Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL016C1328130367240.0
YOR296W1289126720520.0
Scas_665.251272120516660.0
CAGL0G07579g1277129615660.0
Kwal_55.2030271070013381e-169
KLLA0B13002g1377131410361e-119
Kwal_47.168951506132970.004
Scas_703.33150958870.063
CAGL0J08591g119660820.20
AER148W1502140820.24
CAGL0C05049g118155810.32
KLLA0B04708g149066800.37
CAGL0G08800g1020187770.81
AGR356W95642713.7
Scas_686.592853714.5
YOR086C118617714.7
KLLA0C13860g117349705.3
Scas_662.23115851697.2
CAGL0L11440g153068697.5
Scas_449.1636120697.6
AER398W115091689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL016C
         (1303 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3...  2594   0.0  
YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containi...   795   0.0  
Scas_665.25                                                           646   0.0  
CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces c...   607   0.0  
Kwal_55.20302                                                         520   e-169
KLLA0B13002g complement(1134173..1138306) weakly similar to sgd|...   403   e-119
Kwal_47.16895                                                          42   0.004
Scas_703.33                                                            38   0.063
CAGL0J08591g complement(847505..851095) similar to tr|Q12466 Sac...    36   0.20 
AER148W [2652] [Homologous to ScYML072C - SH] complement(914026....    36   0.24 
CAGL0C05049g 475910..479455 similar to sp|Q12451 Saccharomyces c...    36   0.32 
KLLA0B04708g complement(425404..429876) similar to sp|Q03640 Sac...    35   0.37 
CAGL0G08800g complement(835307..838369) similar to sp|P40469 Sac...    34   0.81 
AGR356W [4667] [Homologous to ScYHR073W (OSH3) - SH] complement(...    32   3.7  
Scas_686.5                                                             32   4.5  
YOR086C (TCB1) [4892] chr15 complement(483220..486780) Protein c...    32   4.7  
KLLA0C13860g 1189822..1193343 similar to sgd|S0005612 Saccharomy...    32   5.3  
Scas_662.23                                                            31   7.2  
CAGL0L11440g 1213237..1217829 similar to sp|Q03640 Saccharomyces...    31   7.5  
Scas_449.1                                                             31   7.6  
AER398W [2898] [Homologous to ScYJR090C (GRR1) - SH] complement(...    31   9.4  

>ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3987
            bp, 1328 aa]
          Length = 1328

 Score = 2594 bits (6724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1252/1303 (96%), Positives = 1252/1303 (96%)

Query: 1    MRLREASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLKVVLLEYINEPRFRRQY 60
            MRLREASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLKVVLLEYINEPRFRRQY
Sbjct: 1    MRLREASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLKVVLLEYINEPRFRRQY 60

Query: 61   QRLNDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEGNALKKVRPILEGRLSDIA 120
            QRLNDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEGNALKKVRPILEGRLSDIA
Sbjct: 61   QRLNDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEGNALKKVRPILEGRLSDIA 120

Query: 121  IGKYKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVED 180
            IGKYKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVED
Sbjct: 121  IGKYKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVED 180

Query: 181  TQKELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPA 240
            TQKELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPA
Sbjct: 181  TQKELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPA 240

Query: 241  VGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIK 300
            VGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIK
Sbjct: 241  VGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIK 300

Query: 301  HSIKSNGGFTADDFPTKELYEQWKEYELHAIDDLINRLEENKARHNESLSKKAGVKVIPA 360
            HSIKSNGGFTADDFPTKELYEQWKEYELHAIDDLINRLEENKARHNESLSKKAGVKVIPA
Sbjct: 301  HSIKSNGGFTADDFPTKELYEQWKEYELHAIDDLINRLEENKARHNESLSKKAGVKVIPA 360

Query: 361  NSRGMLVKLLCILLEREQPSQTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTL 420
            NSRGMLVKLLCILLEREQPSQTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTL
Sbjct: 361  NSRGMLVKLLCILLEREQPSQTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTL 420

Query: 421  LDDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHL 480
            LDDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHL
Sbjct: 421  LDDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHL 480

Query: 481  MLSGIYSKPKPKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDYY 540
            MLSGIYSKPKPKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDYY
Sbjct: 481  MLSGIYSKPKPKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDYY 540

Query: 541  ASLVKQAKKEPFGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLAD 600
            ASLVKQAKKEPFGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLAD
Sbjct: 541  ASLVKQAKKEPFGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLAD 600

Query: 601  LPEFINDAEQNALAENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYL 660
            LPEFINDAEQNALAENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYL
Sbjct: 601  LPEFINDAEQNALAENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYL 660

Query: 661  VRLCADTCVRVHEVIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEY 720
            VRLCADTCVRVHEVIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEY
Sbjct: 661  VRLCADTCVRVHEVIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEY 720

Query: 721  EIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTAERMK 780
            EIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTAERMK
Sbjct: 721  EIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTAERMK 780

Query: 781  NTWLFNEMRNALMPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTIS 840
            NTWLFNEMRNALMPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTIS
Sbjct: 781  NTWLFNEMRNALMPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTIS 840

Query: 841  KHQVKVEDKKDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKV 900
            KHQVKVEDKKDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKV
Sbjct: 841  KHQVKVEDKKDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKV 900

Query: 901  VRKTVNPMWDELFELVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSD 960
            VRKTVNPMWDELFELVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSD
Sbjct: 901  VRKTVNPMWDELFELVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSD 960

Query: 961  GYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVN 1020
            GYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVN
Sbjct: 961  GYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVN 1020

Query: 1021 FSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKV 1080
            FSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKV
Sbjct: 1021 FSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKV 1080

Query: 1081 MLQAWNTILHSADALLLPNLSCAXXXXXXXXXXXXTLWENXXXXXXXXXXXXXXXXXTIP 1140
            MLQAWNTILHSADALLLPNLSCA            TLWEN                 TIP
Sbjct: 1081 MLQAWNTILHSADALLLPNLSCARSRKKVMSSKSMTLWENAMSMAKGDSSDSAAAAATIP 1140

Query: 1141 GFGSALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADEL 1200
            GFGSALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADEL
Sbjct: 1141 GFGSALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADEL 1200

Query: 1201 QAEVERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSSXXXXXXXXXXX 1260
            QAEVERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSS           
Sbjct: 1201 QAEVERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSSRRKRAQVAAAV 1260

Query: 1261 XXLEHDPLEVAAVTQDXXXXXXXXXGRAAYVQDTLSRRAELAK 1303
              LEHDPLEVAAVTQD         GRAAYVQDTLSRRAELAK
Sbjct: 1261 RQLEHDPLEVAAVTQDILLRILLLRGRAAYVQDTLSRRAELAK 1303

>YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containing a
            C2 domain, which may be involved in calcium-dependent
            phospholipid binding, has low similarity to
            uncharacterized C. albicans Orf6.5092p [3870 bp, 1289 aa]
          Length = 1289

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1267 (36%), Positives = 732/1267 (57%), Gaps = 68/1267 (5%)

Query: 4    REASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLKVVLLEYINEPRFRRQYQRL 63
            R  S  SS  SD  V+  +PS+      ++  +++Y   LK++LL+YINEPRF+      
Sbjct: 3    RTVSTLSSTVSDVSVE--IPSICNVINTELPTSDVYLYTLKLILLDYINEPRFKEAALLS 60

Query: 64   NDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEGNALKKVRPILEGRLSDIAIGK 123
            N   T  +   +    +++  +K       + + + +E + ++    IL+G+L+ I+  K
Sbjct: 61   NRTGTSRVLSDKTNHQQTQHGKKLVV----DKQDDMSERDIVQATLRILKGKLAQISGNK 116

Query: 124  YKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQK 183
                ++   +S++K+Y  + LD + ++    MG+ EE++  F   AS E+ K+ +++++ 
Sbjct: 117  NLAPNEMHWKSIVKMYYSM-LDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRD 175

Query: 184  ELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYTDSFKPEDGEGSI---RSRSSQGVP- 239
            EL+ +V+ FID++ID+L     S    + +L  Y  + K   GE ++   R+ S   VP 
Sbjct: 176  ELFSEVAYFIDLVIDVLPD---SCANIIKRLLDYKINLKK--GETTVKKKRAASPATVPQ 230

Query: 240  --AVGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELD 297
              ++ G+ I    +P+F V +ISH  Y M+LF  DE +   DV+ +KD   N  +  EL 
Sbjct: 231  YRSISGSTIS-NKQPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELR 289

Query: 298  AIKHSIKS-NGGFTADDFPTKELYEQWKEYELHAIDDLINRLE--ENKARHNESLSKKAG 354
             ++  IK  NG  TA DF +   Y  WK YEL  I +L++R E  E    H        G
Sbjct: 290  YLRKKIKKDNGTLTASDFSSDREYNLWKNYELLEIANLMDRFEIGEKVTSH--------G 341

Query: 355  VKVIPANSRGMLVKLLCILLEREQPSQTSP--LSSDAQFLISKCARYWRLDYFSTRVSLF 412
             ++IP +++ + V+L+ ++L++E  +  +   LS +A F   K ARYWR++Y ST  SL 
Sbjct: 342  NRLIPKDAKSVFVRLIGLVLKKECSNAVNAINLSQEALFFFHKSARYWRIEYPSTISSLV 401

Query: 413  YTAYNLTLLDDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFI 472
            Y+A NL++L D E+     E+L    ++K    S+   + + WNA DR+ W  NL HT  
Sbjct: 402  YSAANLSVLGDEELNIPITENLFSVIRNKYL-CSEDNLDPSAWNAQDRYLWAANLFHTTD 460

Query: 473  SCMNVLHLMLSGIYSKPKPKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCL 532
              M  ++ +L+ I+S  KPKFSPVL+ YY+ +  DP+M  Y          W+K  K+ L
Sbjct: 461  QSMRTINNLLTAIFSGTKPKFSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTL 520

Query: 533  THTSEDYYASLVKQA-KKEPFGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAV 591
               SEDY+ SL++   K     + ++Q++ E I++ +K IQKRY KPLLDEI++ R CAV
Sbjct: 521  FKASEDYFVSLLQDMLKANAIEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAV 580

Query: 592  VTIQKFLADLPEFINDAEQNALAENTEVL-PAVALEAYRAIQELKDIWVQLKPKDLSFNT 650
               + + +D    I  AE++ +    + L P  AL+ Y  ++EL+ I++Q+KPK   F  
Sbjct: 581  FLCEVYGSDSLNLIKTAEKSTMKMTGQKLGPIDALDMYDVLKELRQIYLQVKPKG-KFFF 639

Query: 651  AVHNPFYKYLVRLCADTCVRVHEVIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQI 710
             + N F KYL RLC D    V +VI +SL+ E W+P+++  H+S SVLDIFKM+NES  +
Sbjct: 640  NLENYFIKYLTRLCDDVSRNVQKVIKSSLESENWQPVNDQDHFSRSVLDIFKMINESTSM 699

Query: 711  FEKLQWENEYEIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQAD----SALHSDDNSY 766
             EK  W+NE+++A+  T +LK+FSDG+  Y+A+++ +I+ DL + D    S   SD  S 
Sbjct: 700  LEKFGWQNEFQLAQMITVILKAFSDGMLSYSAQLMELIQRDLQEGDEPSYSLESSDTRSS 759

Query: 767  ENLITLQGTAERMKNTWLFNEMRNAL--MPALAEPPETYEFKQRTCVCLNNLSEMMQKIN 824
             +L       E+ +++ LF +++N +   P +  P   Y+FK+RTCV LN+L + +  + 
Sbjct: 760  LSLNNANVNHEKSRSSRLFEDLKNVVKSTPKMVAPAP-YQFKKRTCVLLNDLDKTLFLLE 818

Query: 825  DLEETVNAEKISDTISKHQV--KVEDK-KDRSDKAVPQLYTIRIVKAENILSFNSDGSSN 881
              EE  +  KIS  I+++     +ED  K   D+ + Q+YT+RI+ AENI  F+  G SN
Sbjct: 819  SFEEKADPSKISSVIAQYHSSHNLEDNGKSFDDQNMKQVYTLRIIGAENIKGFSKTGLSN 878

Query: 882  SAVTLVDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGEARMISATVWHH-SAKINPVS 940
            + V++ + ++QREI  TK+V +++ P WDE F    P G++  I  T+WHH  +++  ++
Sbjct: 879  TYVSMRNITLQREIGTTKIVARSITPKWDEEFVFESPFGKSNDIMFTIWHHPHSRLKNLA 938

Query: 941  SYKVCGKCSLLLDPTVYRSDGYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRAL 1000
               +CGK ++   P   + DG+P + +L L+ QG L  Q+SLESE+ DA+  +GR +R+ 
Sbjct: 939  EDDLCGKANMKFTPRKLKDDGFPIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSF 998

Query: 1001 SRACDRAIGLMVSKFTAFVNFSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDY 1060
            SR+ DRAI L+V+KF+ F+ F+ SR  LKTV         G A      VYDAILPLFDY
Sbjct: 999  SRSRDRAINLIVNKFSDFIAFAFSRTTLKTV-----CGHHGSALASDEAVYDAILPLFDY 1053

