Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL022W43342521000.0
Kwal_26.76493623058151e-106
Sklu_2430.113892908171e-106
Scas_717.673433227665e-99
YMR101C (SRT1)3432867571e-97
KLLA0B12848g3612916912e-87
CAGL0K03355g3423006873e-87
Kwal_27.109862852484771e-56
Scas_716.563302594792e-56
CAGL0C04279g2742544509e-53
KLLA0E17259g2752474403e-51
AER003C2742484352e-50
YBR002C (RER2)2862704055e-46
Kwal_26.9380110288740.47
CAGL0L05874g1522131673.5
CAGL0B01144g39177655.1
YBR245C (ISW1)1129113655.7
CAGL0G08217g32645646.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL022W
         (425 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH] complement(3...   813   0.0  
Kwal_26.7649                                                          318   e-106
Sklu_2430.11 YMR101C, Contig c2430 20248-21417                        319   e-106
Scas_717.67                                                           299   5e-99
YMR101C (SRT1) [4059] chr13 complement(468444..469475) cis-Preny...   296   1e-97
KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces...   270   2e-87
CAGL0K03355g complement(304962..305990) similar to sp|Q03175 Sac...   269   3e-87
Kwal_27.10986                                                         188   1e-56
Scas_716.56                                                           189   2e-56
CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces c...   177   9e-53
KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces...   174   3e-51
AER003C [2508] [Homologous to ScYBR002C (RER2) - SH] (638834..63...   172   2e-50
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...   160   5e-46
Kwal_26.9380                                                           33   0.47 
CAGL0L05874g 652940..657508 similar to sp|P22147 Saccharomyces c...    30   3.5  
CAGL0B01144g complement(102067..103242) similar to tr|Q06263 Sac...    30   5.1  
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...    30   5.7  
CAGL0G08217g complement(778823..779803) similar to tr|Q06551 Sac...    29   6.6  

>ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH]
           complement(356930..358231) [1302 bp, 433 aa]
          Length = 433

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/425 (93%), Positives = 397/425 (93%)

Query: 1   MHTTLXXXXXXXXXXXXXXXXTGVLGGSQIRPMVQKGTHKNNDSFPSTAHTSMVEVKNTE 60
           MHTTL                TGVLGGSQIRPMVQKGTHKNNDSFPSTAHTSMVEVKNTE
Sbjct: 1   MHTTLPHAGPRAGPLPGPPVATGVLGGSQIRPMVQKGTHKNNDSFPSTAHTSMVEVKNTE 60

Query: 61  XXXXXXXXXXXXDQVIQLEWHDPIEEAAQELDAARVAANSEPTLRARVKRLVRGEWKQTY 120
                       DQVIQLEWHDPIEEAAQELDAARVAANSEPTLRARVKRLVRGEWKQTY
Sbjct: 61  AATAAGGAQKQADQVIQLEWHDPIEEAAQELDAARVAANSEPTLRARVKRLVRGEWKQTY 120

Query: 121 RNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKL 180
           RNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKL
Sbjct: 121 RNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKL 180

Query: 181 GHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRAT 240
           GHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRAT
Sbjct: 181 GHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRAT 240

Query: 241 NLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMF 300
           NLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMF
Sbjct: 241 NLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMF 300

Query: 301 DLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYI 360
           DLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYI
Sbjct: 301 DLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYI 360

Query: 361 EFSNCMWPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGTYARSLLARRARPVRLEA 420
           EFSNCMWPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGTYARSLLARRARPVRLEA
Sbjct: 361 EFSNCMWPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGTYARSLLARRARPVRLEA 420

Query: 421 LPPPP 425
           LPPPP
Sbjct: 421 LPPPP 425

>Kwal_26.7649
          Length = 362

 Score =  318 bits (815), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 208/305 (68%), Gaps = 6/305 (1%)

Query: 125 KISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEA 184
           +I   +    ++R ++  +Q +L  IL++GPLP HVSFIMDGNRRYAKS+++P+K GHEA
Sbjct: 51  RIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEA 110

Query: 185 GSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKD 244
           G++ L+  L TC+  GI+ VSAYAFSIENFNRP+EE+DTLT +L+ +L + A RA + + 
Sbjct: 111 GALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRES 170

Query: 245 RMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVR 304
            +YG RL VVG+R+ +S  LND+I+ +E +T      T+YIC PYT+RNDIYHA+++   
Sbjct: 171 ELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAE 230

