 197 VYSHAKEAL------SRHVP-----DGMALYTLASALSSVAVCIAMNPFDVAMTRMY-HH 244
            Y  +K  L        H P      GMA  T+A AL        MNPFDV   RM  + 
Sbjct: 93  TYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADAL--------MNPFDVIKQRMQLNT 144

Query: 245 RGGLYRGPLDCLCKTV-RQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
           R  ++      + K +  +EGF+A Y  +   L+   P       + E A + + 
Sbjct: 145 RESVWH-----VTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMN 194

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 29  TNPIETVKTRLQLQG-ELVAG-VSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           T P++ +KT LQ++G E V+  + +  +   +A S IY+  G +G  +GL
Sbjct: 219 TTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGL 268

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 101/291 (34%), Gaps = 54/291 (18%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQG-------------- 75
           +P +T+K RLQ   +     S  + GP   V   +  +G+RG   G              
Sbjct: 79  HPFDTIKVRLQTSQD-----STRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSV 133

Query: 76  -LACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXX 134
            L C + Y++LL   +   Y+  +  L GC++S                           
Sbjct: 134 MLGCLHNYRMLLK--KYVYYNEEKLPLSGCIISG----------------VMAGWSVSFI 175

Query: 135 XSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALL-RTGVGSAV 193
            +P++L K ++Q     +     G +   +  ++   GVRGLY+G+ + L+ RT      
Sbjct: 176 AAPVELAKAKLQVQYDAKTTKYTGPVD-VIKKVYSSNGVRGLYKGLTSTLIFRT------ 228

Query: 194 QLAVYSHAKEALSRHVPDGMALYTLASAL------SSVAVCIAMNPFDV--AMTRMYHHR 245
               +  + E L+R   +   +   A         +S        P DV   +       
Sbjct: 229 NFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKY 288

Query: 246 GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
            G +R          R  G+   +KG +   LR  P     L   E  LR 
Sbjct: 289 DGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRT 339

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQL 276
           ++   S +A     +PFD    R+   +    ++GPLDC+ KT  Q+G    Y G    L
Sbjct: 65  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPL 124

Query: 277 L 277
           +
Sbjct: 125 V 125

>Scas_702.10
          Length = 302

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 62/138 (44%), Gaps = 18/138 (13%)

Query: 137 PLQLVKTRMQALAPRRVPPLPG-RMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           PL L K R+QA       PLP   +GR L  + ++  V GLY G+ AA+LR    + V+ 
Sbjct: 29  PLDLAKVRLQA------APLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQCTYTTVRF 82

Query: 196 AVYSHAKEAL--SRHVPDGMALYTLASALSSVAVCIAMNPF-DVAMTRMYHHRG------ 246
             Y   KE L    H+ D   +Y L  ++ S A+   +  F DV   RM +         
Sbjct: 83  GAYDLMKENLIPQGHIND--MVYLLPCSMFSGAIGGLVGNFADVVNIRMQNDSALKPELR 140

Query: 247 GLYRGPLDCLCKTVRQEG 264
             YR  +D + K    EG
Sbjct: 141 RNYRNAIDGVYKIYMHEG 158

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 103/271 (38%), Gaps = 22/271 (8%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T+P++  K RLQ        + R+       ++ I R E + GL  GL+ A   Q     
Sbjct: 27  THPLDLAKVRLQAAPLPKPTLGRM-------LTTILRNENVMGLYSGLSAAVLRQCTYTT 79

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
            R G YD ++  L      +   Y                           +V  RMQ  
Sbjct: 80  VRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFA-------DVVNIRMQND 132

Query: 149 APRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
           +  + P L       +  ++K    + G++ L  G    ++R  + +A Q+  Y   K  
Sbjct: 133 SALK-PELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNY 191

Query: 205 LSRHV---PDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVR 261
           L   +   P   + +  AS L+ +      +P DV  TR+ +         +  L   ++
Sbjct: 192 LVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTESESAIKILTSAIK 251

Query: 262 QEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           +EG S +++G L    R+ P T+L    +EQ
Sbjct: 252 KEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQ 282

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 4/124 (3%)

Query: 172 GVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP-DGMALYT--LASALSSVAVC 228
           G++ L+ G    ++R  + +A Q+  Y   K  L   +  D    YT   AS L+ +   
Sbjct: 163 GLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVAT 222

Query: 229 IAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLT 288
              +P DV  TR+ +  G  ++  L  L   VR+EG S +++G L    R+ P T+L   
Sbjct: 223 TVCSPADVMKTRIMNGSGD-HQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFF 281

Query: 289 LMEQ 292
            +EQ
Sbjct: 282 AIEQ 285

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 6/166 (3%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +PL LVK R+Q         L G   R+++A   + G + +Y G  A  +   +  A + 
Sbjct: 37  TPLDLVKCRLQVNPKLYTSNLQGF--RKIIA---NEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 196 AVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDC 255
             Y + K   S  +  G+ +Y +ASA +     I + PF+    +            +D 
Sbjct: 92  GGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDG 151

Query: 256 LCKTVRQE-GFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300
             K   +  G  A YKG +    R  P+T+   T  E+ ++ +  V
Sbjct: 152 WKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 107/290 (36%), Gaps = 39/290 (13%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           + T P++TVK R QLQ          Y G       + R EG+R L +G   A A  +L 
Sbjct: 40  SVTAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLY 95

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
              + G Y  L  A     L  +                           PL L++TR+ 
Sbjct: 96  GSLQFGTYAWLNTAAASAGLPPQ--------AHSLAVGALAGLVSSLLTYPLDLLRTRL- 146

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALS 206
            +A R       R   R++  +   G  G ++G   A+  T + + +   +Y     A  
Sbjct: 147 -VANRSAHFFSLRRQARVI--WDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIA-- 201

Query: 207 RHVPDGMALYTLASALSSVAVCI---AMNPFDVAMTRMY----HHRGGLYRGP------- 252
               D   L  LA+A S  A  +   A+ P D    R+      H     R P       
Sbjct: 202 ---ADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALR 258

Query: 253 ----LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
               L      VR EG ++LYKG    L +  P T++ L + ++ LR++ 
Sbjct: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (43%), Gaps = 12/123 (9%)

Query: 174 RGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMAL-----------YTLASAL 222
           R LY+G+   LL   V  A+    Y  AK+   RH+ +  A            Y LA+  
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 223 SSVAVCIAMNPFDVAMTR-MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
           S +A  +  NP  V  TR M   R G Y+   D + K  + EG  A ++G +  LL ++ 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQ 182

Query: 282 HTI 284
             I
Sbjct: 183 GAI 185

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 68/178 (38%), Gaps = 22/178 (12%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRL--YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           TNPI  +KTR       +   SR   Y      V  +Y+TEG+    +G+  +     LL
Sbjct: 131 TNPIWVIKTR-------IMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPS-----LL 178

Query: 87  NGSRLGLYDPLRAALGGCVL--SDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
             S+  +Y  L   L    L  S  +                          P QL+K++
Sbjct: 179 GVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSK 238

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK 202
           +Q          P  + + +  ++   G+RG Y+G+ A LLR    + +   VY + K
Sbjct: 239 LQDFGA------PSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 66/163 (40%), Gaps = 12/163 (7%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +P+ ++KTR+  +A  R  P        +  L++  GV   ++GV  +LL    G A+  
Sbjct: 132 NPIWVIKTRI--MATSRAGPYKSTFDG-VYKLYQTEGVLAFWRGVVPSLLGVSQG-AIYF 187

Query: 196 AVYSHAKEALSRHVPD------GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249
           A+Y   K        D       ++     + +S +    ++ PF +  +++     G  
Sbjct: 188 ALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDF--GAP 245

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            G    +     +EG    Y+G  A LLR  P T +   + E 
Sbjct: 246 SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYEN 288

>Kwal_23.3965
          Length = 307

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 109/290 (37%), Gaps = 40/290 (13%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T P++T+K RLQLQ   +A  ++ Y G       + R EG+R L +G   A A  IL   
Sbjct: 32  TAPLDTLKIRLQLQ---LANEAQ-YGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
           ++   Y  L   L    L  +                           P  +++TR  A 
Sbjct: 88  TQFTSYAILNKLLSKSQLPAQ--------IHTGMVGALSGTCSAIASYPCDVLRTRFIAN 139

Query: 149 APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRH 208
             R +  +          +++  G RG ++GV ++++   V ++  LA Y   K      
Sbjct: 140 HSRELSTMLSTAQE----IWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVK-IFCEQ 194

Query: 209 VPDGMA-----LYTLASALSSVAVCIAMNPFDVAMTR--------MYH--HRGGLYR--- 250
            PD  +     L + AS ++ +     + P D    R        + H  H    Y+   
Sbjct: 195 RPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYK 254

Query: 251 -----GPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
                  L      V +EG  ALY G+   + +  P T++ L + E  LR
Sbjct: 255 SYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCLR 304

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHH--RGGLYRGPLDCLCKTVRQEGFSALYKGHL 273
           +A  LS ++  I   P D    R+         Y G L    + VRQEG  AL+KG++
Sbjct: 19  VAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76

>Scas_632.9
          Length = 292

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/306 (20%), Positives = 106/306 (34%), Gaps = 34/306 (11%)

Query: 1   MSPSTDTPVSK------LGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYS 54
           MS S D P+ K      L                  P +TVK RLQ QG      S ++ 
Sbjct: 1   MSESIDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQG------SHIFP 54

Query: 55  GPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYX 113
                +   Y  EG+ RG  QG+        L N +    Y+     L        +   
Sbjct: 55  TTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL-------EKFTN 107

Query: 114 XXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRR-----LVALF 168
                                 +P++L+K ++Q         + G++        L+ + 
Sbjct: 108 VSPLSNILLSGAFAGSCASFVLTPVELIKCKLQV--SNLQTAVEGQIKHTKIIPTLMYVL 165

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALS--RHVPDGMALYTLASALSS-V 225
           +++G+ GL+QG  +  +R  +G     A Y   K+ L   R   +      L S  S+ +
Sbjct: 166 REKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGL 225

Query: 226 AVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTIL 285
           A   ++ P D   + M      L    ++ + K +   G +  Y+G    L+R  P    
Sbjct: 226 AFNASIFPADTVKSMMQTEHITL----INAVKKVLTTYGITGFYRGLGITLIRAVPANAT 281

Query: 286 CLTLME 291
              + E
Sbjct: 282 VFYMYE 287

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGG------LYRGPLDCLCKTVRQEGFSALYKG 271
           ++ A + V+  + M P DV  TRM    G        Y G +DCL + V++EGFS LYKG
Sbjct: 13  VSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKG 72

Query: 272 HLAQLLRIAPH 282
             + +L  AP 
Sbjct: 73  ISSPMLMEAPK 83

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 65/174 (37%), Gaps = 17/174 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P E VK RLQ        V+  ++GP + V    R  G+  L  GL          NG  
Sbjct: 129 PFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGY 181

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA--- 147
            G+   +RA     +L   +T                        + L +VK+R+Q+   
Sbjct: 182 FGVIFQIRA-----LLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT 236

Query: 148 --LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
             LA   V P        L  ++ + G   LY+G    +LR G G  + L V++
Sbjct: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 99/265 (37%), Gaps = 26/265 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90
           P++ VKTR+QLQ     G    Y+G    +  I + EG   L +G++     +     ++
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 91  LGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAP 150
               D  +         D+ T                         P +LVK R+Q +  
Sbjct: 88  FACNDSYQKMFKDLYGVDKLT-----QQISILSGSLAGVTEACVIVPFELVKIRLQDVNS 142

Query: 151 RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTG------VGSAVQL-AVYSHAKE 203
           +   P+       +    ++ G+  LY G+++ + R         G   Q+ A+   AK 
Sbjct: 143 KFNGPM-----EVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKT 197

Query: 204 ALSRHVPDGMA----LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL---YRGPLDCL 256
              +   D +A     Y   S   ++   +       A T +    G +   Y      L
Sbjct: 198 NTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL--ADGTVVPKYNWTWPSL 255

Query: 257 CKTVRQEGFSALYKGHLAQLLRIAP 281
            K   +EGF+ALYKG + ++LR+ P
Sbjct: 256 FKIYSEEGFTALYKGFIPKILRLGP 280

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 22/183 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDR-----GVRGLYQGVDAALLRTGVG 190
           +PL+LVKT++Q++           M + L+   +         R L++G++  L R    
Sbjct: 177 APLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPF 236

Query: 191 SAVQLAVYSHAKEAL--------SRHVPDGMALYTLASA-LSSVAVCIAMNPFDVAMTR- 240
           SA+  + Y   KE L        S+       + + AS  +S +   I  +PFDV  TR 
Sbjct: 237 SAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRW 296

Query: 241 ---MYHHR----GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
              M ++     G   R     L    R EG +ALY G  A++++I P   + ++  E +
Sbjct: 297 QISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEIS 356

Query: 294 LRV 296
            +V
Sbjct: 357 KKV 359

>Scas_582.7
          Length = 329

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+Q+   +        + +++  +    G   L++GV + +L  G   AV  A
Sbjct: 56  PIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVYFA 115

Query: 197 VYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYR 250
            Y   K  L        H P  +A   ++ A ++VA    MNPFD    RM      L +
Sbjct: 116 TYEFTKAHLIPDSQRETHQPIKVA---VSGATATVASDFFMNPFDTIKQRM--QISDLKK 170

Query: 251 GPLDCLCKTVRQ-EGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
             +  + K +   EG SA Y  +   +    P       + E A +   
Sbjct: 171 EKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFFN 219

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 63/158 (39%), Gaps = 10/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K + Q   P          GR  + + +D G+  LY+G      R   GS     
Sbjct: 138 PLDVLKIKRQT-NPESFK------GRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFG 190

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +     +   ++S + + +  I   P DV  TR+ +         L
Sbjct: 191 GNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGL 250

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T++ EG +A +KG   +LL   P  +    L +
Sbjct: 251 RIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQ 288

>Kwal_23.4354
          Length = 343

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 35/189 (18%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDR-------GVRGLYQGVDAALLRTG 188
           +PL+L +TR+Q++ PR  P     M   +  L K+        G + L++G++  L R  
Sbjct: 159 APLELFRTRLQSI-PRSSPKSTTAM--MIKDLIKESRYEISKVGYKALFRGLEITLWRDV 215

Query: 189 VGSAVQLAVYSHAKEALS---------------RHVPDGMALYTLASALSSVAVCIAMNP 233
             S++    Y   K  +S                H  +     +   A+++V      +P
Sbjct: 216 PFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLT----HP 271

Query: 234 FDVAMTRMY--HHRGGLYRGPLDCLCKTVRQ----EGFSALYKGHLAQLLRIAPHTILCL 287
           FDV  TRM   +    L + P   + K + Q    EG +ALY G + ++++IAP   + +
Sbjct: 272 FDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMI 331

Query: 288 TLMEQALRV 296
           +  E   R+
Sbjct: 332 STYEVCKRL 340

>Kwal_27.11626
          Length = 299

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 64/158 (40%), Gaps = 11/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K +      R+  P   + GR  + + KD G  GLY+G      R   GS     
Sbjct: 137 PLDVLKIK------RQTNPESFK-GRGFIKILKDEGF-GLYRGWGWTAARNAPGSFALFG 188

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +     +   ++S + + A  I   P DV  TR+ +          
Sbjct: 189 GNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGF 248

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T++ EG +A +KG   +LL   P  +    L +
Sbjct: 249 RIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 286