Query: 1061 LNSNLAILATELTRSLLHKVMLQAWNTILHSADALLLPNLSCAXXXXXXXXXXXXTLWEN 1120
            LN+NL ILA+EL++ LL  VML+AWN +L +AD LLLP L+ A            +LWEN
Sbjct: 1054 LNANLNILASELSQRLLFMVMLRAWNLVLENADLLLLPALNSAKVNILRSAKK--SLWEN 1111

Query: 1121 XXXXXXXXXXXXXXXXXTIPGFGSALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKN 1180
                             T+ G+G  LT  EI+ VF WL ALCVDFFHN GEGPPL +LKN
Sbjct: 1112 TLSTTK-----------TVSGYGRPLTQAEIEAVFKWLDALCVDFFHNKGEGPPLAELKN 1160

Query: 1181 QHYQNLLLVPVFYDKAADELQAEVERLMPFYEQYLDRRNYFDFGRHTASRPALPKGSLAR 1240
            ++YQN+LL+P FYDK+  EL+ EV+RL+P YE+YL    +F   +   +      G+++R
Sbjct: 1161 EYYQNILLIPAFYDKSVSELKDEVQRLIPLYEEYL---RWFYLKKTPITFTNKSAGTISR 1217

Query: 1241 KDSVWAH 1247
            K S+ A+
Sbjct: 1218 KKSLVAN 1224

>Scas_665.25
          Length = 1272

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1205 (33%), Positives = 660/1205 (54%), Gaps = 97/1205 (8%)

Query: 32   DVSKAELYQSLLKVVLLEYINEPRFRRQYQRLNDVETGELFPRERQPVR------SRDDR 85
            D  +   Y+  L++VLLEY +EPRF++QY     ++ G L   ER+ V       ++ +R
Sbjct: 30   DEERRTAYRHALQIVLLEYSHEPRFQKQY-----MQQGAL--SERKDVSNITLSMTQSNR 82

Query: 86   K-RATWFWPNGELESTEGNALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDLYL 144
               AT F        +E  AL  V  +L   +  I I +  ++++ LRRS  + Y ++  
Sbjct: 83   DPMATTF--------SEEQALNYVLTLLREYIYKIIIREVDLQNENLRRSYSRFYGNILA 134

Query: 145  DPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLARCE 204
                S +       EELIM F+KAAS E+ KL ++D  KE+ ++  +F++ L+ L+ +  
Sbjct: 135  GGPPSAMT-----VEELIMQFSKAASNELCKLPIKDVSKEVTKETEEFVNFLLSLVPK-- 187

Query: 205  VSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPAVGGNCIEVTVKPAFTVSEISHSVY 264
               P    K+++  D  K      + R    Q +     N      +P FTVS I+H+ Y
Sbjct: 188  -EAPTLSQKIKNIRDIQKVRKPVSNRRPLPRQQLDGTQIN------RPNFTVSSITHAKY 240

Query: 265  IMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIKHSIK-SNGGFTADDFPTKELYEQW 323
               LF V++     D+  +   + +  Y +EL  + +++K   G  + +DF  +  Y  W
Sbjct: 241  FANLFEVEDDYLQRDIDVILPNVTSKIYCWELSRLSNNLKKGKGSLSRNDFHNEREYNSW 300

Query: 324  KEYELHAIDDLINRLEENKARHNESLSKKAGVKVIPANSRGMLVKLLCILLEREQP--SQ 381
            K YE   I   ++R        +  L+      +IP   R   V LLC +  +E P  S+
Sbjct: 301  KNYEQGEIASQLDRF----GVESRDLASMNFPNIIPQYPRETFVALLCFVFRKECPADSK 356

Query: 382  TSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTLLDDGEMLKDDIEHLVQAAQSK 441
            +  LS  A F ++KC++YWR+D+ +T  +L Y+A N ++L    +  +  E+L    + +
Sbjct: 357  SINLSQAAMFFLTKCSKYWRVDFPTTLAALVYSAANKSILSQDFLNPELTENLFSMIRRR 416

Query: 442  GAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHLMLSGIYSKPKPKFSPVLNIYY 501
              + SD   +++ WN  DR QW++NL  T   C+N L  ++S +Y +PKP FSP+L  Y+
Sbjct: 417  ILK-SDDNIDTSIWNTTDRDQWILNLLTTGKQCINSLCGLISQLYEEPKPTFSPILRFYF 475

Query: 502  NYVKTDP----LMIQYNFPETDFYGKWMKQLKRCLTHTSEDYYASLVKQAKKE---PFGM 554
             Y++ DP    L+    F E     KW+K+L++ L  TS D+Y S +++  ++    F  
Sbjct: 476  QYIEEDPFISSLLESNKFTEK---SKWIKKLRKKLKDTSVDFYMSQIRKIPRDNTIEFQH 532

Query: 555  YSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLADLPEFINDAEQNALA 614
            Y  QD+ E I +Q+K++QK+Y KPLLD INI  +CA + ++ F  D+ + +   E+    
Sbjct: 533  Y--QDVVESIYRQIKLLQKKYSKPLLDMINIPVSCADILLKVFCTDVVKILGTIEKKGKK 590

Query: 615  ENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYLVRLCADTCVRVHEV 674
            ++  + P+ AL+ Y+++++L+ I+VQ++ ++  F   + + F KYL RLC +  +   ++
Sbjct: 591  DS--LGPSNALDLYKSMKDLRFIYVQVETEE-DFPIKLEDFFNKYLRRLCNEATLTEDKI 647

Query: 675  IHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSFS 734
            I  SLK+E WE I +    S SV DIFK +N+++++F++++W +EY+IAK  T+LL SF 
Sbjct: 648  IKKSLKDEKWESIHDDARISFSVTDIFKSINQNIKMFQEIEWGDEYQIAKVLTKLLNSFL 707

Query: 735  DGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTAERMKNTWLFNEMRNAL-- 792
            DGL  Y+  VL +I+ D+ Q +SA  + + +     T +  + R  +T L + +R  +  
Sbjct: 708  DGLQFYSKFVLDLIQRDM-QGNSATMAPEGTTRT--TEKNVSARPSST-LLHGLRKVVGG 763

Query: 793  --MPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQVKVEDKK 850
                + +  P  Y++K +TCV LN+L +M   I+ +E+ VN E++S  I  H+   +  K
Sbjct: 764  SSSSSSSNVPPPYQYKVQTCVMLNDLYQMKSNISTIEDLVNPERLSSIIKNHEKSTKTLK 823