Query: 305 LCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSN 364
            C+       DI    LTN M++   SN+ D+L+RTSGHTRLSDYMLWQ HE   IEFSN
Sbjct: 231 SCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSN 290

Query: 365 CMWPDFTFRTFFTILLKWSFVTALHEARKQ---ERLRRK-LGTYARSLLARRARPVRLEA 420
            +WPDF F  FF +LLKWSF T++   RKQ     LR + L  + R+L   + + V  E 
Sbjct: 291 TLWPDFDFFEFFKMLLKWSFFTSVR--RKQLNNVSLRSQTLSFFKRTLFPFKRKQVSYED 348

Query: 421 LPPPP 425
           LP PP
Sbjct: 349 LPEPP 353

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score =  319 bits (817), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/290 (51%), Positives = 201/290 (69%), Gaps = 12/290 (4%)

Query: 105 RARVKRLVRGEWKQTYRNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIM 164
           R  VK  +  + KQTY+        L    L+  ++  +Q+ LL IL+ GPLP H+SFIM
Sbjct: 59  REDVKCYLDHQKKQTYQ-------YLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIM 111

Query: 165 DGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTL 224
           DGNRRYAKS+ +P+  GHEAG++ L+R L+ CK+ GI+  SAYAFSIENFNRPKEE+DTL
Sbjct: 112 DGNRRYAKSLGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTL 171

Query: 225 TEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTA---- 280
           T +L+ +L + A +A ++KD +YG+   VVGDR+L+S ELNDKIT +E MT  N      
Sbjct: 172 TRLLAEKLDEIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEK 231

Query: 281 -FTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVR 339
              +YIC PYT+RNDIYHAM++ V   +   + ++ IS E LT+AMY    SN+ D+L+R
Sbjct: 232 TSLLYICFPYTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIR 291

Query: 340 TSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILLKWSFVTALH 389
           TSGHTRLSDYMLWQ HE   IEFS  +WP +TF  F+ +L++WSF T+L 
Sbjct: 292 TSGHTRLSDYMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQ 341

>Scas_717.67
          Length = 343

 Score =  299 bits (766), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 149/322 (46%), Positives = 200/322 (62%), Gaps = 4/322 (1%)

Query: 104 LRARVKRLVRGEWKQTYRNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFI 163
           L   +K LV   ++  +  +  +++ LF   +        Q LL+KIL +  +P+HVSFI
Sbjct: 16  LVKEIKHLV---FRTIHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFI 72

Query: 164 MDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDT 223
           MDGNRRYAKS NLPL  GHEAG V L+   + CK+ G++ VSAYAFSIENFNR KEE+DT
Sbjct: 73  MDGNRRYAKSRNLPLNKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDT 132

Query: 224 LTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTV 283
           L E+ S +L +FA RA + +D +YG+RL VVGD +L+S EL DKI  +E +T   + FT 
Sbjct: 133 LMELFSAKLDEFAKRAIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTTDGSDFTF 192

Query: 284 YICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGH 343
           Y+C PYT RNDIYH M++ +   +     S++++ E  T+ MYL   SN+ D+L+RTSGH
Sbjct: 193 YVCFPYTARNDIYHTMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGH 252

Query: 344 TRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILLKWSFVTALHEARKQERLRRKLGT 403
            R SDYMLWQ HE   IEF N  WPDF F   + I+LKWSF   + +  +      K   
Sbjct: 253 NRFSDYMLWQTHENGTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEM-NFSLKTIW 311

Query: 404 YARSLLARRARPVRLEALPPPP 425
           Y       + R  +LE LP PP
Sbjct: 312 YEGPNSKIQNRYTKLEELPEPP 333

>YMR101C (SRT1) [4059] chr13 complement(468444..469475)
           cis-Prenyltransferase (dehydrodolichyl diphosphate
           synthetase), synthesizes long-chain polyprenol compounds
           [1032 bp, 343 aa]
          Length = 343

 Score =  296 bits (757), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 140/286 (48%), Positives = 201/286 (70%), Gaps = 7/286 (2%)

Query: 143 VQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGIE 202
           +QN+L+K L++GP+P+HVSFIMDGNRRYAKS  LP+K GHEAG + L+  L+ CKR G++
Sbjct: 53  LQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVK 112

Query: 203 AVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLSP 262
            VSAYAFSIENFNRPKEE+DTL  + + +L +FA RA + KD +YG+++ +VGD++LLSP
Sbjct: 113 CVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYKDPLYGSKIRIVGDQSLLSP 172