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (45%), Gaps = 11/162 (6%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +PL ++KTRM + A   +  +     + L  L K+ GV+GL++G+  AL+    G A+  
Sbjct: 129 NPLWVIKTRMMSKANSDLTSM-----KVLRDLIKNDGVQGLWKGLVPALVGVSQG-ALHF 182

Query: 196 AVYSHAKEAL---SRHVPDGMALYTLA-SALSSVAVCIAMNPFDVAMTRMYHHRGGLYRG 251
             Y   K  L   +R   +   L T+A +++S +    A+ PF +  + +   +      
Sbjct: 183 TCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQASENDF 242

Query: 252 PLDCLCKTV-RQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            L  L K +  + G    YKG  A LLR  P T +   + E 
Sbjct: 243 KLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYEN 284

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 57/143 (39%), Gaps = 11/143 (7%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGV-RGLYQGVDAALLRTGVGSAVQL 195
           PL L K R+Q L           +   +V    D  + R LY+G+   L+   +   +  
Sbjct: 28  PLDLFKVRLQLLITSTTKKGYRNLWSEIVG--SDLSLTRELYRGLTVNLVGNTIAWGLYF 85

Query: 196 AVYSHAKEALS------RHVPD-GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL 248
           A Y  AK+ L       R+  D    +Y  ASA S +   +  NP  V  TRM   +   
Sbjct: 86  ASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRM-MSKANS 144

Query: 249 YRGPLDCLCKTVRQEGFSALYKG 271
               +  L   ++ +G   L+KG
Sbjct: 145 DLTSMKVLRDLIKNDGVQGLWKG 167

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 76/183 (41%), Gaps = 28/183 (15%)

Query: 136 SPLQLVKTRMQALAPR-----RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVG 190
           +PL+L++TR+Q++ PR     R   L G + R +       G R L++G++  L R    
Sbjct: 155 APLELLRTRLQSV-PRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPF 213

Query: 191 SAVQLAVYSHAKEAL-----SRHVPDGMALYTLASALSSVAVCIA---MNPFDVAMTRMY 242
           SA+    Y   K        + H       +  + A  S+   +A    +PFDV  TRM 
Sbjct: 214 SAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQ 273

Query: 243 --------------HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLT 288
                           +    RG    L    + EG  ALY G L ++++IAP   + ++
Sbjct: 274 IAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMIS 333

Query: 289 LME 291
             E
Sbjct: 334 TYE 336

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 71/186 (38%), Gaps = 19/186 (10%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGS 89
           P +TVK RLQ Q       S ++      +   Y+ EG+ RG  QG+A       L N +
Sbjct: 33  PFDTVKVRLQTQA------SNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENAT 86

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALA 149
               Y+     L        +                         +P++LVK ++Q +A
Sbjct: 87  LFVSYNQCSKFL-------EKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQ-VA 138

Query: 150 PRRVPPLPGRMGRRL---VALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL- 205
             +V     +  + L    A+  +RG+ GL+QG     +R   G     A Y   K++L 
Sbjct: 139 NLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLK 198

Query: 206 SRHVPD 211
            RH  D
Sbjct: 199 DRHSLD 204

>Kwal_14.2210
          Length = 315

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 111/311 (35%), Gaps = 83/311 (26%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLAC------ 78
           T  +P E VK  LQ+Q    A    L+    +AV  +Y  EG+ GL    GL C      
Sbjct: 33  TVVSPFERVKILLQVQSSTHAYNHGLF----RAVKQVYLEEGVPGLLRGNGLNCIRIFPY 88

Query: 79  ------AYAY-----------QILLNGSRLGLYDPLRAAL-GGCVLSDRRTYXXXXXXXX 120
                  Y +            ++LN  RL     +  AL GGC  S   TY        
Sbjct: 89  SAVQFLVYEFCKKQWFQQNPDTVVLNWHRL-----VSGALCGGC--SVLATY-------- 133

Query: 121 XXXXXXXXXXXXXXXSPLQLVKTRMQALAPR------------RVPPLPGRMGRRLVALF 168
                           PL LV+TR+                    PP    + R+     
Sbjct: 134 ----------------PLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT-- 175

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL-SRHVPDGMALYTLA-SALSSVA 226
           ++ G+ GLY+GV    +      A+  AVY   +E + +   P   +LY L+  A+S   
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGV 235

Query: 227 VCIAMNPFDVAMTRMY------HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
                 PFD+   R           G  Y+   D L    R EGF   YKG  A L ++ 
Sbjct: 236 AQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVV 295

Query: 281 PHTILCLTLME 291
           P T +   + E
Sbjct: 296 PSTAVSWVVYE 306

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 69/174 (39%), Gaps = 19/174 (10%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           SP + VK  +Q  +          + R +  ++ + GV GL +G     +R    SAVQ 
Sbjct: 36  SPFERVKILLQVQSSTHA--YNHGLFRAVKQVYLEEGVPGLLRGNGLNCIRIFPYSAVQF 93

Query: 196 AVYSHAKEALSRHVPDGMALYT---LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYR-- 250
            VY   K+   +  PD + L     ++ AL      +A  P D+  TR+      L R  
Sbjct: 94  LVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLH 153

Query: 251 -----------GPLDCLCKTVRQE-GFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
                      G  + L KT  QE G   LY+G     + + P+  L   + EQ
Sbjct: 154 KAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQ 207

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 106/281 (37%), Gaps = 41/281 (14%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T  +P+E VK  LQ+Q    A       G   AV  +Y+ EG++GL +G          +
Sbjct: 32  TVVSPVERVKILLQVQSSTTA----YNGGLVHAVKQVYKEEGVKGLFRGNG--------I 79

Query: 87  NGSRLGLYDPLRAALGGCVLS-----DRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLV 141
           N  R+  Y  ++ A+     +      +  +                        PL LV
Sbjct: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLV 139

Query: 142 KTRMQALAPR------------RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGV 189
           +TR+                  R PP    + RR+    ++ G+RG Y+GV    L    
Sbjct: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFR--EEGGLRGWYRGVYPTSLGVVP 197

Query: 190 GSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIAMN---PFDV------AMTR 240
             A+  A+Y   K AL  H  D  ++     A+ +V+  IA     PFD+       +T 
Sbjct: 198 FVALNFALYERLK-ALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTM 256

Query: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
                G  Y    D L    RQEG    YKG  A L+++ P
Sbjct: 257 GQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 69/176 (39%), Gaps = 21/176 (11%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           SP++ VK  +Q  +        G +   +  ++K+ GV+GL++G     LR    SAVQ 
Sbjct: 35  SPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQY 92

Query: 196 AVYSHAKEAL-----SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYR 250
           AVY   K  +     S H         +  AL   A  +   P D+  TR+      L +
Sbjct: 93  AVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAK 152

Query: 251 -------------GPLDCLCKTVRQE-GFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
                        G ++ L +  R+E G    Y+G     L + P   L   L E+
Sbjct: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYER 208

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 25/189 (13%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY--AYQI 84
           T TNPI  VKTRLQL  +   G SR Y      +  + R EG+ GL +GL+ +Y  + + 
Sbjct: 179 TATNPIWLVKTRLQLD-KAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVES 237

Query: 85  LLNGSRLGLYDPLR--------AALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS 136
           +L   +  LY+ ++           G     ++ TY                       +
Sbjct: 238 IL---QWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILT 294

Query: 137 -PLQLVKTRMQALAPRRVPPLPGRMG-----RRLVALFKDRGVRGLYQGVDAALLRTGVG 190
            P ++V+TR+     R+ P   G++      +    + K+ G   +Y G+   L+RT   
Sbjct: 295 YPHEVVRTRL-----RQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPN 349

Query: 191 SAVQLAVYS 199
           S +    + 
Sbjct: 350 SIIMFGTWE 358

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 79/189 (41%), Gaps = 33/189 (17%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRR------LVALFKDRGVRGLYQGVDAALLRTGV 189
           +P+ LVKTR+Q           GR  R       L  + ++ G+ GLY+G+ A+ L + V
Sbjct: 182 NPIWLVKTRLQL-----DKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGS-V 235

Query: 190 GSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAV-----------------CIAMN 232
            S +Q  +Y   K  + +   +     +  +  + + V                  I   
Sbjct: 236 ESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTY 295

Query: 233 PFDVAMTRMYH---HRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLT 288
           P +V  TR+       G L Y G        +++EGF+++Y G    L+R  P++I+   
Sbjct: 296 PHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFG 355

Query: 289 LMEQALRVV 297
             E  ++++
Sbjct: 356 TWELVIKLL 364

>Scas_721.27
          Length = 374

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 74/187 (39%), Gaps = 23/187 (12%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T TNPI  +KTR+QL     AG +R Y      +  + ++EG+ GL +GL+ +Y      
Sbjct: 190 TATNPIWMIKTRVQLDK---AGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYL----- 241

Query: 87  NGSRLG-----LYDPLRAALG---------GCVLSDRRTYXXXXXXXXXXXXXXXXXXXX 132
            GS  G     LY+ ++  +             L+  RT                     
Sbjct: 242 -GSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIAS 300

Query: 133 XXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
               P ++V+TR++ +      P    + +    + K+ G+  +Y G+   L+RT   S 
Sbjct: 301 IVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSI 360

Query: 193 VQLAVYS 199
           +    + 
Sbjct: 361 IMFGTWE 367

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 79/186 (42%), Gaps = 29/186 (15%)

Query: 136 SPLQLVKTRMQ---ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
           +P+ ++KTR+Q   A   R+           L  + K  G+ GLY+G+ A+ L + +   
Sbjct: 193 NPIWMIKTRVQLDKAGTTRKYK----NSWDCLKTVLKSEGIYGLYRGLSASYLGS-IEGI 247

Query: 193 VQLAVYSHAKE--------------ALSRHVPDGMALYTLASALSSVAVCIA---MNPFD 235
           +Q  +Y   K                L++   + +  +   S  + VA  IA     P +
Sbjct: 248 LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHE 307

Query: 236 VAMTRM----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           V  TR+      +    Y G +      +++EG +++Y G    L+R  P++I+     E
Sbjct: 308 VVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWE 367

Query: 292 QALRVV 297
             +R++
Sbjct: 368 LVIRLL 373

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 112/310 (36%), Gaps = 43/310 (13%)

Query: 6   DTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYR 65
           D  VS   S            T   P++TVK +LQ+           ++  A  +  I +
Sbjct: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP---------HNKNANVLINILK 60

Query: 66  TEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAAL-GGCVLSDRRTYXXXXXXXXXXXX 124
            EG+RG  +G        I+  G++ G Y  + + L GG  L+                 
Sbjct: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLN------ISPQLYSCLVG 114

Query: 125 XXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAAL 184
                       P  +++TR  A +  ++  L       ++A++   G+ G + G  +++
Sbjct: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDE----IMAIWSHEGLMGFFSGCGSSM 170

Query: 185 LRTGVGSAVQLAVYSHAK------EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAM 238
           +  G+ +A+   VY   K        LS        L  LA  +S     +A  P D   
Sbjct: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVR 230

Query: 239 TRMY---------HHR---GGLY-----RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
            R+          H R     +Y     R  L      V+QEG  +LY+G    L++  P
Sbjct: 231 RRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVP 290

Query: 282 HTILCLTLME 291
            T + L   E
Sbjct: 291 STAISLWSYE 300

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 69/170 (40%), Gaps = 27/170 (15%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F++ G RG+Y+G+ +A++ +  G+++   
Sbjct: 25  PIDTLKTRLQAKG----------------GFFRNGGYRGVYRGLGSAVVASAPGASLFFI 68

Query: 197 VYSHAKEAL---------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247
            Y   K            S +V D +  +  +S++  +A C+   P +V   R   H   
Sbjct: 69  TYDTCKAETRGFFRGLLPSSNVAD-VVTHMFSSSMGEIAACMVRVPAEVVKQRSQTHASH 127

Query: 248 LYRGPLDCLCKTVRQEGF-SALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
                L  + K    EG    LY+G    ++R  P T +   L E   +V
Sbjct: 128 SSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKV 177

>Kwal_23.5757
          Length = 307

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 71/175 (40%), Gaps = 15/175 (8%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +PL LVK R Q  A      L G   R++V   +  G   ++ GV A  +   +  A + 
Sbjct: 38  TPLDLVKCRRQVDASLYKSNLDGW--RQIV---RSEGATKVFTGVGATAIGYSLQGAFKY 92

Query: 196 AVYSHAKEALSRHVPDGMA------LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249
             Y   K   S+ V    A      ++  ASA +     I + P++    R        +
Sbjct: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152

Query: 250 -RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
            R   D   K V  EGF++LYKG      R  P+T+   T  E   R+V ++  R
Sbjct: 153 ARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE---RIVEMIYAR 204

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 96/262 (36%), Gaps = 16/262 (6%)

Query: 27  TFTNPIETVKTRLQLQGELV--AGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQI 84
           T  +PIE VK  +Q Q E++    +   Y G         R EG+    +G         
Sbjct: 27  TAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIRYF 86

Query: 85  LLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
                     D ++A  G         Y                       S L   +TR
Sbjct: 87  PTQALNFAFKDQIKAMFG---FKKEEGYAKWFAGNLASGGIAGGLSLMFVYS-LDYARTR 142

Query: 145 MQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           + A A +       R    LV ++K      GV GLY+G   +++   V   +   +Y  
Sbjct: 143 LAADA-KSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDS 201

Query: 201 AKEALSRHVPDG--MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL--YRGPLDCL 256
            K  L     +G  +A + L   +++ A   A  P D    RM    G    Y+G +DCL
Sbjct: 202 CKPLLLTGSLEGSFIASFLLGWVVTTGA-STASYPLDTVRRRMMMTSGQAVKYKGAMDCL 260

Query: 257 CKTVRQEGFSALYKGHLAQLLR 278
            K V  EG S+L+KG  A +LR
Sbjct: 261 QKIVAAEGVSSLFKGCGANILR 282

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 243 HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            HR   Y+G +DC  +T RQEG  + ++G+ A ++R  P   L     +Q
Sbjct: 52  DHR---YKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQ 98

>Kwal_55.21338
          Length = 323

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 96/256 (37%), Gaps = 30/256 (11%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T T P+  V T+LQ Q      +S      A  +  IYR +G  G   GL  A     L 
Sbjct: 38  TLTYPLIVVTTKLQTQDAKGEKLSL-----ADTIKDIYRKDGAMGFFAGLESALFGTTLS 92

Query: 87  NGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
           N      Y+    A   CVL  R T                        +PL +  TRM 
Sbjct: 93  NFVYYYCYE----ASSRCVLRARHT-QRLTTAESMLVGSIAGSLNATAANPLWVANTRMT 147

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL- 205
                R     G +   +  + KD G+ GL++G++ AL+   +   +Q  VY   K  + 
Sbjct: 148 VQKSDR-----GTLST-IFDIVKDEGISGLFKGLNPALILV-INPIIQYTVYEQLKNWIL 200

Query: 206 ----SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY---HHRGGLYRGP---LDC 255
               +R +    A   +  A+  +A   +  P+     RM+    H+      P   L  
Sbjct: 201 SSRQTRTLSPSWAF--ILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSL 258

Query: 256 LCKTVRQEGFSALYKG 271
           + + ++++G   LY+G
Sbjct: 259 MAEIIKKDGILGLYRG 274

>Kwal_55.21335
          Length = 317

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 99/266 (37%), Gaps = 23/266 (8%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGS 89
           P++T+K RLQ Q       + ++      +   Y+ EG  +G  QG+A       L N  
Sbjct: 65  PLDTIKVRLQTQP------AHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLVGAALENAV 118