Query: 851  DRSD---KAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNP 907
              S      + Q YTIR+V+A +I  F++DG SN++VTL +   + EI  T+++ K+VNP
Sbjct: 824  RHSSVTPSVMHQFYTIRVVEANDIKGFSNDGLSNTSVTLQNIDARMEIGSTQIIHKSVNP 883

Query: 908  MWDELFELVVPAGEARMISATVWHH-SAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQET 966
             WD+ FE+ +P  +A  IS   WHH + +   +   ++CG   L LDP  ++ DGYP + 
Sbjct: 884  KWDQEFEVDLPYNKACSISIKFWHHPTNRFKSLGGDEICGTAMLTLDPKRFKDDGYPNDV 943

Query: 967  NLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVNFSLSRA 1026
            +L L+ QG + LQVSLESE+ D  F +G+++R L R CDR + L+V KFT F+ FS SR 
Sbjct: 944  SLPLNDQGMIYLQVSLESEKDDVSFSLGKSYRTLDRTCDRVLDLIVEKFTLFIKFSFSRE 1003

Query: 1027 ALKTVVSSTTASAPGGAGTKT---NVVYDAILPLFDYLNSNLAILATELTRSLLHKVMLQ 1083
             L         S  G  GT     + + DAI+PL++Y++ NL IL + ++  LL+ ++L+
Sbjct: 1004 TL--------VSLHGSEGTNQVTEDQIGDAIVPLYNYIDLNLNILGSGVSTELLNAIILK 1055

Query: 1084 AWNTILHSADALLLPNLSCAXXXXXXXXXXXXTLWENXXXXXXXXXXXXXXXXXTIPGFG 1143
             W  I+ SAD L+LP+LS A            +LW                    I G+G
Sbjct: 1056 VWLVIMTSADFLMLPSLSTA-EQKHRSKSSRMSLWGGHSHD--------------ISGYG 1100

Query: 1144 SALTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAE 1203
              LT  EI  +F WLR++ VDF +N G+GPPL +L N +Y+NL ++  +YDK    L+ +
Sbjct: 1101 RPLTFNEIKTIFRWLRSISVDFLYNNGQGPPLKELHNHYYENLQIILKYYDKNVHSLKKK 1160

Query: 1204 VERLM 1208
            VE+LM
Sbjct: 1161 VEKLM 1165

>CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces
            cerevisiae YOR296w, start by similarity
          Length = 1277

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1296 (31%), Positives = 656/1296 (50%), Gaps = 92/1296 (7%)

Query: 37   ELYQSLLKVVLLEYINEPRFRRQY----QRLND-----VETGELFPRERQPVRSRDDRKR 87
            E Y   L V+LLEY+ EPRF        Q L D      ++GE   RE+  + S  +   
Sbjct: 26   ETYHYTLIVILLEYMAEPRFHVNSTGAPQPLRDEMNQKSKSGEFLLREQSSIGSYQNSSS 85

Query: 88   ATWFWPNGELESTEGNALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDLYLDPN 147
            A  +                +   L  RLS I   + K+     +R LLK YND +LDPN
Sbjct: 86   AKDY----------------LLVALTERLSLITRNQIKVTDPNFKRCLLKFYNDYFLDPN 129

Query: 148  MSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLARCEVST 207
            M   L+     E+++  F+++A+ E+ K+ +++   ELY+QV+ F+++LI+     E   
Sbjct: 130  MKIKLKQTSNIEDIVAYFSQSANKELNKVLLDNFSLELYRQVASFLELLIN--CTPEKYM 187

Query: 208  PEFVSKLRSYTDSFKPEDGEGSIRSRS---SQGVPAVGGNCIEVTVKPAFTVSEISHSVY 264
             +F  KL +   +F+P       +  S   +  VP      I    +P++ + +ISH  Y
Sbjct: 188  ADFKPKLEAMKSTFEPNRYRPLTKRYSLDMNSNVP------ITAQRQPSWNLDDISHIGY 241

Query: 265  IMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIKHSIK-SNGGFTADDFPTKELYEQW 323
             M+LF +D+ +   DV  +   +    Y+ EL  ++  +K S+   +  DFPT+  Y  W
Sbjct: 242  FMKLFAMDKMKIQYDVNDILKHLSLSSYKNELLELRVKVKNSSFSLSVSDFPTEREYRNW 301

Query: 324  KEYELHAIDDLINRLEENKARHNESLSK-KAGVKVIPANSRGMLVKLLCILLEREQPS-- 380
            + Y       LI++        +E +S   A    IP+N + ++ KL  ++++ E  +  
Sbjct: 302  QNYIFGETTQLIDKFS------SEQISNINAPTPCIPSNRKAIISKLFELIIQSEYKNDE 355

Query: 381  QTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTLLDDGEMLKDDIEHLVQAAQS 440
            +   LS ++ F I KCA+YW  D+ ST  SLF+ A N  L  +  +  + +E  +    +
Sbjct: 356  KVLALSKESTFFIFKCAKYWLSDFPSTIASLFFAAMNKVLFTNDMLNVEFVEKSIMMVSN 415

Query: 441  KGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHLMLSGIYSKPKPKFSPVLNIY 500
               +  +T+   T WN  DR  W+  L          + ++LS ++    P FSP L+ Y
Sbjct: 416  LFLRSRETK-ELTTWNNYDRILWVKTLRVICSKTFKSISILLSKLFDPNLPSFSPYLSFY 474

Query: 501  YNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDYYASLVKQ-AKKEPFGMYSIQD 559
            +    TD     Y    T F  KW + L+  +    + YY SLV    + E   +  IQD
Sbjct: 475  FTIKYTDRYTEDY-LKSTSFEKKWAESLRNNINRACQTYYQSLVSTLPRDETLEIQHIQD 533

Query: 560  IAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFLADLPEFINDAEQNALAENTEV 619
            IAE I + ++ +QK+YPKP+ +++NI    A   I  FL DL   +   +      +  +
Sbjct: 534  IAEKIYKMIEKLQKKYPKPMFEDVNIAFVVADFLINAFLVDLETMLRFVKHYHKIASKSI 593

Query: 620  LPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYLVRLCADTCVRVHEVIHNSL 679
             P   LE Y+AI +L++I+VQ+KP +L F   + + F ++L  L  D   R+  V+ +S+
Sbjct: 594  APVDGLECYKAIVDLREIYVQIKPNEL-FPINLESMFGQFLQALNDDIKKRIMHVVKSSI 652