Query: 263 ELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKD--ISTEM 320
           E+  KI  +E++T+    FT++IC PYT+RND+ H + D V       L++K   I+   
Sbjct: 173 EMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVE----DHLENKSPRINIRK 228

Query: 321 LTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILL 380
            TN MY+G +SN+ ++L+RTSGH RLSDYMLWQVHE + IEFS+ +WP+F+F   + ++L
Sbjct: 229 FTNKMYMGFHSNKCELLIRTSGHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMIL 288

Query: 381 KWSFVTALHEA-RKQERLRRKLGTYARSLLARRARPVRLEALPPPP 425
           KWSF + + +   K   L  K+     S+  ++   + L   P PP
Sbjct: 289 KWSFFSTIQKYNEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPP 334

>KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces
           cerevisiae YMR101c SRT1 cis-prenyltransferase homologue,
           start by similarity
          Length = 361

 Score =  270 bits (691), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 187/291 (64%), Gaps = 10/291 (3%)

Query: 142 FVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGI 201
           ++Q  +++IL+MGP+P+H+SFIMDGNRRYAK ++ P+K GH AG   L+  LH C+R  +
Sbjct: 66  WLQMFMVRILRMGPVPRHLSFIMDGNRRYAKKLDQPVKEGHRAGGATLIDILHICRRLNV 125

Query: 202 EAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLS 261
            +VSAYAFSIENFNR  +E+ TL E+L   +  F  RATN KD +YG RL VVGD +LLS
Sbjct: 126 SSVSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATNAKDELYGIRLRVVGDLSLLS 185

Query: 262 PELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEML 321
            EL  KI   E +T+    F +Y+ LPYT+RNDI H+M      C      ++DI+ + L
Sbjct: 186 EELLKKIRNAEKLTRDGQEFVLYLALPYTSRNDIAHSMQVTTDKCINS---NEDITEQAL 242

Query: 322 TNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILLK 381
           T+ MY    SN+ D+L+RTSGHTRLSDYMLWQVHE S IEF +C+WPDF F   + I+LK
Sbjct: 243 TDNMYFEQYSNKCDLLIRTSGHTRLSDYMLWQVHEGSIIEFVDCLWPDFNFWRLYWIMLK 302

Query: 382 WSFVTALHEA-------RKQERLRRKLGTYARSLLARRARPVRLEALPPPP 425
           WSF      A       R + R+  K+         +R + V L++LP  P
Sbjct: 303 WSFYQTWQNASQLPDPVRTRTRVFPKISGALPIETLKRTKRVALDSLPAAP 353

>CAGL0K03355g complement(304962..305990) similar to sp|Q03175
           Saccharomyces cerevisiae YMR101c, hypothetical start
          Length = 342

 Score =  269 bits (687), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 195/300 (65%), Gaps = 11/300 (3%)

Query: 132 QFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMR 191
            F  + ++   +Q +L+  L+ GP+P HV+FIMDGNRR+AKS ++PL+ GHEAG   L+ 
Sbjct: 40  SFYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLT 99

Query: 192 TLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARL 251
            ++ CK  G++ +SAYAFSIENFNRP+EE++TL  +   +L +FA +A + KD +YG+ L
Sbjct: 100 LVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSL 159

Query: 252 LVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLV-RLCQAGA 310
            +VGDR+L+SPEL ++I  +E +T+++  F +YIC PYT+RNDI+  +  +  +  Q+  
Sbjct: 160 RIVGDRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNI 219

Query: 311 LDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCMWPDF 370
           +DS ++S    T +M+    S+  DIL+RTSGH RLSD+MLWQV+E + +EFS  +WP F
Sbjct: 220 IDS-NLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQF 278

Query: 371 TFRTFFTILLKWSF-----VTALHEARKQERLRRKLGTYARSLLARRARPVRLEALPPPP 425
            F   + I+L+WS      +  ++   K  +   KL    +++L    + +  E LP PP
Sbjct: 279 NFFQMYLIILRWSMFKMFQIYNMNNVSKHSKFGSKLYKPYKTIL----KYIFSERLPDPP 334

>Kwal_27.10986
          Length = 285

 Score =  188 bits (477), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 152/248 (61%), Gaps = 5/248 (2%)

Query: 139 VVNFVQNLLLKILQM-GPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCK 197
           V+NF +NL  +++Q+ G +P+HV  IMDGNRR+AK  ++ +K GH AG  ++ R L  C 
Sbjct: 13  VLNFCKNLFSRVIQVSGNVPRHVGLIMDGNRRWAKLKHVEIKEGHNAGFHSMSRALELCY 72