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALA 149
               ++  +  L       ++                         +P++L+K  +Q   
Sbjct: 119 LFVTFNRAQNFL-------QQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSN 171

Query: 150 PRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV 209
                    ++   +  + + +G+ GL+QG  +  +R   G AV    Y   K  L+R  
Sbjct: 172 LEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRR 231

Query: 210 PD--GMALYTLASALSS-VAVCIAMNPFD-VAMTRMYHHRGGLYRGPLDCLCKTVRQEGF 265
            D        LAS  S+ VA   ++ P D +  T    H      G +D   + + + G 
Sbjct: 232 NDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQH-----LGIVDATKRILARSGP 286

Query: 266 SALYKGHLAQLLRIAPHTILCLTLME 291
           + LY+G    L+R AP   +     E
Sbjct: 287 AGLYRGLGITLIRAAPANAIVFYTYE 312

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 68/200 (34%), Gaps = 21/200 (10%)

Query: 31  PIETVKTRLQLQGELVAGVSRL---YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           P E +KTRLQLQG       +    YS    A+  + + EG R L  G     A  +  +
Sbjct: 168 PSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFS 227

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
             +   Y+  R         D R                         +P+ +VKTR+Q 
Sbjct: 228 ALQFAFYEKFRQLAFKIEQKDGRD-GELSIPNEILTGACAGGLAGIITTPMDVVKTRVQT 286

Query: 148 LAPR-----------------RVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVG 190
             P                  R   L   +   L  +++  GV G + GV    + T V 
Sbjct: 287 QQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQ 346

Query: 191 SAVQLAVYSHAKEALSRHVP 210
           S++ L +Y      LS   P
Sbjct: 347 SSIMLLLYQMTLRGLSNAFP 366

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 76/182 (41%), Gaps = 24/182 (13%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVR-GLYQGVDAALLRTGVGSA 192
           L  VKTR Q  AP        +  R +++ ++    + GVR GLY G  AA+L +   +A
Sbjct: 74  LDTVKTRQQG-APNV------KKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAA 126

Query: 193 VQLAVYSHAKEAL--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRM--------- 241
           +    Y + K  +     + D +  +  A  L          P +V  TR+         
Sbjct: 127 IFFGTYEYTKRTMIEDWQINDTIT-HLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNP 185

Query: 242 YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVE 301
           +   G  Y    + +   +++EGF +L+ G+ A L R  P + L     E+  ++   +E
Sbjct: 186 FFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIE 245

Query: 302 NR 303
            +
Sbjct: 246 QK 247

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 72/184 (39%), Gaps = 23/184 (12%)

Query: 137 PLQLVKTRMQALAP----------RRVPPLPGRMGRRLVALFK-DRGVRGLYQGVDAALL 185
           PL L+KTR+               + +   PG + + L   ++ + G+RGLY+GV    L
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPG-IWQLLSETYRLEGGLRGLYRGVWPTSL 200

Query: 186 RTGVGSAVQLAVYSHAKE---ALSRHVPDGMA-LYTLA-SALSSVAVCIAMNPFDVAMTR 240
                 A+  AVY   +E     S   P   + LY L   A+S         PFD+   R
Sbjct: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260

Query: 241 MY------HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
                   +  G  Y    D L    R EG S  YKG  A L ++ P T +   + E   
Sbjct: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320

Query: 295 RVVR 298
             VR
Sbjct: 321 DSVR 324

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 59/147 (40%), Gaps = 22/147 (14%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV--PDGMALYTLASALSS 224
           ++ + G +GL++G     +R    SAVQ  VY   K+ L  HV   +G    T    L S
Sbjct: 70  VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF-HVNGNNGQEQLTNTQRLFS 128

Query: 225 VAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-GF 265
            A+C     +A  P D+  TR+      L               G    L +T R E G 
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 266 SALYKGHLAQLLRIAPHTILCLTLMEQ 292
             LY+G     L + P+  L   + EQ
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQ 215

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 72/185 (38%), Gaps = 23/185 (12%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYS-------GPAQAVSLIYRTE-GLRGLQQGLACAY 80
           T P++ +KTRL +Q   ++ ++R  +       G  Q +S  YR E GLRGL +G+    
Sbjct: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTS 199

Query: 81  AYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQL 140
              +        +Y+ LR    G   SD +                          P  L
Sbjct: 200 LGVVPYVALNFAVYEQLREF--GVNSSDAQP-SWKSNLYKLTIGAISGGVAQTITYPFDL 256

Query: 141 VKTRMQALAPRRVPPLPGRMGRR-------LVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           ++ R Q LA          +G R       LV + +  GV G Y+G+ A L +    +AV
Sbjct: 257 LRRRFQVLAMG-----GNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311

Query: 194 QLAVY 198
              VY
Sbjct: 312 SWLVY 316

>Kwal_23.3042
          Length = 542

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 81/186 (43%), Gaps = 31/186 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLV-----ALFKDRGVRGLYQGVDAALLRTGVGS 191
           P+  +K R+Q       P      GR+L+      ++K+ G+R  Y+G+   ++     +
Sbjct: 364 PIDTLKYRVQC-----APLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYA 418

Query: 192 AVQLAVYSH------AKEALSRHVPDGMALYT-----LASALSSVAVCIAMNPFDVAMTR 240
           A+ L  +S       A++A    +P+     +     L  A S      A+ P ++  TR
Sbjct: 419 AMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTR 478

Query: 241 M-------YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
           +       + HR   Y G  D L KTV++EG+  L+KG +  L ++ P   +     E  
Sbjct: 479 LQAQGTFAHPHR---YNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENL 535

Query: 294 LRVVRL 299
            R ++L
Sbjct: 536 KRGMKL 541

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 100/289 (34%), Gaps = 52/289 (17%)

Query: 30  NPIETVKTRLQL-QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           +P +T+K RLQ  Q E        + GP   V   +R +G+RG   G        IL++ 
Sbjct: 42  HPFDTIKVRLQTSQNE------TRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95

Query: 89  SRLGLYDPLRA-------------ALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXX 135
             LG     R               L GC++S                            
Sbjct: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISG----------------VLAGWSVSFIA 139

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALL-RTGVGSAVQ 194
            P++L K ++Q    +      G +   +  ++  +G+RGLY+G+ + L+ RT       
Sbjct: 140 PPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKGLISTLIFRT------H 192

Query: 195 LAVYSHAKEALSRHVPDGM-----ALYTLASALS-SVAVCIAMNPFDVA--MTRMYHHRG 246
              +  + E L+R   +       A+   A   S S        P DV   +        
Sbjct: 193 FVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYD 252

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
           G ++     +    + +G +  +KG +   LR  P     L   E  LR
Sbjct: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLR 301

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 71/172 (41%), Gaps = 16/172 (9%)

Query: 137 PLQLVKTRMQAL--APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           P   +K R+Q      R   PL       +   F+++G+RG Y G    L+   +  +V 
Sbjct: 43  PFDTIKVRLQTSQNETRFKGPLDC-----VYKTFRNQGIRGFYLGFTPPLVGWILMDSVM 97

Query: 195 LAVYSHAKEALSRHV-PDGMAL----YTLASALSSVAVCIAMNPFDVAMTRM---YHHRG 246
           L    + +  + ++V P+   L      ++  L+  +V     P ++A  ++   Y    
Sbjct: 98  LGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTT 157

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
             Y+GPLD + K    +G   LYKG ++ L+    H +      E   R  R
Sbjct: 158 TRYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRTHFVYWWGSYELLTRWFR 208

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQL 276
           +A   S VA     +PFD    R+   +    ++GPLDC+ KT R +G    Y G    L
Sbjct: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87

Query: 277 L 277
           +
Sbjct: 88  V 88

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 62/158 (39%), Gaps = 11/158 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++K +      R+  P   R GR  + + +D G+ GLY+G      R   GS     
Sbjct: 137 PLDVLKIK------RQTNPESFR-GRGFLRILRDEGM-GLYRGWGWTAARNAPGSFALFG 188

Query: 197 VYSHAKE---ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
             + AKE    L  +         ++S   + A  I   P DV  TR+            
Sbjct: 189 GNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGF 248

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
             +  T++ EG +A +KG   +LL   P  +    + +
Sbjct: 249 TIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQ 286

>Scas_558.2
          Length = 289

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 71/181 (39%), Gaps = 30/181 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F++ G  G+Y+G+ +A++ +   +++   
Sbjct: 26  PIDTLKTRLQAKG----------------GFFQNGGYHGIYRGLGSAVVASAPSASLFFV 69

Query: 197 VYSHAKEALSRHV-----------PDGM--ALYTLASALSSVAVCIAMNPFDVAMTRMYH 243
            Y   K  +  HV           P  +   ++ +AS++  +A C+   P +V   R   
Sbjct: 70  TYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAACLVRVPAEVIKQRTQV 129

Query: 244 HRGGLYRGPLDCLCKTVRQEG-FSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVEN 302
           H           + K   QEG    LY+G    ++R  P T +   L E   +   L +N
Sbjct: 130 HSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDN 189

Query: 303 R 303
            
Sbjct: 190 E 190

>Kwal_23.2913
          Length = 320

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP-DGMALYTL--ASALS 223
           L ++ GVR L+QG  A L R G GSA+  A Y  +K  LSR+   D +++ ++  A  ++
Sbjct: 184 LIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVA 243

Query: 224 SVAVCIAMNPFDVAMTRM 241
            +++ I + P D   T++
Sbjct: 244 GMSMWIGVFPIDTIKTKL 261

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 67/166 (40%), Gaps = 27/166 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F + G +G+Y+G+ +A++ +  G+++   
Sbjct: 24  PIDTIKTRLQAKG----------------GFFANGGYKGIYRGLGSAVVASAPGASLFFI 67

Query: 197 VYSHAKEA----LSRHVPDG------MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246
            Y + K      +S+    G         + L+S++  +  C+   P +V   R   H  
Sbjct: 68  SYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHST 127

Query: 247 GLYRGPLDCLCKTVRQEGF-SALYKGHLAQLLRIAPHTILCLTLME 291
                 L  + +   +EG    LY+G    ++R  P T +   L E
Sbjct: 128 NSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYE 173

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 31 PIETVKTRLQLQGELVA--GVSRLYSGPAQAV 60
          PI+T+KTRLQ +G   A  G   +Y G   AV
Sbjct: 24 PIDTIKTRLQAKGGFFANGGYKGIYRGLGSAV 55

>Scas_667.4
          Length = 308

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 94/261 (36%), Gaps = 14/261 (5%)

Query: 27  TFTNPIETVKTRLQLQGELV--AGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQI 84
           T  +PIE VK  +Q Q E++    +   Y G  +      +TEG+    +G         
Sbjct: 29  TAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAFWRGNTANVIRYF 88

Query: 85  LLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
                     D ++A  G         Y                       S L   +TR
Sbjct: 89  PTQALNFAFKDKIKAMFG---FKKEEGYGKWFAGNLASGGAAGGLSLLFVYS-LDYARTR 144

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKD----RGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           + A A +       R  + L+ ++K      G+ GLY+G   +++   V   +   +Y  
Sbjct: 145 LAADA-KSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDS 203

Query: 201 AKEALSRHVPDGMALYT-LASALSSVAVCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLC 257
            K A+     +G  L + L   + +     A  P D    RM    G    Y G  DC  
Sbjct: 204 LKPAVLTGSLEGSFLASFLLGWIVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFR 263

Query: 258 KTVRQEGFSALYKGHLAQLLR 278
           K V  EG S+L+KG  A +LR
Sbjct: 264 KVVAAEGVSSLFKGCGANILR 284

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y+G ++C  +T + EG  A ++G+ A ++R  P   L     ++
Sbjct: 57  YKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDK 100

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 10/127 (7%)

Query: 58  QAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYX 113
           Q    IY+ EG+RG+ +G+      Q+   GSR GL     D +R   G     D+ T  
Sbjct: 150 QVFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLT-- 207

Query: 114 XXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGV 173
                                  P+++++  MQ+       P    +G+    +++  G+
Sbjct: 208 ----ALEKIMASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGL 263

Query: 174 RGLYQGV 180
           +GLY+GV
Sbjct: 264 KGLYRGV 270

>Scas_662.12
          Length = 308

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 137 PLQLVKTRMQAL--APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           P QL+K+ +Q        +P         +  +++D G++GLY+G+ A LLR    + + 
Sbjct: 238 PFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCIT 297

Query: 195 LAVYSHAKEAL 205
             +Y + K  L
Sbjct: 298 FCIYENFKSKL 308

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 69/171 (40%), Gaps = 17/171 (9%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPG-RMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           +PL ++KTR+ + +          R G +  +L    G + ++ G+  +LL    G A+ 
Sbjct: 136 NPLWVIKTRIMSTSRHHKDSYKSIRHGFK--SLLTKEGPKAIWMGLLPSLLGVSQG-AIY 192

Query: 195 LAVYS----HAKEALSRHVPDGMAL---YTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247
             +Y     H    L++   D         L S+LS +   +++ PF +  + +   R  
Sbjct: 193 FMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSV 252

Query: 248 LYRGP------LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
               P      +  + K  R  G   LYKG  A LLR  P T +   + E 
Sbjct: 253 TNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYEN 303

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 67/162 (41%), Gaps = 19/162 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPG---RMGRRLVALFKDRGVRG--------LYQGVDAALL 185
           PL L+K R+Q LA             +   L+   K  G +G         Y+G+   LL
Sbjct: 27  PLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIYNLIKESYRGLPINLL 86

Query: 186 RTGVGSAVQLAVYSHAKEALSRHV---PDGMALYTLASALSSVAVCIAMNPFDVAMTRMY 242
              V  ++   +Y+  K+ + ++     +   ++  +  +S ++  +  NP  V  TR+ 
Sbjct: 87  GNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLTSGLISGISTTLLTNPLWVIKTRIM 146

Query: 243 ----HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
               HH+   Y+         + +EG  A++ G L  LL ++
Sbjct: 147 STSRHHKDS-YKSIRHGFKSLLTKEGPKAIWMGLLPSLLGVS 187

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 20/172 (11%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQG-VDAALLRTGVGSAVQ 194
           +P+  +K R+Q      + P   ++     ++ K+ G+R  ++G +  +LL    GSA Q
Sbjct: 35  APMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSA-Q 93

Query: 195 LAVYSHAKEALSRHVPDGMA--LYTL-ASALSSVAVCIAMNPFDVAMTRMY----HHRGG 247
            + YS     L+   P G+   L++L   A + +   I   PFDV  TR+      H   
Sbjct: 94  FSSYSLFNRYLT---PFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRL 299
           + R   D      + EG    +KG +A +  I     L  ++M      +R+
Sbjct: 151 ITREVRDIW----KLEGLPGFFKGSIASMTTIT----LTASIMFGTYETIRI 194

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 258 KTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRL 299
           + ++QEG S+LY+G L  L +  P T +     E A+  +R+
Sbjct: 272 QILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIHYLRM 313

>Scas_645.9
          Length = 391

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 76/187 (40%), Gaps = 24/187 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDR-----GVRGLYQGVDAALLRTGVG 190
           +PL+L+KT++Q++           M + L+   +           L++G++  L R    
Sbjct: 204 APLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPF 263

Query: 191 SAVQLAVYSHAKEALSRHVPDGMALYT------LASALSSVAVCIAMNPFDVAMTR---- 240
           SA+    Y   K  L        +  T      +  ++S     +  +PFDV  TR    
Sbjct: 264 SAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQIS 323