Query: 680  KEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSFSDGLCQ 739
            K E W  ++++ +YS+S++DIF+++NE+VQIF K  WE++YEIA   T +L  F++GL  
Sbjct: 653  KAEKWVRMNDATYYSTSIVDIFRLVNEAVQIFTKFDWEDQYEIAYLTTNILSEFTEGLKY 712

Query: 740  YAAKVLAIIEEDLSQADSALHSDDNSYENLIT-------LQGTAERMKN---TWLFNEMR 789
            Y +K+  + E DL Q D           NLIT       L    E++     TW F++M+
Sbjct: 713  YCSKLQNLAENDL-QMDVI---------NLITVTPESTPLSSGIEKLDKKGKTWSFHQMK 762

Query: 790  NALM--PALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQVKVE 847
             AL   P++   P  YE+  RTCV LNNL  M+  I  L+E V  +++S  +S+ + K  
Sbjct: 763  RALKSKPSIM-VPAPYEYTVRTCVILNNLDAMLGMITRLDELVKPQELSKYLSEAKAKPN 821

Query: 848  DKKDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNP 907
               + S+  +  ++TIR++    + +  +DG SN  VTL D++ + E+  T+++  ++NP
Sbjct: 822  RSTENSNN-INHIFTIRVLNTMEVHADTNDGFSNLRVTLNDSNRKSELGSTRIIEDSLNP 880

Query: 908  MWDELFELVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQETN 967
            +WDE FEL +   E   I   VWHHS   N     ++C K  ++LDP  +  +G P E +
Sbjct: 881  IWDEEFELRISNKEKAYIDFLVWHHSDAKN-TKMVELCAKGHVVLDPKRFSDNGLPSEMS 939

Query: 968  LDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVNFSLSRAA 1027
            + +  +G L + V+LE+E+ D +FC+G A+R   R+ ++ + ++V+KF+  V   +S+  
Sbjct: 940  IAMSPKGHLNIHVTLETEKMDPLFCIGNAYRTALRSKEKLLNMIVTKFSTVVAHIISKNT 999

Query: 1028 LKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKVMLQAWNT 1087
            LK V +         A     VVYDAI+PLFDYLNSNL+ILA+EL + LL +V+L+AW+ 
Sbjct: 1000 LKFVKAEKKNYVGKDA---EEVVYDAIVPLFDYLNSNLSILASELPKELLFEVILKAWDV 1056

Query: 1088 ILHSADALLLPNLSCAXXXXXXXXXXXXTLWENXXXXXXXXXXXXXXXXXTIPGFGSALT 1147
            IL  AD++LL     +            ++W N                 TI GFG  LT
Sbjct: 1057 ILLRADSMLL-PSLSSISSSGLVNSARKSIWRNSISSNP-----------TISGFGKPLT 1104

Query: 1148 PREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAEVERL 1207
              +I +VF WL ALC+DFFHN G GP + +LKN  Y ++L +P FY  +  EL+  + +L
Sbjct: 1105 EEDISIVFKWLDALCIDFFHNEGAGPSIENLKNVKYTSMLNIPKFYGTSVPELKKLILQL 1164

Query: 1208 MPFYEQYLDRRNYFDFGRHTASRPALPKGSLARKDSVWAHSSXXXXXXXXXXXXXLEHDP 1267
               Y+QYLD  + ++    T          ++R  ++   S+              EHDP
Sbjct: 1165 EKSYDQYLD--HIYNQDHATIQLIRTQTMGVSRHATIMGSSTKATREQLKDIIKEEEHDP 1222

Query: 1268 LEVAAVTQDXXXXXXXXXGRAAYVQDTLSRRAELAK 1303
            L+++A   D         G   +V   L RR +L K
Sbjct: 1223 LKISADKMDVILRILLAKGEFHFVYKNLERRKKLLK 1258

>Kwal_55.20302
          Length = 710

 Score =  520 bits (1338), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 283/700 (40%), Positives = 415/700 (59%), Gaps = 28/700 (4%)

Query: 615  ENTEVLPAV-ALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYLVRLCADTCVRVHE 673
            EN+  +P   A E Y++++EL DI+ Q++P   SF   +   F KYL  LC + C     
Sbjct: 12   ENSRSIPIYDATETYKSLRELADIYAQVEPSK-SFPFKLERYFIKYLSELCDEACSSTLG 70

Query: 674  VIHNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSF 733
            VI  +L++ETWEPI+ S  YS+SV+D+FKM++ES  +F KL W N Y+I+K  T LLK+ 
Sbjct: 71   VIQTALEKETWEPIEYSTGYSTSVVDVFKMIHESFDLFLKLNWGNGYQISKIYTFLLKAV 130

Query: 734  SDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYEN-----LITLQGTAERMKNTWLFNEM 788
            +DGL  YA+ V  +IE+++    S   ++  SY N      I  Q  A +MK TWL+ EM
Sbjct: 131  ADGLSLYASNVAKLIEDEVKSTQSE-ETEAESYGNENKRLSILSQTAAAKMKKTWLYGEM 189

Query: 789  RNALMPALAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQV---K 845
            +NAL       P+ ++F+ +TCVCL+NL  MMQ + +LEE VN +++S  ++KH++   K
Sbjct: 190  KNALKSNEISIPKPFKFQNKTCVCLSNLDRMMQMVTELEERVNPDEVSKAVNKHEISNAK 249

Query: 846  VEDKKDRSDKAVPQLYTIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTV 905
               K +  ++ +  +YT+++++AENI    +D ++ S+++++DT+ +RE A T+ V K  
Sbjct: 250  SRKKAEMQNRGLRHIYTVKVIRAENIRVAANDSNTLSSISIIDTNNRREFATTREVLKVT 309

Query: 906  NPMWDELFELVVPAGEARMISATVWHHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQE 965
             P+W+E FE+ +P  + R  +  +WHH    N V+S KV G+  L L+P   R DGYPQ+
Sbjct: 310  RPIWNEEFEIEIPMDDVRPFNFILWHHKQSFNSVNS-KVYGRSFLYLNPHKMRDDGYPQD 368

Query: 966  TNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVNFSLSR 1025
             +L+LDT G+++LQVS+E+E+ DA+F +GRA+R+L+RA DR+I L+VSKF  FV+F+ S+
Sbjct: 369  ISLNLDTTGQVLLQVSVETEKVDALFSMGRAYRSLNRALDRSIELIVSKFQVFVHFAFSK 428

Query: 1026 AALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKVMLQAW 1085
            A L+ V         G        VYD+ILPLFDYLN+NL ILAT L R LL+K+ML+AW
Sbjct: 429  ATLRAVCGPN-----GQIRADKTAVYDSILPLFDYLNANLDILATRLPRELLYKIMLEAW 483