Query: 198 RAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDR 257
            AG+   + +AFSIENF R   E+++L  +    ++         +   +G ++ V+GDR
Sbjct: 73  EAGVSTATVFAFSIENFKRSSAEVESLMNLARSGIRQVVQNGEMAEK--FGIKINVIGDR 130

Query: 258 ALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDIS 317
           +LL  ++  ++   E++TK NT   + IC PYT R+++ H++  +V   Q G L++ DI+
Sbjct: 131 SLLPADVLREVETAEEITKANTRAVLNICFPYTGRDELLHSIRGVVNEAQCGNLNTSDIN 190

Query: 318 TEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQS-YIEFSNCMWPDFTFRTFF 376
              +   +Y G  S   D+L+RTSG TRLSD+++WQV  +   IEF +C+WPDF  R   
Sbjct: 191 EATIDKFLYTGG-SPPVDLLIRTSGVTRLSDFLIWQVSRKDVVIEFLDCLWPDFGSRQMA 249

Query: 377 TILLKWSF 384
            +LL+++F
Sbjct: 250 WLLLRFAF 257

>Scas_716.56
          Length = 330

 Score =  189 bits (479), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 150/259 (57%), Gaps = 4/259 (1%)

Query: 138 MVVNFVQNLLLKILQMG-PLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTC 196
           + + +++N+  + +++   +P+HV FIMDGNRRYA+  +L +K GHEAG   + + L  C
Sbjct: 48  LTLKWIKNIFSRTIRVSRNVPRHVGFIMDGNRRYARRNHLQVKEGHEAGFFTMSKILELC 107

Query: 197 KRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGD 256
             +G+E  + YAFSIENF R   E+D L ++   R++     A+      YG ++ ++GD
Sbjct: 108 YESGVECATVYAFSIENFKRSPHEVDALMKLAKDRIRQIV--ASGEMAEKYGIKVRIIGD 165

Query: 257 RALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDI 316
            +LL  EL D +    ++TK+N    + IC PYT R +I H+M ++V L QA + D K I
Sbjct: 166 LSLLDKELRDDMNNAMEITKNNKRAVLNICFPYTGREEIVHSMQNVVELAQANSDDPKFI 225

Query: 317 STEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSY-IEFSNCMWPDFTFRTF 375
             E L NA     +    D+L+RTSG  RLSD+M+WQV  +   IE  +C+WPDF     
Sbjct: 226 IDEQLINANLYTGDQPPLDLLIRTSGMVRLSDFMVWQVSNKGVAIELIDCLWPDFGPLRM 285

Query: 376 FTILLKWSFVTALHEARKQ 394
             ILLK+ F  +     K+
Sbjct: 286 AWILLKFVFQKSFSNRNKK 304

>CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2, hypothetical start
          Length = 274

 Score =  177 bits (450), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 147/254 (57%), Gaps = 8/254 (3%)

Query: 142 FVQNLLLKILQMG-PLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAG 200
             +NL+ + L +   +P+H+ FIMDGNRRYAK   +  K GHEAG  ++ + L  C  AG
Sbjct: 12  LAKNLISRTLSVSNCVPRHIGFIMDGNRRYAKKKQMESKEGHEAGFRSMSKILELCYEAG 71

Query: 201 IEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALL 260
           ++  + +AFSIENF R   E+D +  +   R++    R      + YG R+ V+GD +LL
Sbjct: 72  VDTATVFAFSIENFKRSAYEVDAIMSLARERIRQI--REHGELAQKYGVRIRVIGDISLL 129

Query: 261 SPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEM 320
             +L  +I    ++T++NT  T+ IC+PYT R +IYH+M  ++      +  SK+IS E+
Sbjct: 130 DKDLLKEIKNTMELTRNNTRATLNICMPYTGREEIYHSMKTVL---DDDSYSSKNISEEI 186

Query: 321 LTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSY-IEFSNCMWPDFTFRTFFTIL 379
           +   +Y  A     D+L+RTSG TRLSD+MLWQ       IEF +C+WP+F       IL
Sbjct: 187 IDEHLYT-AGQPPLDLLIRTSGVTRLSDFMLWQTCSNDVMIEFIDCLWPEFGPFRMAWIL 245