Query: 241 -MYHHRGGLYRGP--------LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
            M ++   + + P           L    + EG+ ALY G + ++++IAP   + ++  E
Sbjct: 324 FMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYE 383

Query: 292 QALRVVR 298
            + R+  
Sbjct: 384 LSKRLFN 390

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 73/178 (41%), Gaps = 16/178 (8%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVR-GLYQGVDAALLRTGVGSAVQLA 196
           L  VKTR Q  AP         M +    +F + G R GLY G  AA+L +   +A+  +
Sbjct: 74  LDTVKTRQQG-APNVHKY--KHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFS 130

Query: 197 VYSHAKEAL--SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRM---------YHHR 245
            Y   K  +    H+ D  +  T A  L          P +V  TR+         + + 
Sbjct: 131 TYEFTKRTMINDYHLNDTFSHLT-AGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNS 189

Query: 246 GGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
           G  Y+   + +    R EG +AL+ G+ A L R  P + L     E+  +   L+E +
Sbjct: 190 GYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGK 247

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 51/129 (39%), Gaps = 10/129 (7%)

Query: 31  PIETVKTRLQLQG-----ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQIL 85
           P E +KTRLQLQG        +G +  Y     A++ IYRTEG+  L  G     A  + 
Sbjct: 168 PSEVLKTRLQLQGCYNNPHFNSGYN--YKSLRNAIATIYRTEGVAALFFGYKATLARDLP 225

Query: 86  LNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXX-XXXXXXXXXSPLQLVKTR 144
            +  +   Y+  R      +L  +  Y                        +PL +VKTR
Sbjct: 226 FSALQFAFYEKFRQ--WAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTR 283

Query: 145 MQALAPRRV 153
           +Q   P ++
Sbjct: 284 VQTQLPSQI 292

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 27/165 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F + G RG+Y+G+ +A++ +  G+++   
Sbjct: 25  PIDTLKTRLQAKG----------------GFFHNGGYRGIYRGLGSAVVASAPGASLFFV 68

Query: 197 VYSHAKEAL---------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247
            Y   K+ L         S  + + +  + L+S+L  ++ C+   P +V   R   H   
Sbjct: 69  TYDSMKQQLRPVMGRWTASEQLAEVLT-HMLSSSLGEMSACLVRVPAEVIKQRTQTHHTN 127

Query: 248 LYRGPLDCLCKTVRQEG-FSALYKGHLAQLLRIAPHTILCLTLME 291
                L  + +    EG    LY+G    ++R  P T +   L E
Sbjct: 128 SSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYE 172

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL ++KTRM  L  RRVP L   + R    LF++ G R  ++G+    +    G A+ L 
Sbjct: 209 PLDVLKTRMM-LHERRVPML--HLAR---TLFREEGARVFFRGIGPRTMWISAGGAIFLG 262

Query: 197 VYS 199
           VY 
Sbjct: 263 VYE 265

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 173 VRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP-DGMALY--TLASALSSVAVCI 229
           VRGLY+G    ++R    + +Q  +Y + K+  + +   + ++ +   +  +L+      
Sbjct: 146 VRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAA 205

Query: 230 AMNPFDVAMTRMYHHRGGLYRGPLDCLCKTV-RQEGFSALYKG 271
           A  P DV  TRM  H     R P+  L +T+ R+EG    ++G
Sbjct: 206 ATTPLDVLKTRMMLHE---RRVPMLHLARTLFREEGARVFFRG 245

>Kwal_23.4731
          Length = 314

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 67/179 (37%), Gaps = 11/179 (6%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           TNPI  +KTR+       +  S  Y      +  +Y  EG  G  +GL  +  + +    
Sbjct: 145 TNPIWVIKTRIM---STSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPS-LFGVAQGA 200

Query: 89  SRLGLYDPLRAALGG--CVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ 146
               +YD LR        +  D +                          P QL+K+ +Q
Sbjct: 201 IYFTIYDSLRHQYFARRGITEDEK----MGNLENIAITSVSKMLSVTAVYPFQLLKSNLQ 256

Query: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL 205
           + A         R    + ++ +  G++GLY+G+ A LLR    + +   +Y + +  L
Sbjct: 257 SFAAVEKRD-SYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYENLRHWL 314

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 21/169 (12%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK-DRGV-RGLYQGVDAALLRTGVGSAVQ 194
           PL LVK R+Q L           + + ++   K D  V R  Y+G+   L+   +   + 
Sbjct: 33  PLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRGLGVNLIGNSIAWGLY 92

Query: 195 LAVYSHAKEALSRH------VPD----------GMALYTLASALSSVAVCIAMNPFDVAM 238
             +Y   K+ + R+       P           G +LY  ++ALS +   I  NP  V  
Sbjct: 93  FGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALSGLGTAILTNPIWVIK 152

Query: 239 TRMY---HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTI 284
           TR+          Y+   D + K    EGFS  ++G +  L  +A   I
Sbjct: 153 TRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLFGVAQGAI 201

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 17/169 (10%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRM-GRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           +P+ ++KTR+ + + +          G R V  +   G  G ++G+  +L     G A+ 
Sbjct: 146 NPIWVIKTRIMSTSSQASERYKTTWDGIRKV--YAHEGFSGFWRGLVPSLFGVAQG-AIY 202

Query: 195 LAVYS------HAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYH----H 244
             +Y        A+  ++     G       +++S +    A+ PF +  + +       
Sbjct: 203 FTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQSFAAVE 262

Query: 245 RGGLYRGPLDCLCKTVRQ-EGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           +   YR     L K++ Q EG   LYKG  A LLR  P T +   + E 
Sbjct: 263 KRDSYR--FWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYEN 309

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 10/165 (6%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +P+ ++KTR+ +   +        M   +  L +  G +GL++G+  AL     G A+  
Sbjct: 144 NPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVSQG-ALYF 201

Query: 196 AVYSHAKE-ALSRHVPDGMALYTLA------SALSSVAVCIAMNPFDVAMTRMYHHRGGL 248
           AVY   K+  L R   +G+ ++         ++L  +     + PF +  + +   R   
Sbjct: 202 AVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANE 261

Query: 249 YRGPLDCLCK-TVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
            +  L  L K  +  +GF  LYKG  A L+R  P T +   + E 
Sbjct: 262 QKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYEN 306

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 73/181 (40%), Gaps = 16/181 (8%)

Query: 29  TNPIETVKTRLQLQGELVAGV-SRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           TNPI  +KTR+    +   G  + +Y+G  Q    + RT+G +GL +GL  A     L  
Sbjct: 143 TNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQ----LLRTDGFQGLWKGLVPA-----LFG 193

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS---PLQLVKTR 144
            S+  LY  +   L    L  +R                         +   P QL+K+ 
Sbjct: 194 VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSN 253

Query: 145 MQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
           +Q+    R      R+   +  +  + G  GLY+G+ A L+R    + +   VY + K  
Sbjct: 254 LQSF---RANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLKHR 310

Query: 205 L 205
           L
Sbjct: 311 L 311

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 23/167 (13%)

Query: 137 PLQLVKTRMQ--ALAPRRVPPLPGRMGRRLVALFKDRG---VRGLYQGVDAALLRTGVGS 191
           PL L+K R+Q  A + ++    P  + + ++    + G      LY+G+   L    +  
Sbjct: 29  PLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINLFGNAIAW 88

Query: 192 AVQLAVYSHAKEALSRHVPD---------------GMALYTLASALSSVAVCIAMNPFDV 236
            V   +Y   KE + + V                    +Y  A A S +   I  NP  V
Sbjct: 89  GVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNPIWV 148

Query: 237 AMTR-MYHHRG--GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
             TR M   +G  G Y    + + + +R +GF  L+KG +  L  ++
Sbjct: 149 IKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVS 195

>Scas_669.6
          Length = 373

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 71/191 (37%), Gaps = 24/191 (12%)

Query: 31  PIETVKTRLQLQGELVAGVSRL---YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
           P E +KTRLQLQG +     +    Y     A+ +I  TEG++ L  G     A  +  +
Sbjct: 166 PSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFS 225

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ- 146
             + G Y+  R         D  T                        +P+ ++KTR+Q 
Sbjct: 226 ALQFGFYEKFRQTAFKLEKKD-ITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQT 284

Query: 147 -----------------ALAPRRVPP--LPGRMGRRLVALFKDRGVRGLYQGVDAALLRT 187
                            A   ++  P  L   + R L  +++  GV G + GV    + T
Sbjct: 285 QQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWT 344

Query: 188 GVGSAVQLAVY 198
            V S++ L +Y
Sbjct: 345 SVQSSIMLLLY 355

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 69/177 (38%), Gaps = 14/177 (7%)

Query: 138 LQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGV-RGLYQGVDAALLRTGVGSAVQLA 196
           L  VKTR Q  AP  + P    M      +F + G+ RGLY G  AA+L +   +A+   
Sbjct: 72  LDTVKTRQQG-AP--MTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 197 VYSHAKEALSRHVPDGMALYTLASA-LSSVAVCIAMNPFDVAMTRM---------YHHRG 246
            Y   K  +   +     +  L++  L          P +V  TR+         +   G
Sbjct: 129 TYEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSG 188

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
             YR     +   V  EG  AL+ G+ A L R  P + L     E+  +    +E +
Sbjct: 189 YNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKK 245

>Scas_715.45
          Length = 305

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 65/170 (38%), Gaps = 13/170 (7%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +PL L+K R+Q       P L       ++ + K  G+  L+ GV A  +   +  A + 
Sbjct: 35  TPLDLIKCRLQV-----DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89

Query: 196 AVYSHAKEALSRHVPDGMA--------LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247
             Y   K   S H+    A        +Y L+SA +     I + PF+    +       
Sbjct: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPP 149

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
                ++   K   +EG +  YKG      R  P+T+   T  E+ +  +
Sbjct: 150 WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 68/171 (39%), Gaps = 14/171 (8%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +PL LVK R+Q         L G        + +  G+  ++ GV A  +   +  A + 
Sbjct: 34  TPLDLVKCRLQVNPQLYRSNLDGWK-----TIVRSEGLSKVFTGVGATFIGYSLQGACKY 88

Query: 196 AVYSHAKEALSRHV-PDG-----MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249
             Y + K+  S  + P+       A+Y  ASA +     I + P++    +         
Sbjct: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFC 148

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLV 300
           +  L+   K    EG S LYKG      R  P+T+   T  E   R+V ++
Sbjct: 149 KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE---RIVEMI 196

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 92/264 (34%), Gaps = 35/264 (13%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNGS 89
           P +TVK RLQ Q       + LY      +   Y  EG+ +G  QG+A       L N  
Sbjct: 27  PFDTVKVRLQTQP------AHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAV 80

Query: 90  RLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQ--- 146
                  L  +   C                               +P++LVK ++Q   
Sbjct: 81  -------LFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILTPVELVKCKLQVSN 133

Query: 147 -----ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHA 201
                +   R     P      + ++ K++G+ GL+QG  +  +R  +G AV    Y   
Sbjct: 134 ISNSLSQTTRHTSVWP-----TIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIM 188

Query: 202 KEALSRHVPDGMALYTLASALSSVAVCIAMN----PFDVAMTRMYHHRGGLYRGPLDCLC 257
           K   +   P     +T    +S  +  +  N    P D   +        +    ++ L 
Sbjct: 189 KMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHVSI----VNALK 244

Query: 258 KTVRQEGFSALYKGHLAQLLRIAP 281
           K +R  G +  Y+G    L+R AP
Sbjct: 245 KVLRTHGITGFYRGLGITLIRAAP 268

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 82/185 (44%), Gaps = 29/185 (15%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRM-GRRLV-----ALFKDRGVRGLYQGVDAALLRTGVG 190
           P+  +K R+Q        PL  ++ G  L+      +F++ G+R  Y+GV   ++     
Sbjct: 367 PIDTLKFRVQC------APLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPY 420

Query: 191 SAVQLAVYSH------AKEALSRHVP-DGMALYTLA----SALSSVAVCIAMNPFDVAMT 239
           +A+ L  +S       AK+A + ++P D + L  L      A S       + P ++  T
Sbjct: 421 AALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRT 480

Query: 240 RM-----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           R+     Y H   +Y G  D L KT+ +EG+  L+KG +  L ++ P   +     E   
Sbjct: 481 RLQAQGTYAH-PYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLK 539

Query: 295 RVVRL 299
           + + L
Sbjct: 540 KFMNL 544

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 66/175 (37%), Gaps = 28/175 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA    +       M  ++  +    G   L++GV + +L  G   AV   
Sbjct: 43  PIDALKTRVQAAGLNKAAST--GMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFG 100

Query: 197 VYSHAK------EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYR 250
            Y   K      E +  H P   AL   +  ++++A    MNPFD    R+         
Sbjct: 101 TYEFCKARLISPEDMQTHQPMKTAL---SGTIATIAADALMNPFDTVKQRL--------- 148

Query: 251 GPLDC------LCKTVRQ-EGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298
             LD       + K + Q EGF+A Y  +   L    P       + E A +   
Sbjct: 149 -QLDTNLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFN 202

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 62/152 (40%), Gaps = 16/152 (10%)

Query: 63  IYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXXX 118
           IY+ EG+RG+ +G+      Q+   GSR GL     D +R   G     D+         
Sbjct: 162 IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDK------LNP 215

Query: 119 XXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQ 178
                             P+++++  MQ+       P    +G+    +++  G++GLY+
Sbjct: 216 FEKIGASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYR 275

Query: 179 GVDAALLRTGVG---SAVQLAVYSHAKEALSR 207
           GV     R G+G   +   +     AKE ++R
Sbjct: 276 GVTP---RIGLGIWQTVFMVGFGDMAKEFVAR 304

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           +P+ +VKTR+Q     +           L ++ ++ G+ GLY+G+ A+ L + V   +Q 
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDC-LKSILRNEGIYGLYRGLSASYLGS-VEGILQW 255

Query: 196 AVYSHAKEALSRHVPDGMALYTLAS-----------------ALSSVAVCIAMNPFDVAM 238
            +Y   K  + +   +    +  ++                  L+     I   P +V  
Sbjct: 256 LLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVR 315

Query: 239 TRMYH---HRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           TR+       G + Y G +      +++EG +++Y G    L+R  P++I+     E  +
Sbjct: 316 TRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVI 375

Query: 295 RVV 297
           +++
Sbjct: 376 KLL 378

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 7/138 (5%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMA---LYTLASALS 223
           +++  G R L++G+   L+      ++    Y   K+  S+   +G     ++ +A+A +
Sbjct: 130 VYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATA 189

Query: 224 SVAVCIAMNPFDVAMTRMYHHRGG---LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
             A   A NP  +  TR+   + G    Y+   DCL   +R EG   LY+G  A  L  +
Sbjct: 190 GWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-S 248

Query: 281 PHTILCLTLMEQALRVVR 298
              IL   L EQ   +++
Sbjct: 249 VEGILQWLLYEQLKHLIK 266

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAY 80
           NPI  VKTR+QL     AG +R Y      +  I R EG+ GL +GL+ +Y
Sbjct: 198 NPIWMVKTRVQLDK---AGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASY 245

>Kwal_33.15446
          Length = 305

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 96/292 (32%), Gaps = 56/292 (19%)

Query: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89
           +P +T+K RLQ   +     +  + GP   V    R +G+RG   G        IL++  
Sbjct: 37  HPFDTIKVRLQTSQD-----TGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSV 91

