Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL021C2392177491e-101
KLLA0B12870g20517661.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL021C
         (235 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH] (358274..358...   293   e-101
KLLA0B12870g complement(1123581..1124198) weakly similar to sp|P...    30   1.3  

>ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH]
           (358274..358993) [720 bp, 239 aa]
          Length = 239

 Score =  293 bits (749), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 150/217 (69%)

Query: 1   MDLPPSIACSCTGGRSFRHSNKQPSYTKLNGAKCENTPAQGHTMFQLELSGPLRDKLLQX 60
           MDLPPSIACSCTGGRSFRHSNKQPSYTKLNGAKCENTPAQGHTMFQLELSGPLRDKLLQ 
Sbjct: 1   MDLPPSIACSCTGGRSFRHSNKQPSYTKLNGAKCENTPAQGHTMFQLELSGPLRDKLLQA 60

Query: 61  XXXXXXXXXXXXXXXXWVTFGSLVVLCERGAATARETQALLGSLLLRPRAARSSNYSDEF 120
                           WVTFGSLVVLCERGAATARETQALLGSLLLRPRAARSSNYSDEF
Sbjct: 61  GGGAAAAEVKVAAARGWVTFGSLVVLCERGAATARETQALLGSLLLRPRAARSSNYSDEF 120

Query: 121 XXXXXXXXXXXXEDEYRALTGGMQQEQQRHGFGSAAREVREQXXXXXXXXXXXXXXXXXX 180
                       EDEYRALTGGMQQEQQRHGFGSAAREVREQ                  
Sbjct: 121 RAQQQRLRAAAAEDEYRALTGGMQQEQQRHGFGSAAREVREQLAAVANVVLTVVGVAYGV 180

Query: 181 XXXXXXXXXXXXXXXXXXXXCGLTALVADVAMYNVYH 217
                               CGLTALVADVAMYNVYH
Sbjct: 181 WWVARAAGVGAEARVLLALGCGLTALVADVAMYNVYH 217

>KLLA0B12870g complement(1123581..1124198) weakly similar to
           sp|P32341 Saccharomyces cerevisiae YKL119c VPH2
           H+-ATPase assembly protein singleton, start by
           similarity
          Length = 205

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 13/17 (76%)

Query: 201 CGLTALVADVAMYNVYH 217
            GL  L ADVAMYNVY+
Sbjct: 165 SGLLVLTADVAMYNVYN 181

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,375,016
Number of extensions: 123054
Number of successful extensions: 177
Number of sequences better than 10.0: 2
Number of HSP's gapped: 175
Number of HSP's successfully gapped: 2
Length of query: 235
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 137
Effective length of database: 13,203,545
Effective search space: 1808885665
Effective search space used: 1808885665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)