Query: 380 LKWSFVTALHEARK 393
           LK++F       RK
Sbjct: 246 LKFAFHKNFSSGRK 259

>KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2 cis-prenyltransferase, a key
           enzyme in dolichol synthesis, start by similarity
          Length = 275

 Score =  174 bits (440), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 151/247 (61%), Gaps = 5/247 (2%)

Query: 140 VNFVQNLLLKILQMG-PLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKR 198
           +  V+  L K+++    +PQHV+FIMDGNRR+AK  N+ +  GH AG  ++ R L  C  
Sbjct: 14  LEMVKTTLAKVIRSSDKVPQHVAFIMDGNRRFAKKNNMEVNEGHNAGFESMCRILELCYE 73

Query: 199 AGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRA 258
           +G++  + +AFSIENF R   E++ L E+   +++  +     L ++ YG ++ ++GDR+
Sbjct: 74  SGMKVATVFAFSIENFKRSTFEVNWLMELAKDKIKQISQHG-ELAEQ-YGIKVQIIGDRS 131

Query: 259 LLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDIST 318
           LL  ++  ++   E++T +N+   + IC PYT R +I H++  +++    G +D +DI  
Sbjct: 132 LLPADVLKEVELAEEITMNNSRAVLNICFPYTGREEIVHSIQGIMKETAMGEIDYRDIDE 191

Query: 319 EMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSY-IEFSNCMWPDFTFRTFFT 377
           + + + +Y        ++L+RTSG TRLSD++LWQ+  +   IE  +C+WP+FT  +   
Sbjct: 192 QTIEDHLYTQGQP-PVELLIRTSGVTRLSDFLLWQLSNRGCTIELVDCLWPEFTPFSMLK 250

Query: 378 ILLKWSF 384
           IL+K++F
Sbjct: 251 ILIKFAF 257

>AER003C [2508] [Homologous to ScYBR002C (RER2) - SH]
           (638834..639658) [825 bp, 274 aa]
          Length = 274

 Score =  172 bits (435), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 149/248 (60%), Gaps = 8/248 (3%)

Query: 139 VVNFVQNLLLKILQM-GPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCK 197
           +++ ++++ + +L+  G +P+HV FIMDGNRRYAK  N+ ++ GH AG +++ + L  C 
Sbjct: 13  LISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRYAKKHNIEVREGHSAGFMSMNKVLELCY 72

Query: 198 RAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDR 257
            +G+   + +AFS++NF R   E+D+L E+   R+         L ++ YG  + ++GDR
Sbjct: 73  ESGVTTATVFAFSVDNFRRSAFEVDSLMELAKERVMQITQHG-ELAEQ-YGIHVRIIGDR 130

Query: 258 ALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDIS 317
           +LL  ++ +++   E  T+ NT   + +C+PYT R +I HAM   +   Q+   D   I+
Sbjct: 131 SLLPADVQEEMARAEKATEANTRAVLNVCIPYTARGEILHAMKGTIADAQS---DGAPIT 187

Query: 318 TEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQS-YIEFSNCMWPDFTFRTFF 376
              L   MY G      D+L+RTSG +RLSD++LWQV ++   IE  +C+WPDF   T  
Sbjct: 188 EADLDAHMYTGGLPP-LDLLIRTSGVSRLSDFLLWQVCQKGVVIELLSCLWPDFGPLTMA 246

Query: 377 TILLKWSF 384
            ILL+++F
Sbjct: 247 WILLRYAF 254

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score =  160 bits (405), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 153/270 (56%), Gaps = 15/270 (5%)

Query: 138 MVVNFVQNLLLKILQMG-PLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHTC 196
            V+ + +N+  + L+    +P+HV FIMDGNRR+A+   + +K GHEAG V++ R L  C
Sbjct: 12  FVLKWTKNIFSRTLRASNCVPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELC 71

Query: 197 KRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGD 256
             AG++  + +AFSIENF R   E+++L  +   R++    R   L  + YG R+ ++GD
Sbjct: 72  YEAGVDTATVFAFSIENFKRSSREVESLMTLARERIRQITERG-ELACK-YGVRIKIIGD 129

Query: 257 RALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFD-LVRLCQAGALDSKD 315
            +LL   L + +    + TK+N   T+ IC PYT R +I HAM + +V+  +  A+D   
Sbjct: 130 LSLLDKSLLEDVRVAVETTKNNKRATLNICFPYTGREEILHAMKETIVQHKKGAAIDEST 189