Query: 90  RLGLYDPLRA-------------ALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXS 136
            LG     R               L GC+LS                            +
Sbjct: 92  MLGCLHNYRMLLKKYVYQHEEKLPLSGCILSG----------------VLAGWSVSFIAA 135

Query: 137 PLQLVKTRMQ----ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQG-VDAALLRT---- 187
           P++L K ++Q    A   R   PL       +  ++   G+RG+Y+G V   + RT    
Sbjct: 136 PVELAKAKLQVQYDAQTTRYRGPLD-----VIKKVYAADGIRGMYKGLVSTLIFRTHFVY 190

Query: 188 GVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALS-SVAVCIAMNPFDVAMTRM--YHH 244
             GS   L  +  A   LS       A+   A   S S        P DV    +     
Sbjct: 191 WWGSYELLTRWFKANTNLSD-----TAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDK 245

Query: 245 RGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
             G  R   +      R  G    +KG +   LR  P     L   E  LRV
Sbjct: 246 YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRG-GLYRGPLDCLCKTVRQEGFSALYKGHLAQL 276
           ++   S +A     +PFD    R+   +  G ++GPLDC+ +T+RQ+G    Y G    L
Sbjct: 23  VSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPL 82

Query: 277 L 277
           +
Sbjct: 83  V 83

>Scas_714.18
          Length = 305

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 10/136 (7%)

Query: 166 ALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSV 225
           ++ K++G+ GL+QG  +  +R  +GS V  A Y   K+ L    P      T    +S  
Sbjct: 176 SIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRD--PKSEVNTTWQLLISGA 233

Query: 226 AVCIAMN----PFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
              +A N    P D   + M      L    ++ +   + ++G +  Y+G    LLR  P
Sbjct: 234 TAGLAFNGSVFPADTVKSIMQTEHLAL----METVRSILERDGVAGFYRGLGITLLRAVP 289

Query: 282 HTILCLTLMEQALRVV 297
                    E+  +++
Sbjct: 290 SNAAVFYTYEKLSKIL 305

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 102/295 (34%), Gaps = 46/295 (15%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T  +P +TVK RLQ   ++ +G    + GP   V    + +G+RGL  G        I++
Sbjct: 25  TVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMM 83

Query: 87  NGSRLGLYDPLRA-------------ALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXX 133
           + + LG     R               L GC++S                          
Sbjct: 84  DSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISG----------------VMAGWTVSF 127

Query: 134 XXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKD--------RGVRGLYQGVDAALL 185
             +P++L K ++Q     +     G +   +  +FK          GVR LY+G+ + L+
Sbjct: 128 IAAPVELAKAKLQVQYDAKTTKYTGPI-DVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186

Query: 186 -RTGVGSAVQLAVYSHAKEALSRHVP-DGMALYTLASALS-SVAVCIAMNPFDVA--MTR 240
            R+          Y    +   ++      A+   A  LS S     +  P DV   +  
Sbjct: 187 FRSNF--VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244

Query: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
                 G ++     +    RQ G    +KG L   LR  P     L   E  LR
Sbjct: 245 CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLR 299

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGG-----LYRGPLDCLCKTVRQEGFSALYKGH 272
           +A   S VA     +PFD    R+   + G      ++GPLDC+ KT++ +G   LY G 
Sbjct: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73

Query: 273 LAQLL 277
              L 
Sbjct: 74  TPPLF 78

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 94/265 (35%), Gaps = 22/265 (8%)

Query: 27  TFTNPIETVKTRLQLQGELV--AGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQI 84
           T  +PIE VK  +Q Q E++    + + YSG         + EGL    +G         
Sbjct: 28  TAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYF 87

Query: 85  LLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTR 144
                     D ++   G         Y                       S L   +TR
Sbjct: 88  PTQALNFAFKDKIKLMFG---FKKEEGYGKWFAGNLASGGAAGALSLLFVYS-LDFARTR 143

Query: 145 MQALAP-------RRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAV 197
           + A A        R+   L     + L    K  G+ GLY+G   +++   V   +   +
Sbjct: 144 LAADAKSSKKGGARQFNGLTDVYKKTL----KSDGIAGLYRGFMPSVVGIVVYRGLYFGM 199

Query: 198 YSHAKEALSRHVPDG--MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL--YRGPL 253
           +   K  +     DG  +A + L   +++ A   +  P D    RM    G    Y G +
Sbjct: 200 FDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSY-PLDTVRRRMMMTSGQAVKYNGAI 258

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLR 278
           DCL K V  EG  +L+KG  A +LR
Sbjct: 259 DCLKKIVASEGVGSLFKGCGANILR 283

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y G +DC  +T +QEG  + ++G+ A ++R  P   L     ++
Sbjct: 56  YSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDK 99

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 50/126 (39%), Gaps = 10/126 (7%)

Query: 59  AVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXX 114
           A   IY  EG+RG+ +G+      Q+   GSR G      + LR   G     D+ T   
Sbjct: 152 AFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLT--- 208

Query: 115 XXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVR 174
                                 P+++++  MQ+       P    +G+    +++  GV+
Sbjct: 209 ---ALEKIFASAIGGGLSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVK 265

Query: 175 GLYQGV 180
           GLY+GV
Sbjct: 266 GLYRGV 271

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 67/149 (44%), Gaps = 17/149 (11%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSH------AKEALSRHVP-DGMALYTLA 219
           +++D G++  Y+GV   ++     +A+ L  +S       A++A    VP D + +    
Sbjct: 365 MYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFI 424

Query: 220 ----SALSSVAVCIAMNPFDVAMTRM-----YHHRGGLYRGPLDCLCKTVRQEGFSALYK 270
                A S       + P ++  TR+     Y H    Y G  D L KTV++EG+  L+K
Sbjct: 425 VLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAH-PHTYTGFRDVLWKTVQREGYQGLFK 483

Query: 271 GHLAQLLRIAPHTILCLTLMEQALRVVRL 299
           G +  L ++ P   +     E   R+++L
Sbjct: 484 GLVPNLAKVCPAVSISYLCYENFKRLMKL 512

>Scas_696.9
          Length = 312

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 10/122 (8%)

Query: 63  IYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXXXXXX 118
           IY  EGLRG+ +G+      Q+   GSR G      D +R A G     DR         
Sbjct: 160 IYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDR------LNA 213

Query: 119 XXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQ 178
                             P+++++  MQ+       P    + +    + K  GV+GLY+
Sbjct: 214 WEKIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYR 273

Query: 179 GV 180
           GV
Sbjct: 274 GV 275

>Scas_328.1
          Length = 227

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 52/118 (44%), Gaps = 10/118 (8%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVA 226
           LF D GV GLY+G   +++   V   +   +Y   K  L   +        L S L   A
Sbjct: 90  LFTD-GVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVL---LTGSFENAFLPSFLLGWA 145

Query: 227 VCIAMN----PFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
           V I+ +    P D    RM    G    Y+G +DC  + V QEG  +L+KG  A + R
Sbjct: 146 VTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 78/192 (40%), Gaps = 35/192 (18%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKD----RGV-RGLYQGVDAALLRTGVG 190
           +PL+L+KT++Q++    +      M R L    K     RGV + +++G++  L R    
Sbjct: 185 APLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPF 244

Query: 191 SAVQLAVYSHAKEALSRHVPDGMALYT----------LASALSSVAVCIAMNPFDVAMTR 240
           SA+  A Y   K  ++   P      +          L   +S     I  +PFDV  TR
Sbjct: 245 SAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTR 304

Query: 241 M----------------YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTI 284
                            Y     ++ G L+ + KT   EG  ALY G   ++ +IAP   
Sbjct: 305 QQISLVTDKKLANSNLKYGSSNTMF-GFLNYIRKT---EGIGALYTGLAPRVAKIAPSCA 360

Query: 285 LCLTLMEQALRV 296
           + ++  E   R+
Sbjct: 361 IMISSYELTKRL 372

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG--MALYTLASALSSVA 226
           K  G+ GLY+G   ++L   V   +   +Y   K  L     +G  +A + L   ++ + 
Sbjct: 173 KTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVIT-MG 231

Query: 227 VCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR-IAPHT 283
              A  P D    RM    G    Y G LDCL K V++EG  +L+KG  A + R +A   
Sbjct: 232 ASTASYPLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAG 291

Query: 284 ILCL 287
           ++ L
Sbjct: 292 VISL 295

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y+G LDC  +T   EG  + ++G+ A +LR  P   L     ++
Sbjct: 57  YKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDK 100

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 12/133 (9%)

Query: 171 RGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP-DGMALYTLASALSSVAV-- 227
            G+   ++G  A +LR     A+  A     K  LS     DG A +   +  S  A   
Sbjct: 71  EGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGG 130

Query: 228 --CIAMNPFDVAMTRMYHHRGG-------LYRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
              + +   D A TR+     G        + G LD   KT++ +G   LY+G +  +L 
Sbjct: 131 LSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLG 190

Query: 279 IAPHTILCLTLME 291
           I  +  L   L +
Sbjct: 191 IIVYRGLYFGLYD 203

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 57/151 (37%), Gaps = 18/151 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P  + K RMQ  A              + +L K+ G+ G Y+G  A L+  G   + Q  
Sbjct: 43  PFDITKVRMQTSAGSATAV------DVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFG 96

Query: 197 VYSHAKEALSRHVPD-----GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL--- 248
           V    K    R   D      +  Y +    S  A      P +    R+      L   
Sbjct: 97  VNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANA 156

Query: 249 -YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
            Y+G LDC+ K ++Q    AL +G  A L+R
Sbjct: 157 EYQGSLDCMRKLLKQ---GALMRGFTATLMR 184

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           L+     +A  +   PFD+   RM    G      +D +   ++ EG    YKG LA L+
Sbjct: 28  LSGTAGGIAQVLVGQPFDITKVRMQTSAGSAT--AVDVVTSLIKNEGILGFYKGTLAPLV 85

Query: 278 RI 279
            +
Sbjct: 86  GV 87

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 91/264 (34%), Gaps = 39/264 (14%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGL-RGLQQGLACAYAYQILLNG- 88
           P +TVK RLQ Q       + ++      +   Y  EGL RG  QG+    A   L N  
Sbjct: 26  PFDTVKVRLQTQ------PAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAV 79

Query: 89  --------SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQL 140
                    RL   + L + L   V +                            +P++L
Sbjct: 80  LFVSFNQAKRLLDVESLLSPLSKTVWAG----------------AFAGACASFVLTPVEL 123

Query: 141 VKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSH 200
           +K ++Q            ++   + ++  +RG  GL+QG     +R   G A     Y  
Sbjct: 124 IKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEV 183

Query: 201 AKEALS--RHVPDGMALYTLASALSS-VAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLC 257
            K  L+  R          LAS  S+ +A   ++ P D   + M      L         
Sbjct: 184 VKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSATR---- 239

Query: 258 KTVRQEGFSALYKGHLAQLLRIAP 281
           K   ++G +  Y+G    L+R  P
Sbjct: 240 KIYARQGIAGFYRGLGITLIRAVP 263

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/263 (20%), Positives = 96/263 (36%), Gaps = 46/263 (17%)

Query: 53  YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTY 112
           Y+    A+  IY+ EG+RGL QGL  +         S    Y  +R       L +R+  
Sbjct: 75  YNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKN- 133

Query: 113 XXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVA--LFKD 170
                                  +P+ L+  R Q    R+   + G      VA  ++K+
Sbjct: 134 TKFTTIEELLLGIVAAATSQIFTNPISLISARQQT---RQ--GIDGDNDFLTVAKEIYKE 188

Query: 171 -RGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMAL-------------- 215
            R ++G ++G+  +L+ T +  ++    Y   K+AL     D M L              
Sbjct: 189 QRSIKGFWKGLKVSLMLT-INPSITYTSYEKLKDAL--FTTDTMNLKKELVDSSSQLSPY 245

Query: 216 --YTLASALSSVAVCIAM----------------NPFDVAMTRMYHHRG--GLYRGPLDC 255
             +TL      ++  I M                + F   +  +Y + G    ++G    
Sbjct: 246 QNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLYYLYKNEGLRSWWKGLSPQ 305

Query: 256 LCKTVRQEGFSALYKGHLAQLLR 278
           L K V  +G   ++KG L +L++
Sbjct: 306 LAKGVLVQGLLFMFKGELTKLMK 328

>Kwal_27.11419
          Length = 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 46/182 (25%)

Query: 137 PLQLVKTRMQA------LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVG 190
           P  L+KTR+Q       L   R    PG+                L++G   + LRT VG
Sbjct: 27  PFDLLKTRLQQNKSSNLLDVVRSIETPGQ----------------LWKGTLPSALRTSVG 70

Query: 191 SAVQLAVYSHAKEALSRHVPDGMA-------------LYT--LASALSSVAVCIAMNPFD 235
           SA+ L+  +  + A++     G+A             +Y   ++ A++  AV +A  P  
Sbjct: 71  SALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPIT 130

Query: 236 VAMTR----MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           V   R    MY+     Y+   +      R EG   L+ G  A ++R AP+  L +   E
Sbjct: 131 VLKVRFESTMYN-----YKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYE 185

Query: 292 QA 293
           Q+
Sbjct: 186 QS 187

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 16/151 (10%)

Query: 160 MGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLA 219
           +G     +++  G+RGL+ G  A ++R    + + +  Y  +K  L R +P  M  +  +
Sbjct: 146 LGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNES 205

Query: 220 --------------SALSSVAVCIAM-NPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEG 264
                         +A SS ++   + +PFD   TRM  +    Y G +      +R E 
Sbjct: 206 GVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQLNPSQYY-GFIQTFKSIIRYER 264

Query: 265 FSALYKGHLAQLLRIAPHTILCLTLMEQALR 295
              L+ G   +L R A    +   + E+ ++
Sbjct: 265 PRNLFDGLSLRLSRKALSAGIAWGIYEELVK 295

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 11/97 (11%)

Query: 1   MSPSTDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAV 60
            S  T T ++ + +F           T T+P +T+KTR+QL           Y G  Q  
Sbjct: 208 FSTKTSTIINSIAAFSSASLAT----TITSPFDTIKTRMQLN-------PSQYYGFIQTF 256

Query: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPL 97
             I R E  R L  GL+   + + L  G   G+Y+ L
Sbjct: 257 KSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYEEL 293

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 66/167 (39%), Gaps = 29/167 (17%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F + G +G+Y+G+ +A++ +   +++   
Sbjct: 26  PIDTLKTRLQAKG----------------GFFANGGYKGVYRGLGSAVVASAPSASLFFV 69

Query: 197 VYSHAKEALSRHV-----PDGMAL------YTLASALSSVAVCIAMNPFDVAMTRMYHHR 245
            Y   K   SR V     P G         + ++S+   ++ C+   P +V   R   HR
Sbjct: 70  AYDSMK-CWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVPAEVIKQRTQTHR 128

Query: 246 GGLYRGPLDCLCKTVRQEGF-SALYKGHLAQLLRIAPHTILCLTLME 291
                  L  L +    EG    LY+G    ++R  P T +   L E
Sbjct: 129 TNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYE 175

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 77/185 (41%), Gaps = 29/185 (15%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVAL------FKDRGVRGLYQGVDAALLRTGVG 190
           P+  +K R+Q        PL   + +  + L      ++  G+R  Y+GV   ++     
Sbjct: 339 PIDTLKYRIQC------APLNTNLKKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPY 392

Query: 191 SAVQLAVYSH------AKEALSRHVPDGMALYTL-----ASALSSVAVCIAMNPFDVAMT 239
           +A+ L  +S        KEA    +P+   + +        A S       + P ++  T
Sbjct: 393 AALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRT 452