Query: 1086 NTILHSADALLLPNLSCAXXXXXXXXXXXXTLWENXXXXXXXXXXXXXXXXXTIPGFGSA 1145
            + IL  AD LLLP LS              +LWEN                         
Sbjct: 484  DEILIQADDLLLP-LSSDAPKLRNRNIKNKSLWENAVGAAKLGISSNSSSER-------P 535

Query: 1146 LTPREIDVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAEVE 1205
            LT  EID +FDWLRALC+DFFHN GEGP L DLKN HYQ LLLVPVFYD+   EL +EV+
Sbjct: 536  LTQIEIDTIFDWLRALCIDFFHNNGEGPSLSDLKNAHYQKLLLVPVFYDRTVHELMSEVD 595

Query: 1206 RLMPFYEQYLDRRNYFDFGRHTASRPALPK--GSLARKDSVWAHSSXXXXXXXXXXXXXL 1263
            RL   Y   +  +N     + +A    + +   ++AR+ ++ A+SS              
Sbjct: 596  RLNKEYRDSMFAQNKIS-TKGSAETNLIKRRVNTIARRKTIIANSSRKRRMELDKEIKAA 654

Query: 1264 EHDPLEVAAVTQDXXXXXXXXXGRAAYVQDTLSRRAELAK 1303
            E +P+E    TQD         G   +V ++L  R  ++K
Sbjct: 655  EENPIENIISTQDVLLRILMAKGETEFVAESLLFRETISK 694

>KLLA0B13002g complement(1134173..1138306) weakly similar to
            sgd|S0005822 Saccharomyces cerevisiae YOR296w,
            hypothetical start
          Length = 1377

 Score =  403 bits (1036), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 354/1314 (26%), Positives = 617/1314 (46%), Gaps = 176/1314 (13%)

Query: 38   LYQSLLKVVLLEYINEPRFRRQYQRL-NDVETGELFPRERQPVRSRDDRKRATWFWPNGE 96
            +Y ++LKVVL  YINEPRFRR+++R+ ++V +  L  R +         + +TWF  +  
Sbjct: 40   VYSNVLKVVLFAYINEPRFRRKWKRVGSNVNSQRL--RVKGASHDNGSNRLSTWFSHDPS 97

Query: 97   L--------------ESTEGNALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDL 142
                            S    ++K+V   LE +L+ IA+ +  I    LRRSLLK YND+
Sbjct: 98   DDEDEDDNNRSSIGGSSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDV 157

Query: 143  YLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLAR 202
            +LD      L  M + E+LI+LF K+A+ E+ KL+ +D + +L+ Q+S+FI+ILID L+R
Sbjct: 158  FLDSQFKQTLGTMTKPEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILID-LSR 216

Query: 203  CEVSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPAVGGNC----------IEVTVKP 252
                 P +V +L +Y +S K   G+ + RS S      + GN           ++ T++P
Sbjct: 217  DTKMGPTYVKRLNAYKNSLK--QGDNNKRSPS-----PINGNVMTSKDEESKLVDDTLQP 269

Query: 253  AFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIKHSI-KSNGGFTA 311
             F +SEI+HS  +  +FGVDE +   DV+ L   +KND Y +EL   + +I K       
Sbjct: 270  TFRLSEITHSKILTTIFGVDELKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAELKP 329

Query: 312  DDFPTKELYEQWKEYELHAIDDLINRLEENKARHNESLSK-KAGVKVIPANSRGMLVKLL 370
             DF T + Y  WK+++L  + +L ++++   + HNES       +++IP + R +   L+
Sbjct: 330  IDFGTMDQYSDWKDHQLKHLSELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQTLV 389

Query: 371  CILLE----REQPSQTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTL-----L 421
             ++L+    R++    + +S D++FL+S+C RYW +DY S   ++F  A +  L     L
Sbjct: 390  NLILKHDFVRQERDNEASISLDSKFLLSRCLRYWLIDYGS---AVFVNAVSGCLHLIRNL 446

Query: 422  DDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHLM 481
            D  E +K   +++    +++ +  +    +   WN  D+ QW  N    F+   + ++  
Sbjct: 447  DFPEGMK-MTQYVFGFMETRLSVEAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVYRC 505

Query: 482  LSGIYSKPK--PKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDY 539
            +  ++S      K   V++ Y+  V+ D ++I+ +F ++D Y K + +LK+    T E  
Sbjct: 506  IECMFSSKTRDTKLKSVISTYHALVEHDSVLIERDFQKSDMYKKQIHKLKKKTFLTIEQR 565

Query: 540  YASLVKQAKKEP-FGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFL 598
            Y SL++    +    +  +  + E I+  + +I+ +Y KPL +  +  +   ++ I  + 
Sbjct: 566  YISLIRHVPTDSEISIKHLHGLCESILDDIALIETKY-KPLTNLSSRYKFVGII-IHTYF 623

Query: 599  ADLPEFINDAEQNALAENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYK 658
            + L   +    Q     N  +    AL+ Y+ + EL+    +      S  + +   FYK
Sbjct: 624  SALFRDLKILMQRIKKYNKPI-DTDALDTYKLLNELRWKNYEESGSISSEGSILEPIFYK 682

Query: 659  YLVRLCADTCVRVHEVIHNSLKEETWEPIDE--SHHYSSSVLDIFKMMNESVQIFEKLQW 716
            YL+  C +T   V +     +  ETWEP+D+     YS S  DI +++++++++ E+LQW
Sbjct: 683  YLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYSRSAYDISRLISDTLRLVEQLQW 742

Query: 717  ENEYEIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTA 776
             +  ++    + +L   S+ +  YA  +  I+ EDL  ++    +D+ + +     QG  
Sbjct: 743  NDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCISE----NDEQNGQG----QGMG 794

Query: 777  ERMKN-TWLFNEMRNALMPA---------------------------------------- 795
             R+ N   +F +M++A+  +                                        
Sbjct: 795  HRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNVDAVDAASAASASDTESATTT 854

Query: 796  -LAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQVKVEDKKDRSD 854
              A     Y    R+CVCLNN++ ++  I+++E++    ++S+ +  H     +KK +S+
Sbjct: 855  TTATAATGYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEVRAHVTDDNNKKIKSE 914

Query: 855  KAVPQLYTIRIVKAEN--ILSFNSDGSSNSAVTLVDTSVQREIAKTKV-----------V 901
                QL++I  + AE    +    + S   ++++VDT+ + EI +T V           +
Sbjct: 915  -IKGQLWSIVPIAAEGAPCVGGKDNQSPRYSLSIVDTAKRHEIYRTLVGGFPEWWEDEEL 973