Query: 316 ISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSY-IEFSNCMWPDFTFRT 374
           + + + T      A     D+L+RTSG +RLSD+++WQ   +   IE  +C+WP+F    
Sbjct: 190 LESHLYT------AGVPPLDLLIRTSGVSRLSDFLIWQASSKGVRIELLDCLWPEFGPIR 243

Query: 375 FFTILLKWSFVTALHEARKQERLRRKLGTY 404
              ILLK+SF    H++   +  R + G Y
Sbjct: 244 MAWILLKFSF----HKSFLNKEYRLEEGDY 269

>Kwal_26.9380
          Length = 1102

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 197 KRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGD 256
           K+  ++A+++Y  +++  N      D +TE++ + L     R+T     +  + + + G 
Sbjct: 762 KQTYVDALTSYNLALDEVN------DKITEIMHKVLP-LKERSTEASASLQASEMEISGL 814

Query: 257 RALLSPELNDKITYIEDMTKHNTAFTVY 284
           R  +S   +   TY+ D+ KH T+ T Y
Sbjct: 815 RESISSMSSKLDTYLADIEKHKTSITAY 842

>CAGL0L05874g 652940..657508 similar to sp|P22147 Saccharomyces
            cerevisiae YGL173c KEM1 multifunctional nuclease, start
            by similarity
          Length = 1522

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 19/131 (14%)

Query: 179  KLGHEAGSVALMRTLHT--CKRAGIEAVSAYA----FSIENFNRPKEEIDTLTEMLSRRL 232
            KL   +G + +M+ L      RA +  +        FS ENF     E ++LT+   R  
Sbjct: 1067 KLSKTSGDIPVMQDLFPDLSSRAIMSMLDDIKQWIKFSTENFVVVSLESNSLTKASIRAC 1126

Query: 233  QDFANRATNLKDRMYGARLLVVGDRALLSP------------ELNDKITYIEDMTKHNTA 280
            +D+  + ++  ++    +L  V   A+LSP            +L D++ YI+D  K    
Sbjct: 1127 EDYIEKYSSSIEQHETKQLAKVPREAVLSPRVSFSQLRAQKFDLGDRVVYIQDSGKV-PL 1185

Query: 281  FTVYICLPYTT 291
            F+    + YTT
Sbjct: 1186 FSKGTVVGYTT 1196

>CAGL0B01144g complement(102067..103242) similar to tr|Q06263
           Saccharomyces cerevisiae YLR181c, start by similarity
          Length = 391

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 183 EAGSVALMRTLHTCKRAGIEAVSAY--AFSIENFNRPKEEIDTLTE---MLSRRLQDFAN 237
           ++GSV L+ T    +RAG+  V+ Y   +++E   +  E  D +TE   ML  +++ F  
Sbjct: 2   DSGSVRLVATAQDMERAGLAVVAYYLRLYAVEKLLQLSERSDEVTEAATMLLDQIETFKQ 61

Query: 238 RATNLKD-RMYGARLLV 253
             T  +D    G ++L+
Sbjct: 62  EVTGSEDSEADGVKVLL 78

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
            ATP-dependent chromatin remodeling factor, has strong
            similarity to Drosophila nucleosome remodeling factor
            ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 45/113 (39%), Gaps = 19/113 (16%)

Query: 201  IEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALL 260
            IE    Y   IEN     + +    E L R+L ++ N   +LK +               
Sbjct: 937  IEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKH-------------- 982

Query: 261  SPELNDKITYIEDMTKHNTAFTVYICLPYT-TRNDIYHAMFDLVRLCQAGALD 312
             P  N+K TY E+  +    F + +   Y   R+D+Y  + D +R C    LD
Sbjct: 983  PPSSNNKRTYSEEEDR----FILLMLFKYGLDRDDVYELVRDEIRDCPLFELD 1031

>CAGL0G08217g complement(778823..779803) similar to tr|Q06551
           Saccharomyces cerevisiae YLR246w ERF2, hypothetical
           start
          Length = 326

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 154 GPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVAL-MRTLHTCK 197
           G LP+++    D  + Y  ++ LP   G  AG+ ++ ++  HTCK
Sbjct: 120 GVLPRNIHMHKDTPQEYFNNVTLPYGAGGSAGNASVTLKYCHTCK 164

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,080,245
Number of extensions: 461739
Number of successful extensions: 1261
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1261
Number of HSP's successfully gapped: 20
Length of query: 425
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 321
Effective length of database: 12,995,837
Effective search space: 4171663677
Effective search space used: 4171663677
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 63 (28.9 bits)