Query: 240 RM-----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
           R+     Y H    Y G  D L KT+++EG+  L+KG +  L ++ P   +     E   
Sbjct: 453 RLQAQGTYAH-PHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLK 511

Query: 295 RVVRL 299
           R+++L
Sbjct: 512 RLMKL 516

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 16/174 (9%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL  + T++Q         +  ++   +  +++  G+ G Y G+++A+     G A+   
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKL-ETIKEIYRKDGLLGFYAGLESAIY----GMALTNF 87

Query: 197 VYSHAKEALSRHV---PDGMALYTLASALSSVA----VCIAMNPFDVAMTRMYHHRGGLY 249
           VY +  E  SR+V        L TL S L+         IA NP  VA TRM   +    
Sbjct: 88  VYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE-- 145

Query: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303
           +  L  + + V+++    L+ G L   L +  + I+  T+ EQ L+ + L  N+
Sbjct: 146 KTALATIIEIVKKDSAKTLFNG-LKPALVLVMNPIVQYTVFEQ-LKNLVLAWNK 197

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 96/278 (34%), Gaps = 66/278 (23%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACA--------- 79
           T P+ T+ T+LQ QG      +       + +  IYR +GL G   GL  A         
Sbjct: 31  TYPLVTITTKLQTQGN---DENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNF 87

Query: 80  ---YAYQI----LLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXX 132
              Y Y++    +L   +    + L + L GCV                           
Sbjct: 88  VYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGS---------------------VTA 126

Query: 133 XXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
              +P+ +  TRM      +           ++ + K    + L+ G+  AL+   +   
Sbjct: 127 IASNPIWVANTRMTVTKSEKTAL------ATIIEIVKKDSAKTLFNGLKPALVLV-MNPI 179

Query: 193 VQLAVYSHAKEALSRHVPDGM---ALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249
           VQ  V+   K  +      G+   +   L  AL  +A   +  P+    TRM+    G +
Sbjct: 180 VQYTVFEQLKNLVLAWNKQGILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKH 239

Query: 250 ----------------RGPLDCLCKTVRQEGFSALYKG 271
                           +  L  + + V+++G S LY+G
Sbjct: 240 TDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRG 277

>Scas_718.24
          Length = 337

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 5/114 (4%)

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG--MALYTLASALSSVA 226
           K  GV GLY+G   +++   V   +   +Y   K  L     +G  +A + L   +++ A
Sbjct: 201 KSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVTTGA 260

Query: 227 VCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
              +  P D    +M    G    Y+G  DC  K V  EG ++L+KG  A +LR
Sbjct: 261 STCSY-PLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILR 313

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 25/44 (56%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y+G +DC  +T +QEG  + ++G+ A ++R  P   L     ++
Sbjct: 86  YKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDK 129

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 63/151 (41%), Gaps = 21/151 (13%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVA 226
           ++++ G+R  Y+G+   +L     +A+ L  +S  K        + + +      +S++ 
Sbjct: 345 MYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLV 404

Query: 227 V-----------CIAMNPFDVAMTRM-------YHHRGGLYRGPLDCLCKTVRQEGFSAL 268
           V              + P ++  TR+       + HR   Y G  D   KTV++EG   L
Sbjct: 405 VLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHR---YDGFQDVFRKTVQREGLPGL 461

Query: 269 YKGHLAQLLRIAPHTILCLTLMEQALRVVRL 299
           YKG +  L ++ P   +     E   R +RL
Sbjct: 462 YKGLVPTLAKVCPAVAISYLCYENLKRAMRL 492

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 31/186 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRM-GRRLV-----ALFKDRGVRGLYQGVDAALLRTGVG 190
           P+  +K RMQ        PL   + GR+L+      ++ + G++  Y+GV   +L     
Sbjct: 340 PIDTLKFRMQC------APLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPY 393

Query: 191 SAVQLAVYSHAKE--------ALSRHVPDGMALYTLA----SALSSVAVCIAMNPFDVAM 238
           +A+ L  +S  K+         L++   D + L  L      A S       + P ++  
Sbjct: 394 AALDLGTFSMLKKWYISSKAKKLNKKEED-VELSNLVVLPMGAFSGTFGATVVYPINLLR 452

Query: 239 TRMYHHRGGL-----YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
           TR+   +G       Y G  D L KT+++EG+  L+KG +  L ++ P   +     E  
Sbjct: 453 TRL-QAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENL 511

Query: 294 LRVVRL 299
            ++++L
Sbjct: 512 KKLMKL 517

>Scas_578.3*
          Length = 524

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 73/167 (43%), Gaps = 29/167 (17%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRM-GRRLV-----ALFKDRGVRGLYQGVDAALLRTGVG 190
           P+  +K R+Q        PL G + G  L+      ++K+ G+R  Y+GV    L     
Sbjct: 346 PIDTLKFRIQC------APLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPY 399

Query: 191 SAVQLAVYSHAKEALSR------HVP--DGMALYTLA---SALSSVAVCIAMNPFDVAMT 239
           +A+ L  +S  K+   +      ++P  D M  Y L     A S      A+ P ++  T
Sbjct: 400 AALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRT 459

Query: 240 RM-----YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAP 281
           R+     Y H    Y G  D   +T+++EG    YKG +  L+++ P
Sbjct: 460 RLQAQGTYAHPY-TYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCP 505

>Scas_667.22
          Length = 306

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 51/139 (36%), Gaps = 16/139 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K R+Q       P     + R+L+   K+ G +G Y+G    L+  G   ++Q  
Sbjct: 45  PFDTTKVRLQT---SSTPTTAMEVIRKLL---KNEGPKGFYKGTLTPLIGVGACVSLQFG 98

Query: 197 VYSHAKEALSRHVPD------GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG--- 247
           V    K       PD       +  Y +      +      +P +    R+    G    
Sbjct: 99  VNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPN 158

Query: 248 -LYRGPLDCLCKTVRQEGF 265
             ++GPLDC+ K   Q GF
Sbjct: 159 VEFKGPLDCIRKLRAQGGF 177

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 9/137 (6%)

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVY-----SHAKEALSRHVPDGMALYTLASALS 223
           K R   G  +G+   +LR G G      VY     +   +   R       L  L  ALS
Sbjct: 170 KLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKL-CLFGALS 228

Query: 224 SVAVCIAMNPFDVAMTRMY--HHRGGLYRGPLDCLCKTVRQEG-FSALYKGHLAQLLRIA 280
              + + + P DV  + M   + +   Y   +  + KT+  +G   A +KG    +LR A
Sbjct: 229 GTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAA 288

Query: 281 PHTILCLTLMEQALRVV 297
           P         E A+R++
Sbjct: 289 PANGATFATFELAMRLL 305

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 51/114 (44%), Gaps = 5/114 (4%)

Query: 169 KDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG--MALYTLASALSSVA 226
           K  GV GLY+G   +++   V   +   +Y   K  L     +G  +A + L   +++ A
Sbjct: 182 KSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGA 241

Query: 227 VCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
              +  P D    RM    G    Y G  DCL K V  EG  +L+KG  A +LR
Sbjct: 242 STCSY-PLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y G LDC  +T  QEG  + ++G+ A ++R  P   L     ++
Sbjct: 67  YAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDK 110

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 13/124 (10%)

Query: 171 RGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSSVAVCIA 230
            GV   ++G  A ++R     A+  A     K        +G A +  A  L+S     A
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKW-FAGNLASGGAAGA 139

Query: 231 MN-----PFDVAMTRM-----YHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
           ++       D A TR+        +GG   + G +D   KT++ +G + LY+G L  ++ 
Sbjct: 140 LSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVG 199

Query: 279 IAPH 282
           I  +
Sbjct: 200 IVVY 203

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 61/151 (40%), Gaps = 18/151 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K R+Q     +VP     + + L+   K+ G +G Y+G    L+  G   ++Q  
Sbjct: 45  PFDTTKVRLQT---SKVPTSAAEVVKNLL---KNEGPKGFYKGTLTPLVGVGACVSIQFG 98

Query: 197 VYSHAKEAL-SRHVPDGMAL----YTLASALSSVAVCIAMNPFDVAMTRMYHHRG----G 247
           V    K    +R+V     L    Y L      +      +P +    R+    G     
Sbjct: 99  VNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQA 158

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
            ++GP+DC+ K   Q+G   L +G +  +LR
Sbjct: 159 EFKGPIDCIKKLRSQKG---LMRGLIPTMLR 186

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 73/179 (40%), Gaps = 30/179 (16%)

Query: 136 SPLQLVKTRMQ------ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGV 189
           SP++ V+ R+Q      A A  + P         +  + K R  +GL +G+   +LR G 
Sbjct: 139 SPIEHVRIRLQTQTGSGAQAEFKGP---------IDCIKKLRSQKGLMRGLIPTMLREGH 189

Query: 190 GSAVQLAVYSHAKEAL-SRHVPDGMA-------LYTLASALSSVAVCIAMNPFDVAMTRM 241
           G      VY    EAL S+ +  G+           L  ALS  A+ + + P DV  + M
Sbjct: 190 GCGTYFLVY----EALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVM 245

Query: 242 YH---HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
                ++    +  +        +EG  A +KG    +LR AP         E A+R++
Sbjct: 246 QTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 15/165 (9%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           P+ +VKTR+Q L P +     G +G  R++V    + G   L  G    LL   +  A +
Sbjct: 35  PIDVVKTRIQ-LEPLKYSS--GMVGSFRKIVG---EEGAAALLTGFGPTLLGYSMQGAFK 88

Query: 195 LAVYSHAKEALSRHVPDGMA------LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL 248
              Y   K+A    +    A      +Y  ++A++     IA+ P +    R+       
Sbjct: 89  FGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQPT-F 147

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
             G +    + +++EG  + Y G    L +  P+ I    + E A
Sbjct: 148 ANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHA 192

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 56/126 (44%), Gaps = 22/126 (17%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASA--LSS 224
           ++K+ GV GL++G     +R    SAVQ  VY   K+ +  HV   +    L +   LS+
Sbjct: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIF-HVDGTVGKEQLLNWQRLSA 117

Query: 225 VAVCIAMN-----PFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-GF 265
            A+C  M+     P D+  TR+      L +             G  + L KT ++E G 
Sbjct: 118 GALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGI 177

Query: 266 SALYKG 271
             LY+G
Sbjct: 178 RGLYRG 183

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 27 TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLAC 78
          T  +P E VK  LQ+Q    +  S    G   AV  +Y+ EG+ GL    GL C
Sbjct: 27 TVVSPFERVKILLQVQ----SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNC 76

>Scas_697.47
          Length = 328

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL--------SRHVPDGMALYTL 218
           + KD GV+ L++G  A L R G GSA+  A Y  +K+ L        S+     +A   L
Sbjct: 186 IVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCL 245

Query: 219 ASALSSVAVCIAMNPFDVAMTRMYHHRG 246
           A  ++ +++ + + P D   T++    G
Sbjct: 246 AGGIAGMSMWLVVFPIDTIKTKLQSSSG 273

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 137 PLQLVKTRMQA-LAPRRVPP------LPGRMGRR----LVALFKDRGVRGLYQGVDAALL 185
           PL L KT +Q+ ++P           LP R  +     ++ +FK++G+ GLYQG+    +
Sbjct: 23  PLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQGMTVTTV 82

Query: 186 RTGVGSAVQLAVYSHAKEALSRH 208
            T V + V    Y+  +++  +H
Sbjct: 83  ATFVQNFVYFFWYTFIRKSYMKH 105

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 60/181 (33%), Gaps = 23/181 (12%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPA--QAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T PI  +K R +         S LY   +   A S I+RTEGLRG  +G           
Sbjct: 122 TMPITVIKVRYE---------STLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPY 172

Query: 87  NGSRLGLYDPLR----AALGGCVL---SDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQ 139
            G  +  YD ++      L   V+   SD R                         +P  
Sbjct: 173 AGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFD 232

Query: 140 LVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYS 199
            VKTRMQ L P +              +     VR L+ G+   L R    + +   +Y 
Sbjct: 233 TVKTRMQ-LEPAKFHSFTSTFWH----IATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

Query: 200 H 200
            
Sbjct: 288 E 288

>Kwal_0.232
          Length = 274

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 66/166 (39%), Gaps = 28/166 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P+  +KTR+QA                    F + G  G+Y+G+ +A++ +   +++   
Sbjct: 26  PIDTLKTRLQAAG----------------GFFANGGYLGVYRGLGSAVVASAPSASLFFV 69

Query: 197 VYSHAKEALSRHVPDGM----------ALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246
            Y   K + SR + + +          A +  +S+   +A C+   P +V   R   H+ 
Sbjct: 70  TYDGMK-SYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACMVRVPAEVIKQRTQTHKS 128

Query: 247 GLYRGPLDCLCKTVRQEGF-SALYKGHLAQLLRIAPHTILCLTLME 291
                 L  L +    EG    LY+G    ++R  P T +   L E
Sbjct: 129 DSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYE 174

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 48/123 (39%), Gaps = 3/123 (2%)

Query: 58  QAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXX 117
           Q    I+  EGLRG+ +G+      Q+   GSR GL    R    G      +       
Sbjct: 155 QVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLS---RLVEDGIRRVTHKRSDEKLS 211

Query: 118 XXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLY 177
                              P+++++  MQ+       P    +G+    ++++ G+RGLY
Sbjct: 212 AMEKIVASALGGGLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLY 271

Query: 178 QGV 180
           +GV
Sbjct: 272 RGV 274

>Scas_718.5
          Length = 324

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 72/176 (40%), Gaps = 32/176 (18%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K RMQ  A + V  L   + R+LV   K+ GV   Y+G    ++  G   +VQ  
Sbjct: 59  PFDTTKVRMQTSA-KSVGALD--IIRKLV---KNEGVWAFYKGSLIPIVGVGACVSVQFG 112

Query: 197 VYSHAKEALSRHVP-----------DG---MALYTLASALSSVAVCIAMNPFDVAMTRMY 242
           V     EA+ R              DG   +  Y +      V      +P +    R+ 
Sbjct: 113 V----NEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQ 168

Query: 243 HHRGG----LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
              G      ++GPLDC+ K V+++   +L +G    +LR A H + C  L  +AL
Sbjct: 169 TQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR-AGHGLGCYFLTYEAL 220

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 24/176 (13%)

Query: 136 SPLQLVKTRMQAL---APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
           SP++ V+ R+Q        R    P    R+LV        + L +G+   +LR G G  
Sbjct: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVK------EKSLMRGLRPMMLRAGHG-- 209

Query: 193 VQLAVYSHAKEAL-SRHVPDG-----MALYTLAS--ALSSVAVCIAMNPFDV--AMTRMY 242
             L  Y    EAL +  +  G     +A + L S  +LS V + +A+ P DV  +M +  
Sbjct: 210 --LGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267

Query: 243 HHRGGLYRGPL-DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
             R   ++  + + +    R++G SA +KG    +LR AP         E  +R++
Sbjct: 268 TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           LA     ++  I   PFD    RM      +  G LD + K V+ EG  A YKG L  ++
Sbjct: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--GALDIIRKLVKNEGVWAFYKGSLIPIV 101

Query: 278 RIAPHTILCLTLMEQALRVVR 298
            +     +   + E   R  R
Sbjct: 102 GVGACVSVQFGVNEAMKRFFR 122

>Kwal_27.12481
          Length = 304

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 92/262 (35%), Gaps = 24/262 (9%)