Query: 902  RKTVNP---------MWDELFELVV------------PAGEARMISATVWHHSAKINPVS 940
               + P         +W E  E                +G     S T            
Sbjct: 974  DLELEPQERMSLSLVLWQEKQEAGANRQRRHRRQRKYNSGTGTRTSETQGTGGNGGGGNG 1033

Query: 941  SYKVCGKCSLLLD------PTVYRSDGYPQETNLDLDTQGRLILQVSLESERFDAMFCVG 994
            S    G+C L LD       +     G  +   L LDTQGR+ ++V LE ER +    VG
Sbjct: 1034 SGVPVGRCYLDLDMPRDMLKSRKNESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVG 1093

Query: 995  RAHRALSRACDRAIGLMVSKFTAFVNFSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAI 1054
            +  R ++R   +++  + ++F   +N S S+ +   +  S ++S PG   T  + +YD++
Sbjct: 1094 KTRRIVARILTQSLKQVTNRFEPCINDSFSKKS---LSMSLSSSVPGQRPTDDD-IYDSL 1149

Query: 1055 LPLFDYLNSNLAILATELTRSLLHKVMLQAWNTILHSADALLLPNLSCAXXXXXXXXXXX 1114
            +PLFD+LN NL +LA  L  +LLH++MLQ WN IL +ADALLLP L  A           
Sbjct: 1150 VPLFDHLNENLTVLAQALPTALLHQIMLQVWNKILVAADALLLPPLQLASISSSANSEYN 1209

Query: 1115 XTLWENXXXXXXXXXXXXXXXXXTIPGFGSAL-----------------------TPREI 1151
                 N                  + GF   L                       T  E+
Sbjct: 1210 FGSRGNRMSYSGSTRGSSSVWDTAVSGFQKVLQKPGFTGWSSPFSNNSNYNNTVGTSLEV 1269

Query: 1152 DVVFDWLRALCVDFFHNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAEVE 1205
            ++VF W+  LC DFFHN GEGPPL  LKN  YQ L+L+   +D    EL+  +E
Sbjct: 1270 EIVFMWIDILCRDFFHNNGEGPPLDKLKNDQYQQLMLIASLFDNETCELKQTIE 1323

>Kwal_47.16895
          Length = 1506

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 16/132 (12%)

Query: 863  IRIVKAENILSFNSDGSSNSAVTL-VDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGE 921
            ++++ AE + S + +  S+  V + VD     ++ KT+V++KT++P+W+E  E+ VP+  
Sbjct: 1094 LKVISAEGLPSHDRNNKSDPYVVINVDGG---QVQKTEVIKKTLSPVWNEELEIPVPSRS 1150

Query: 922  ARMISATV--WHHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQETNLDLDTQGRLILQ 979
               +   V  W  +     +        CS  LD  +   D   ++  L+LD QG + L 
Sbjct: 1151 RSKVVVEVYDWDRTGSNALL--------CSAELDTKILVPD-QTKDLQLNLDKQGTIKLA 1201

Query: 980  VSLESER-FDAM 990
             +   E  F AM
Sbjct: 1202 ATFHPEYLFPAM 1213

>Scas_703.33
          Length = 1509

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 40/58 (68%), Gaps = 4/58 (6%)

Query: 863  IRIVKAENILSFNSDGSSNS-AVTLVDTSVQREIAKTKVVRKTVNPMWDELFELVVPA 919
            ++ V AE++++ + +G S+   V  +D   ++++ KT+V++KT++P+W+E   + +P+
Sbjct: 1108 LKFVSAEHLMAGDRNGKSDPFVVAYID---RKKVYKTQVIKKTLDPVWNESTRIAIPS 1162

>CAGL0J08591g complement(847505..851095) similar to tr|Q12466
           Saccharomyces cerevisiae YOR086c or sp|P48231
           Saccharomyces cerevisiae YNL087w, hypothetical start
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 10/60 (16%)

Query: 886 LVDTSVQ---------REIAKTKVVRKTVNPMWDELFELVVPAGEARMISATVWHHSAKI 936
           ++DTSV          +E+A+T+ VR T+NP+W+E   +++P+    M + TV+    K+
Sbjct: 425 MIDTSVDPYITFQMGGKEVARTRTVRDTLNPVWNETIYMLLPSFTDPM-TITVYDRREKL 483

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 862  TIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDE 911
            TI    AEN+LS +++G S+  +            KTK ++KT+NP W+E
Sbjct: 1014 TIIAKNAENLLSADTNGYSDPFLKFYYNDEDDACFKTKTIKKTLNPTWNE 1063

>AER148W [2652] [Homologous to ScYML072C - SH]
            complement(914026..918534) [4509 bp, 1502 aa]
          Length = 1502

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 15/140 (10%)

Query: 863  IRIVKAENILSFNSDGSSNS-AVTLVDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGE 921
            +++V AE++ S + +G S+   +  VD +   +I K++V++KT+ P+W+    + +P+  
Sbjct: 1083 LQVVSAEDVPSHDRNGLSDPFTIIKVDGT---KIFKSEVIKKTLTPVWNARTNIPIPSRT 1139

Query: 922  ARMISATV--WHHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQETNLDLDTQGRLILQ 979
               +   V  W  S       S  +  KCSL L+  V   +   +  +L L  QG + L+
Sbjct: 1140 RSKVDIEVYDWDRSG------SNDILSKCSLPLEELVPNQE---KAFSLKLRPQGIIHLK 1190

Query: 980  VSLESERFDAMFCVGRAHRA 999
                 E       VG    A
Sbjct: 1191 GRFVPEYIRPAVNVGEGGFA 1210

>CAGL0C05049g 475910..479455 similar to sp|Q12451 Saccharomyces
           cerevisiae YDL019c OSH2, hypothetical start
          Length = 1181

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 899 KVVRKTVNPMWDELFELVVPAGEARMISATVWHH---SAKINPVSSYKVCGKCSL 950
           K V K  NP+  E FE V P G+ R ++  V HH   SA       +   G+C +
Sbjct: 862 KRVAKPFNPLLGETFEYVSPDGQYRFLTEQVSHHPAISATWGEAPKWNYWGECKV 916

>KLLA0B04708g complement(425404..429876) similar to sp|Q03640
            Saccharomyces cerevisiae YML072c, start by similarity
          Length = 1490

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 866  VKAENILSFNSDGSSNSAVTL-VDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGEARM 924
            + A+++ S + +G S+  + + +D     +I ++ VV+KT+NP+W+E  +L VP+     
Sbjct: 1104 ISADDVPSHDRNGKSDPMIIVRIDG---EKIFQSAVVKKTLNPVWNEKVKLPVPSRSRNK 1160