Query: 31  PIETVKTRLQLQGELV--AGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           PIE VK  +Q Q E++    + R Y+G  +        EG+    +G             
Sbjct: 30  PIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASFWRGNTANVIRYFPTQA 89

Query: 89  SRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQAL 148
                 D ++A  G         Y                       S L   +TR+ A 
Sbjct: 90  LNFAFKDKIKAMFG---FKKEEGYAKWFAGNLASGGAAGGLSLMFVYS-LDYARTRLAA- 144

Query: 149 APRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEA 204
             +       R    LV ++K      G+ GLY+G     L + VG  V   +Y    ++
Sbjct: 145 DSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRG----FLPSVVGIVVYRGLYFGGYDS 200

Query: 205 LSRHVPDG------MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL--YRGPLDCL 256
           L   +  G      +A + L  A+++ A   A  P D    RM    G    Y G  D  
Sbjct: 201 LKPLLLTGSLEGSFLASFLLGWAVTTGA-STASYPLDTVRRRMMMTSGQAVKYNGAFDAF 259

Query: 257 CKTVRQEGFSALYKGHLAQLLR 278
            K V  EG  +L+KG  A +LR
Sbjct: 260 RKIVAAEGIKSLFKGCGANILR 281

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 66/187 (35%), Gaps = 32/187 (17%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMG---------------RRLVALFKDRGVRGLYQGVD 181
           P+  +KTRMQA++  +        G               +++  +    G   L++GV 
Sbjct: 40  PIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISRISSTEGSLALWRGVQ 99

Query: 182 AALLRTGVGSAVQLAVYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIA----M 231
           + ++  G   AV  A Y   KE L      + H P       L +A+S VA  +A    M
Sbjct: 100 SMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQP-------LKTAVSGVAATVAADALM 152

Query: 232 NPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           NPFD    R+                   + EG  A +  +   L    P   L   + E
Sbjct: 153 NPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYE 212

Query: 292 QALRVVR 298
            + +   
Sbjct: 213 SSTKFFN 219

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 98/290 (33%), Gaps = 25/290 (8%)

Query: 4   STDTPVSKLG-SFXXXXXXXXXXXTFTNPIETVKTRLQLQGELV--AGVSRLYSGPAQAV 60
           STD   S     F           T   PIE VK  +Q Q E++    + R Y+G  +  
Sbjct: 2   STDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECF 61

Query: 61  SLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXX 120
                 EG+    +G                   D ++A  G         Y        
Sbjct: 62  KRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAGNL 118

Query: 121 XXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGL 176
                          S L   +TR+ A   +       R    LV ++K      GV GL
Sbjct: 119 ASGGLAGGLSLLFVYS-LDYARTRLAA-DSKSAKKGGERQFNGLVDVYKKTLASDGVAGL 176

Query: 177 YQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG------MALYTLASALSSVAVCIA 230
           Y+G     L + VG  V   +Y    ++L   +  G      +A + L  A+++ A   A
Sbjct: 177 YRG----FLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTGA-STA 231

Query: 231 MNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
             P D    RM    G    Y G  D   K V  EG  +L+KG  A +LR
Sbjct: 232 SYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 59/152 (38%), Gaps = 18/152 (11%)

Query: 158 GRMGRR---LVALFK----DRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVP 210
           G + RR   +V  FK    D GV   ++G  A ++R     A+  A     K        
Sbjct: 48  GSLDRRYTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE 107

Query: 211 DGMALYTLASALSSVAVCIAMNPF----DVAMTRM-----YHHRGG--LYRGPLDCLCKT 259
           +G A +   +  S          F    D A TR+        +GG   + G +D   KT
Sbjct: 108 EGYAKWFAGNLASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKT 167

Query: 260 VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
           +  +G + LY+G L  ++ I  +  L   L +
Sbjct: 168 LASDGVAGLYRGFLPSVVGIVVYRGLYFGLYD 199

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 60/157 (38%), Gaps = 28/157 (17%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K R+Q      VP     + ++LV   K+ G RG Y+G    L+  G   +VQ  
Sbjct: 43  PFDTTKVRLQT---SSVPTTALDVVKKLV---KNEGFRGFYKGTLTPLVGVGACVSVQFG 96

Query: 197 VYSHAKEALSRHV--------PD---GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR 245
           V     EA+ R          P+   G+  Y L       A     +P +    R+    
Sbjct: 97  V----NEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQT 152

Query: 246 G----GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
           G      + GPLDC+ K       ++L +G    +LR
Sbjct: 153 GTGAAAQFHGPLDCIKKLTAN---NSLMRGLTPTMLR 186

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           LA     V+  +   PFD    R+      +    LD + K V+ EGF   YKG L  L+
Sbjct: 28  LAGTAGGVSQVLIGQPFDTTKVRL--QTSSVPTTALDVVKKLVKNEGFRGFYKGTLTPLV 85

Query: 278 RIA 280
            + 
Sbjct: 86  GVG 88

>Scas_716.29
          Length = 316

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 103/299 (34%), Gaps = 50/299 (16%)

Query: 27  TFTNPIETVKTRLQLQ----GELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAY 82
           T   P++T+K RLQL+    G+  +G+ ++  G      +I    GLR   +G       
Sbjct: 38  TVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKG------MILNEGGLRSFWKGNVPGTMM 91

Query: 83  QILLNGSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVK 142
            +L  G++   Y       G        T                         P  +++
Sbjct: 92  YVLYGGAQFSSYSFYNNLFG-------ETSDMNGQLQSLVVGALAGMTSSFVSYPTDVLR 144

Query: 143 TRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK 202
           TR  A     +  L          ++   G+ G ++G  A++    + +++    Y   K
Sbjct: 145 TRFIANQDVALSSLS----HGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESIK 200

Query: 203 ---EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVA--------------------MT 239
              +  S+       L   AS++S V   +   P D                      +T
Sbjct: 201 IYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVT 260

Query: 240 RMYHHRGG--LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
            +Y    G    R  L+ L    RQEG  +LY+G    L +  P T++ L   E  +R+
Sbjct: 261 EIYQSYKGASFIRMGLNIL----RQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315

>Kwal_56.23011
          Length = 303

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P  + K R+Q        P+P    + + +L K+ G+   Y+G  A L   G   + Q  
Sbjct: 43  PFDITKVRLQ------TSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFG 96

Query: 197 VYSHAKEALSR-----HVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY----HHRGG 247
           V    K+   +       P  +  Y     +S  A      P +    R+          
Sbjct: 97  VNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAA 156

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
            Y G LDC  K ++Q    AL +G  A  LR +
Sbjct: 157 EYHGSLDCARKLLKQ---GALMRGFTATTLRTS 186

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 172 GVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPD------GMALYTLASALSSV 225
           GV+ L+ G  A L R G GSA+  A Y  +K  L++ V         +A   LA  ++ +
Sbjct: 182 GVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGM 241

Query: 226 AVCIAMNPFDVAMTRM 241
           ++ + + P D   TR+
Sbjct: 242 SMWLVVFPIDTIKTRL 257

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 50/126 (39%), Gaps = 10/126 (7%)

Query: 59  AVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGL----YDPLRAALGGCVLSDRRTYXX 114
           A   IY+ +G++G+ +G+      Q+   GSR G      + +R A G     D+ T   
Sbjct: 156 AFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLT--- 212

Query: 115 XXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVR 174
                                 P+++++  MQ+       P    +      +++  G++
Sbjct: 213 ---ALEKIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIK 269

Query: 175 GLYQGV 180
           GLY+GV
Sbjct: 270 GLYRGV 275

>Kwal_33.15597
          Length = 305

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 66/170 (38%), Gaps = 19/170 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSA 192
           P+ +VKTR+Q          P    + +++ FK      G   L  G    LL   +  +
Sbjct: 33  PIDVVKTRIQLE--------PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 193 VQLAVYSHAKEAL------SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246
            +   Y   K+         + V    ++Y  ++A++     IA+ P +    R+     
Sbjct: 85  FKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPT 144

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
               G +    + +++EG S+ Y G    L +  P+ I    + E+A  V
Sbjct: 145 -FANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEV 193

>Kwal_55.21106
          Length = 328

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 67/172 (38%), Gaps = 37/172 (21%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRR-------------------LVALFKDRGVRGLY 177
           PL LVKT +Q     + P +    G +                   L+ +FK +GV GLY
Sbjct: 23  PLDLVKTLIQT--QNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIKIFKTKGVLGLY 80

Query: 178 QGVDAALLRTGVGSAVQLAVYSHAKEALSRH-----------VPDGMALYTLASALSSVA 226
           QG+  +++   + S      YS  +++  R+            P+ + L  +A+A+S   
Sbjct: 81  QGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELLLGIVAAAVSQ-- 138

Query: 227 VCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTV-RQEGFSALYKGHLAQLL 277
             I  +P  V  TR      G   G  + L +    Q   +  ++G    L+
Sbjct: 139 --IFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSLI 188

>Scas_673.17
          Length = 314

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 64/170 (37%), Gaps = 19/170 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSA 192
           P+ +VKTR+Q          P    + +V  FK    D G   L  G    LL   V  A
Sbjct: 40  PVDVVKTRIQLE--------PTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGA 91

Query: 193 VQLAVYSHAKE------ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246
            +   Y   K+           V    ++Y  ++A++     IA+ P +    R+     
Sbjct: 92  FKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPT 151

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
               G +    + +++EG  + Y G    L +  P+ I    + E+A  V
Sbjct: 152 -FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEV 200

>Kwal_27.12599
          Length = 304

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 60/153 (39%), Gaps = 18/153 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K R+Q       P     + ++LV   K+ G+RG Y+G    L+  G   + Q  
Sbjct: 44  PFDTTKVRLQT---STTPTTAVEVVKKLV---KNEGLRGFYKGTLTPLVGVGACVSCQFG 97

Query: 197 VYSHAK-----EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG----G 247
           V    K      +   H    +  Y +   +  VA     +P +    R+          
Sbjct: 98  VNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVA 157

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
            ++GPLDC+ K +R  G  AL +G    +LR A
Sbjct: 158 EFKGPLDCINK-LRANG--ALMRGLSPTILREA 187

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 96/265 (36%), Gaps = 53/265 (20%)

Query: 53  YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYD-------PLRAALGGCV 105
           Y G   A+  IY  EG+ GL +GL  +     + + S    Y         L+ A GG  
Sbjct: 72  YKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGG-- 129

Query: 106 LSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQALAPRRVPPLPGRMGRRLV 165
             D R                         +P+ +V TR Q           G    R V
Sbjct: 130 --DAR----FSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQA-----AGAADMRTV 178

Query: 166 A--LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL------SRHVPDGMALYT 217
           A  +  + G RG + G+  +L+ T V  ++  A Y   +EAL      + H+ D  AL +
Sbjct: 179 AREVHAENGWRGFWAGLKVSLVLT-VNPSITYATYERLREALFPTPAAASHLVDSAALLS 237

Query: 218 -----LASALSSVAVCIAMNPFDVA-----------------MTRMYHHRG--GLYRGPL 253
                +   LS +   +   P  +A                 +  +Y   G   L++G  
Sbjct: 238 PGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLSLWKGLG 297

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLR 278
             + K V  +G   ++KG L ++LR
Sbjct: 298 PQITKGVLVQGLLFMFKGELTKMLR 322

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 94/251 (37%), Gaps = 20/251 (7%)

Query: 28  FTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLN 87
            T P+ T+ TR+Q+  +     +R  S   +AV  IYR EG+ G   GL  A  Y +  N
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRSKS-KLEAVREIYRKEGVVGFYYGLESA-MYGMAAN 90

Query: 88  GSRLGLYDPLRAALGGCVLSDRRTYXXXXXXXXXXXXXXXXXXXXXXXSPLQLVKTRMQA 147
                 +  L A     V   RR                         +P+ +V TRM  
Sbjct: 91  SLNYYYFYELAARATMRVRGSRR----LNTSEAILSSAVAGSMTAIASNPIWVVNTRM-T 145

Query: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR 207
           +A      L       L+ + +  GV  L+ G+  AL+       +Q  V+   K  + +
Sbjct: 146 VAKSEQSTLA-----VLLDIVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVVLK 199

Query: 208 HVPDGMALYTLASALSSV---AVCIAMNPFDVAMTRMYHHRG----GLYRGPLDCLCKTV 260
                + L + A  L +V   A   +  P+    TRM+  +G       +     +   V
Sbjct: 200 WSGSDVLLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIV 259

Query: 261 RQEGFSALYKG 271
           ++EG   LY G
Sbjct: 260 KKEGIQGLYHG 270

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 61/153 (39%), Gaps = 18/153 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P  + K RMQ  +     P    + + LV   K+ G+   Y+G    L+  G   + Q  
Sbjct: 43  PFDITKVRMQTSSGS---PTAIEVIKNLV---KNEGLLAFYKGTLVPLIGVGACVSCQFG 96

Query: 197 VYSHAKEALSR---HVPDGMAL--YTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL--- 248
           V    K    R   +    ++L  Y     +S  A      P +    R+      L   
Sbjct: 97  VNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKA 156

Query: 249 -YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
            YRG LDC+ K ++Q+   AL +G  A L+R +
Sbjct: 157 EYRGSLDCMKKLLKQK---ALMRGFTATLMRTS 186

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 225 VAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRI 279
           +A  +   PFD+   RM    G      ++ +   V+ EG  A YKG L  L+ +
Sbjct: 35  IAQVLVGQPFDITKVRMQTSSGS--PTAIEVIKNLVKNEGLLAFYKGTLVPLIGV 87

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 65/170 (38%), Gaps = 17/170 (10%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRM---GRRLVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           P  LVK R Q+   R        +    R+         VRG Y+GV   LL      AV
Sbjct: 48  PFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAV 107

Query: 194 QLAVYSHAKEALSR----------HVPDGMALYTLASA--LSSVAVCIAMNPFDVAMTRM 241
               Y   K+ ++            V   + L  +A+A  +S++   +   P +     +
Sbjct: 108 SFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVL 167

Query: 242 YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291
              +G      LD   + VR +GF +L+KG LA L R  P + L     E
Sbjct: 168 QTTQG--KASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYE 215

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 34.3 bits (77), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 22/44 (50%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQ 292
           Y G +DC  +T   EG  + ++G+ A ++R  P   L     ++
Sbjct: 53  YNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDK 96

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 14/125 (11%)

Query: 172 GVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDG------MALYTLASALSSV 225
           G+ GLY+G     L + VG  V   +Y    ++L   +  G      +A + L  A+++ 
Sbjct: 172 GIAGLYRG----FLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTG 227

Query: 226 AVCIAMNPFDVAMTRMYHHRGGL--YRGPLDCLCKTVRQEGFSALYKGHLAQLLR-IAPH 282
           A   A  P D    RM    G    Y G  D   K V  EG  +L+KG  A +LR +A  
Sbjct: 228 A-STASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGA 286

Query: 283 TILCL 287
            ++ L
Sbjct: 287 GVISL 291

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 64/171 (37%), Gaps = 27/171 (15%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKD----RGVRGLYQGVDAALLRTGVGSA 192
           P+ +VKTR+Q          P    + +V  FK      G   L  G    LL    G +
Sbjct: 37  PIDVVKTRIQLE--------PTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLL----GYS 84

Query: 193 VQLAVYSHAKEALSRHVPDGM----------ALYTLASALSSVAVCIAMNPFDVAMTRMY 242
           +Q A      E   +   D +          ++Y  ++A++     IA+ P +    R+ 
Sbjct: 85  IQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLV 144

Query: 243 HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
                   G +    + +++EG  + Y G    L +  P+ I    + E+A
Sbjct: 145 SQPQ-FANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERA 194

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 172 GVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALS-RHVPDGMALYT--LASALSSVAVC 228
           GVR L++G  A L R G GSA+  A Y   K  L+ R   + +++    LA  ++ V++ 
Sbjct: 197 GVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMW 256

Query: 229 IAMNPFDVAMT----------------RMYHHRGGL 248
           + + P D   T                ++Y+ RGG+
Sbjct: 257 VGVFPIDTIKTELQSSNTRQTMMEATRKIYNTRGGI 292

>Scas_717.20
          Length = 356

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVS----LIYRTEGLRGLQQGLACAYAYQILL 86
           P E ++ RLQ+       VS++Y    Q++S    +IY+  G RG   GL+  Y     +
Sbjct: 283 PFEIIRRRLQVS---TLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPM 339

Query: 87  NGSRLGLYDPLRAALG 102
                 +Y+ ++  LG
Sbjct: 340 VACSFFVYERMKWHLG 355

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVA--LFKDRGVRGLYQGVDAALLRTGVGSAV 193
           +PL  +K   Q   P         +G +  A  ++ + G+RG +QG    L+R    +AV
Sbjct: 51  APLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAV 110

Query: 194 QLAVYSHAKEAL 205
           +   Y   +  L
Sbjct: 111 KFVAYEQIRNTL 122

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 64/174 (36%), Gaps = 33/174 (18%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSA 192
           P+ +VKTR+Q          P    + +V+ FK      G   L  G    LL   +  +
Sbjct: 33  PIDVVKTRIQLE--------PTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 193 VQLAVYSHAKEALSRHVPDGMA----------LYTLASALSSVAVCIAMNPFDVAMTRMY 242
            +   Y    E   +   D M           +Y  ++A++     IA+ P +    R+ 
Sbjct: 85  FKFGGY----ELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLV 140

Query: 243 HH---RGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
                  GL+ G      + +++EG  + Y G    L +  P+ I    + E A
Sbjct: 141 SQPTFANGLFGG----FSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHA 190

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 23/169 (13%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQ 194
           P+ +VKTR+Q L P       G +G  R+++A   + G   L  G    LL    G ++Q
Sbjct: 33  PIDVVKTRIQ-LEPTVYNK--GMVGSFRKIIA---EEGAGALLTGFGPTLL----GYSIQ 82

Query: 195 LAVYSHAKEALSRHVPDGMALYTLASALSSVAVC----------IAMNPFDVAMTRMYHH 244
            A      E   +   D +   T A   +SV +           IA+ P +    R+   
Sbjct: 83  GAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ 142

Query: 245 RGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
                 G +    + +++EG  + Y G    L +  P+ I    + E+A
Sbjct: 143 PT-FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERA 190

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 11/93 (11%)

Query: 5   TDTPVSKLGSFXXXXXXXXXXXTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIY 64
           T T V+ + +F           T T+P +T+KTR+QL           +SG  + + LI 
Sbjct: 209 TSTVVNSISAFMSASLAT----TITSPFDTIKTRMQLD-------PTKFSGFYKTLVLIV 257

Query: 65  RTEGLRGLQQGLACAYAYQILLNGSRLGLYDPL 97
             E  + L  GL      +    G   G+Y+ L
Sbjct: 258 SKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEEL 290

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 23/169 (13%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P  L+KTR+Q     +   L G        L + R  + L++G   + LRT +GSA+ L+
Sbjct: 27  PFDLLKTRLQQ---NKDTTLWG-------TLKEIRSPKQLWRGALPSSLRTSIGSALYLS 76

Query: 197 VYSHAKEAL-----------SRHVPDGMALYTLAS-ALSSVAVCIAMNPFDVAMTRMYHH 244
             +  + A+           S  +P       LAS A +   V     P  +   R Y  
Sbjct: 77  TLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVR-YES 135

Query: 245 RGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQA 293
               Y+   +        EG    + G  A ++R AP+  L + L E+A
Sbjct: 136 TMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKA 184

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 31.6 bits (70), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 7/89 (7%)

Query: 210 PDGMALYTLA-SALSSVAVCIAMNPFDVAMTRMY------HHRGGLYRGPLDCLCKTVRQ 262
           P+   LY LA  A+S       + PFD+   R        +  G  Y+   D L    + 
Sbjct: 6   PNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKT 65

Query: 263 EGFSALYKGHLAQLLRIAPHTILCLTLME 291
           EG    YKG  A L ++ P T +   + E
Sbjct: 66  EGPKGYYKGLTANLFKVIPSTAVSWLVYE 94

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 12/76 (15%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRR-------LVALFKDRGVRGLYQGVDAALLRTGV 189
           P  L++ R Q LA          +G R       L+ + K  G +G Y+G+ A L +   
Sbjct: 30  PFDLLRRRFQVLAMGG-----NELGFRYKSVSDALITIGKTEGPKGYYKGLTANLFKVIP 84

Query: 190 GSAVQLAVYSHAKEAL 205
            +AV   VY   +EA+
Sbjct: 85  STAVSWLVYEVIREAM 100

>Scas_671.1*
          Length = 123

 Score = 31.6 bits (70), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88
           T P +T+KTR+QL+        ++++     + LI + E +  L  GL+     + L  G
Sbjct: 57  TAPFDTIKTRMQLK-------PKVFTNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAG 109

Query: 89  SRLGLYDPL 97
              G+Y+ L
Sbjct: 110 IAWGIYEDL 118

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 65/170 (38%), Gaps = 19/170 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFK----DRGVRGLYQGVDAALLRTGVGSA 192
           P+ +VKTR+Q          P    + +++ FK      G   L  G    LL   +  +
Sbjct: 33  PIDVVKTRIQLE--------PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 193 VQLAVYSHAKE------ALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG 246
            +   Y   K+         + V    ++Y  ++A++     IA+ P +    R+     
Sbjct: 85  FKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPT 144

Query: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRV 296
               G +    + +++EG  + Y G    L +  P+ I    + E+A  V
Sbjct: 145 -FANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEV 193

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 66/164 (40%), Gaps = 11/164 (6%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           PL  + T +Q       P L       +  ++   G+ G + G+++A+      + V   
Sbjct: 31  PLVTITTNLQTKENEARPKL-----ETIKEIYNKNGIIGYFLGLESAVYGMATTNFVYYY 85

Query: 197 VYSH-AKEALSRHVPDGMALY--TLASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPL 253
            Y   AK A +      ++ +   LAS ++     +A NP  VA TRM   +       L
Sbjct: 86  FYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVANTRMTVAKSN--HSTL 143

Query: 254 DCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
             +   V+ +G   L  G L   L +  + I+  T+ EQ   +V
Sbjct: 144 RTVIDIVKTDGPLTLLNG-LKPALVLVSNPIIQYTVYEQLKNLV 186

>Scas_705.9
          Length = 323

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRR----------LVALFKDRGVRGLYQGVDAALLR 186
           PL + KT +Q+    +         +R          L+ +F+ RG+RGLYQG+  ++  
Sbjct: 23  PLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGLRGLYQGMSTSVFS 82

Query: 187 TGVGSAVQLAVYSH 200
             V S      YS 
Sbjct: 83  KFVQSFCYFFWYSF 96

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVA--LFKDRGVRGLYQGVDAALLRTGVGSAV 193
           +PL  +K   Q   P         +G    A  ++ + GVRG +QG  A LLR    +AV
Sbjct: 52  APLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAV 111

Query: 194 QLAVYSHAKEAL 205
           +   Y   +  L
Sbjct: 112 KFVAYEQIRNTL 123

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 137 PLQLVKTRMQ--ALAPRRVPPLPGRMGRRLV-ALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           P ++++ R+Q  AL+P+ +     +    +   +FK+RGVRG + G+    ++     A 
Sbjct: 284 PFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVAC 343

Query: 194 QLAVYSHAK 202
              VY   K
Sbjct: 344 SFFVYERMK 352

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 67/172 (38%), Gaps = 14/172 (8%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195
           SP++ V+ R+Q                 L  + K R  + L +G+   +LR G G     
Sbjct: 139 SPIEHVRIRLQTQTGSGTN---AEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYF 195

Query: 196 AVYS-------HAKEALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMY--HHRG 246
            VY        + +  L R       L  +  ALS  A+ + + P DV  + M   + + 
Sbjct: 196 LVYEALIANQMNKRRGLERKDIPAWKL-CIFGALSGTALWLMVYPLDVIKSVMQTDNLQK 254

Query: 247 GLYRGPLDCLCKTVRQEG-FSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297
             +   +  + KT+   G   A +KG    +LR AP         E A+R++
Sbjct: 255 PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 55/151 (36%), Gaps = 18/151 (11%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P    K R+Q       P     + R+L+A   + G RG Y+G    L+  G   ++Q  
Sbjct: 45  PFDTTKVRLQT---SSTPTTAMEVVRKLLA---NEGPRGFYKGTLTPLIGVGACVSLQFG 98

Query: 197 VYSHAKEALSRHVPD-----GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG----G 247
           V    K        D      +  Y        +      +P +    R+    G     
Sbjct: 99  VNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNA 158

Query: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278
            ++GPL+C+ K +R     AL +G    +LR
Sbjct: 159 EFKGPLECI-KKLRHN--KALLRGLTPTILR 186

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 249 YRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
           Y+  LD + K  R EGF  LY G  A LL
Sbjct: 87  YKHALDVIVKVYRNEGFGGLYHGLSASLL 115

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 7/131 (5%)

Query: 174 RGLYQGVDAALLRTGVGSAVQLAVYSH-AKEALSRHVP-DGMALYTLAS--ALSSVAVCI 229
           + L +G+   ++R G G     A Y     +   +  P + +  + L S  ALS   + +
Sbjct: 180 KALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWL 239

Query: 230 AMNPFDVAMTRMYHH--RGGLYRGPLDCLCKTV-RQEGFSALYKGHLAQLLRIAPHTILC 286
            + P DV  + +         Y+  +    + + +Q G  A +KG +  ++R AP     
Sbjct: 240 TVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAAT 299

Query: 287 LTLMEQALRVV 297
               E  +RV+
Sbjct: 300 FVSFEMTMRVL 310

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
            A  +  VA  +   PFD    R+   +  +  G ++ +   +R EG  A YKG L  LL
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEVVQNLLRNEGALAFYKGMLTPLL 88

Query: 278 RI 279
            +
Sbjct: 89  GV 90

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVS----LIYRTEGLRGLQQGLACAYAYQILL 86
           P+E ++ RLQ+         ++Y    Q++S    +IY+ +G RG   GL+  Y     +
Sbjct: 269 PLEIIRRRLQVS---TLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPM 325

Query: 87  NGSRLGLYDPLRAALG 102
                 +Y+ ++  LG
Sbjct: 326 VACSFFVYERMKWHLG 341

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 59/150 (39%), Gaps = 26/150 (17%)

Query: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAV----------YSHAKE--------ALSRH 208
           L K+ GV   Y+G    LL  G+  +VQ  V          Y+ +K          LSR 
Sbjct: 78  LVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRS 137

Query: 209 VPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHH--RGG--LYRGPLDCLCKTVRQEG 264
               ++ Y +      V      +P +    R+      GG   ++GP DC+ K   Q G
Sbjct: 138 NTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGG 197

Query: 265 FSALYKGHLAQLLRIAPHTILCLTLMEQAL 294
              L +G    ++R A H +    L+ +AL
Sbjct: 198 ---LMRGLFPTMIR-AGHGLGTYFLVYEAL 223

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 2/63 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
            A  +  +A  +   PFD    R+           L+ L   V+ EG  A YKG L  LL
Sbjct: 39  FAGTIGGIAQVLVGQPFDTTKVRL--QTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLL 96

Query: 278 RIA 280
            + 
Sbjct: 97  GVG 99

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86
           T T P +T+KTR+QL+          ++      + I + E +  L  GL+   A +   
Sbjct: 239 TVTAPFDTIKTRMQLEPS-------KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFS 291

Query: 87  NGSRLGLYDPL 97
            G   G+Y+ L
Sbjct: 292 AGIAWGIYEEL 302

>Kwal_33.12988
          Length = 303

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 61/157 (38%), Gaps = 26/157 (16%)

Query: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196
           P  + K R+Q  +       P    R +  L K+ G+RG Y+G    L+  G+  + Q  
Sbjct: 43  PFDITKVRLQTSST------PTTALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFG 96

Query: 197 V------YSHAK---EALSRHVPDGMALYTLASALSSVAVCIAMNPFD----VAMTRMYH 243
                  Y H +   ++ S  +P+    Y     +S  A      P +    +   +   
Sbjct: 97  TNEAMKRYFHKRNNFQSTSLRLPE----YYACGFVSGCANAFLATPIEHVRILLQVQTKS 152

Query: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIA 280
                Y+G +DC+ K +++     L +G    +LR +
Sbjct: 153 RADAEYQGAMDCIKKLLKE---GKLMRGFTPTILRTS 186

>Kwal_47.16930
          Length = 611

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 168 FKDRGVRGLYQGVDAALLRTGVGSAVQLAVY------SHAKEALSRHVPDGMALYTLASA 221
           +  R V  ++ G   A L + VG+ +Q A+Y      ++A E      P  M +  +  A
Sbjct: 418 WNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYA 477

Query: 222 LSSVAVCIAMNP-FDVAMTR 240
           L+  + C+AM   +++A  R
Sbjct: 478 LTGFSECLAMTTGYEIAFER 497

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 29  TNPIETVKTRLQLQGELVAG--VSRLYSGPAQAVSLIYRTEGLRGLQQGL 76
           T P++ +KT LQ++G       + R     ++A S IY+  G +G  +G 
Sbjct: 237 TTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGW 286

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 44/112 (39%), Gaps = 9/112 (8%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMG---RRLVALFKDRGVRGLYQGVDAALLRTGVGSA 192
           +PL  +K   Q   P+      G MG   R    +    G RG +QG  A LLR    +A
Sbjct: 38  APLDRIKILFQTSNPQ-FAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAA 96

Query: 193 VQLAVYSHAKEAL---SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRM 241
           ++   Y   +  +    RH      L  L+ +L+ +       P D+   R+
Sbjct: 97  IKFIAYEQIRSVVIPTWRHESHWRRL--LSGSLAGLCSVFVTYPLDLVRVRL 146

>Kwal_26.7972
          Length = 358

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 136 SPLQLVKTRMQALAPRRVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALLRTGVGSAV 193
           +PL  +K   Q   P  +      MG  R    +    G+RG YQG  A L+R    +A+
Sbjct: 46  APLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAI 105

Query: 194 QLAVYSHAKEAL 205
           +   Y   +  +
Sbjct: 106 KFIAYEQIRHFM 117

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277
            +  +  VA  +   PFD+   R+    G       + +   V+ EGF   YKG +A L+
Sbjct: 29  FSGTVGGVAQVLVGQPFDIIKVRLQTMPGN--ATAWEAITDLVKYEGFMGFYKGTMAPLV 86

Query: 278 RI 279
            +
Sbjct: 87  GV 88

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,041,665
Number of extensions: 223448
Number of successful extensions: 1530
Number of sequences better than 10.0: 201
Number of HSP's gapped: 1212
Number of HSP's successfully gapped: 438
Length of query: 303
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 202
Effective length of database: 13,099,691
Effective search space: 2646137582
Effective search space used: 2646137582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)