Query: 925  ISATVW 930
            I+  V+
Sbjct: 1161 IAVQVY 1166

>CAGL0G08800g complement(835307..838369) similar to sp|P40469
           Saccharomyces cerevisiae YIL128w MET18 involved in NER
           repair and RNA polymerase II transcription, hypothetical
           start
          Length = 1020

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 83/187 (44%), Gaps = 39/187 (20%)

Query: 275 QFMADVLHLKDGIKNDYYQYELDAIKHSIKSNGGFTADDFPTKELYEQWKEYELHAIDDL 334
           Q++ D + L D  KN YY     A    +KS            ELYE    YE+ A+  +
Sbjct: 502 QYITDTI-LTDSNKNIYY-----ACLEGLKS----------ISELYEDIV-YEV-ALTRM 543

Query: 335 IN----RLEENKARHNESLS-KKAGVKVIP--ANSRGMLVKLLCILLEREQPSQTSPL-- 385
           +N     L+E    H+E+L   +  +K+I     SR +LVK   + L ++    ++ +  
Sbjct: 544 LNLLPEALDEASIAHDETLILAETLLKIILDFTTSRHILVKESILSLTKKLCKTSASIAR 603

Query: 386 -SSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTLLDDGEMLKDDIEHLVQAAQSKGAQ 444
            SSD  FLI            ST  SL+   Y L    DG +LK +IE+ + A  + G  
Sbjct: 604 RSSDYCFLI-----------LSTIYSLYDNNYFLLKEGDGALLKHEIENDLYAVLADGVN 652

Query: 445 VSDTEFN 451
           V D + N
Sbjct: 653 VKDDDLN 659

>AGR356W [4667] [Homologous to ScYHR073W (OSH3) - SH]
           complement(1387337..1390207) [2871 bp, 956 aa]
          Length = 956

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 890 SVQREIAKTKVVRKTVNPMWDELFELVVPAGEARMISATVWH 931
           SV RE  K + +RK VNP+  E +ELV      R+IS  V H
Sbjct: 668 SVHRE--KARAMRKPVNPLLGETYELVREDKGYRLISEKVSH 707

>Scas_686.5
          Length = 928

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 882 SAVTLVDTS---VQREIAKTKVVRKTVNPMWDELFELVVPAGEARMISATVWH 931
           S+VTL   S   +QR+  KT+ +RK  NP+  E FELV      R+I+  V H
Sbjct: 629 SSVTLFAISFLSIQRD--KTRSLRKPFNPLLGETFELVHDKMGFRLIAEKVSH 679

>YOR086C (TCB1) [4892] chr15 complement(483220..486780) Protein
           containing three C2 domains, which may be involved in
           calcium-dependent phospholipid binding, has a region of
           low similarity to a region of synaptotagmin 7 (mouse
           Syt7), which is involved in synaptic vesicle fusion
           [3561 bp, 1186 aa]
          Length = 1186

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 15/17 (88%)

Query: 895 IAKTKVVRKTVNPMWDE 911
           IAKT+ VR T+NP+WDE
Sbjct: 422 IAKTRTVRDTLNPVWDE 438

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%)

Query: 862  TIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDE 911
            TI    AEN+++ + +G S+  +     + +    KTKVV+KT+NP W++
Sbjct: 995  TIMSRSAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWND 1044

>KLLA0C13860g 1189822..1193343 similar to sgd|S0005612 Saccharomyces
            cerevisiae YOR086c, start by similarity
          Length = 1173

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 863  IRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDE 911
            I I  A +++S + +G S+  V L          KTK ++KT++P W+E
Sbjct: 993  INIKSANDLISSDRNGKSDPFVKLYLNDNGSPFYKTKTIKKTLDPTWNE 1041

>Scas_662.23
          Length = 1158

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 862  TIRIVKAENILSFNSDGSSNSAVTLVDTSVQREIA-KTKVVRKTVNPMWDE 911
            TI    AEN+L  + +G S+  +     + + E A KTK V+KT+NP W++
Sbjct: 976  TITAKSAENLLPSDLNGFSDPYLKFYVNAEKGEPAWKTKTVKKTLNPTWND 1026

>CAGL0L11440g 1213237..1217829 similar to sp|Q03640 Saccharomyces
            cerevisiae YML072c, hypothetical start
          Length = 1530

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 863  IRIVKAENILSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGEA 922
            + I+   ++++ + +G S+  V +      + + KT   +KT++P+W+E  ++ +P+   
Sbjct: 1105 LNIISGSHLMAADRNGKSDPFVGIYING--KRVYKTHTEKKTLDPVWNEHCKIPIPSRSR 1162

Query: 923  RMISATVW 930
              +   VW
Sbjct: 1163 SNVVMRVW 1170

>Scas_449.1
          Length = 636

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 10/120 (8%)

Query: 618 EVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYKYLVRLCADTCVRV--HEVI 675
           E  P   +  +  + +LK ++   K K  SFN A     Y+  V L A  C++    +  
Sbjct: 497 EDCPESQIIIFEILDDLKILFDNFKHKFGSFNKAT---LYQLYVCLLAINCIKKLRQQTN 553

Query: 676 HNSLKEETWEPIDESHHYSSSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSFSD 735
             S  +  W   DE   Y + +   +K ++ + Q+ ++LQ + +YE+ + K  L++  S+
Sbjct: 554 LTSANDSKW---DEQLEYFNDIF--YKGLSPAYQLPKRLQEDTDYEMEQEKQGLIQMSSN 608

>AER398W [2898] [Homologous to ScYJR090C (GRR1) - SH]
           complement(1397876..1401328) [3453 bp, 1150 aa]
          Length = 1150

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 16/91 (17%)

Query: 570 IIQKRYPKPLLDEINITRTC-----AVVTIQKFLADLPEF-------INDAEQNALAENT 617
           +I+  +  PLL E+++T T      ++VT+   L  L EF       ++DA    LA N 
Sbjct: 560 LIKMAHSCPLLVEVDLTSTPQINNDSIVTLMTELPQLREFRLTQNMLLSDAFATQLALNV 619

Query: 618 EVLPAVALEAYRAIQELKD----IWVQLKPK 644
             LPA+ L    A + + D      VQL PK
Sbjct: 620 TSLPALRLVDLSACESITDKTVVKLVQLAPK 650

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,064,274
Number of extensions: 1805738
Number of successful extensions: 5980
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6119
Number of HSP's successfully gapped: 49
Length of query: 1303
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1189
Effective length of database: 12,649,657
Effective search space: 15040442173
Effective search space used: 15040442173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)