Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL015C2202169971e-139
YMR233W2261974644e-58
CAGL0M04939g2331943872e-46
Sklu_1837.21611423769e-46
KLLA0B13024g1241013461e-41
YOR295W (UAF30)2281893044e-34
Kwal_55.2030878552142e-22
CAGL0G07557g241821912e-17
Scas_324.1103491586e-14
Scas_665.262491781543e-12
CAGL0H09416g75020643.2
Scas_667.2428571615.5
Kwal_14.167059947616.7
CAGL0F07425g61447607.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL015C
         (216 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...   388   e-139
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...   183   4e-58
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...   153   2e-46
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement        149   9e-46
KLLA0B13024g complement(1138572..1138946) some similarities with...   137   1e-41
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...   121   4e-34
Kwal_55.20308                                                          87   2e-22
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    78   2e-17
Scas_324.1                                                             65   6e-14
Scas_665.26                                                            64   3e-12
CAGL0H09416g 921571..923823 highly similar to sp|P39925 Saccharo...    29   3.2  
Scas_667.24                                                            28   5.5  
Kwal_14.1670                                                           28   6.7  
CAGL0F07425g complement(722699..724543) similar to sp|P53137 Sac...    28   7.9  

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score =  388 bits (997), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/216 (89%), Positives = 193/216 (89%)

Query: 1   MYAPHFFGSFKHLLTPLPKAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILE 60
           MYAPHFFGSFKHLLTPLPKAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILE
Sbjct: 1   MYAPHFFGSFKHLLTPLPKAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILE 60

Query: 61  RFDLLRDRQSKVLSQEELVQRDSEMAAALVXXXXXXXXXXXXXXXXXXXXXXXNQSDNPN 120
           RFDLLRDRQSKVLSQEELVQRDSEMAAALV                       NQSDNPN
Sbjct: 61  RFDLLRDRQSKVLSQEELVQRDSEMAAALVRGDAGRAKRPRKRDADKPRKKRANQSDNPN 120

Query: 121 SFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFG 180
           SFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFG
Sbjct: 121 SFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFG 180

Query: 181 KKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSD 216
           KKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSD
Sbjct: 181 KKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSD 216

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score =  183 bits (464), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 4/197 (2%)

Query: 16  PLPKAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLSQ 75
           P+  AILSVS+PDEIS KR+RKALQ L++V+LD  +K I  LILERF  +++    ++ +
Sbjct: 9   PMVDAILSVSNPDEISPKRVRKALQILYSVNLDSQRKLINELILERFGDIQENPRVLIPK 68

Query: 76  EELVQRDSEMAAALVXXXX----XXXXXXXXXXXXXXXXXXXNQSDNPNSFHMRPVQLSE 131
            +L+ RD E++  L                            N S + NS  +R V LS 
Sbjct: 69  NDLISRDQELSLRLQKEEERPLRSTRKRKGKSESKSKRKKKKNDSPDSNSISVRKVLLSA 128

Query: 132 PLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKI 191
           PLQ+ LG E+LPRTQVVK +W YIK+H LQNP DRREILCD  MEP+FGKKMTMFSMNK+
Sbjct: 129 PLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNKL 188

Query: 192 LSQHLTNPKDVSGSDQD 208
           L++HL NP ++   +++
Sbjct: 189 LTKHLFNPDEIVKHEEE 205

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score =  153 bits (387), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 115/194 (59%), Gaps = 16/194 (8%)

Query: 20  AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLSQEE-- 77
           AI+SVSDPD++S K+IRKAL++LF+V L+  KK++  LI+ RF +L+     ++S EE  
Sbjct: 16  AIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELIVARFQILQADPHILVSNEEFQ 75

Query: 78  ------------LVQRDSEMAAALVXXXXXXXXXXXXXXXXXXXXXXXNQSDNPNS--FH 123
                       L  +  E    L                         +  NPNS   +
Sbjct: 76  NLKMIRGNYDALLSSKSMEKKHKLTESSKKTRIQVKKKKSKKSSKDGEKKVANPNSNAIN 135

Query: 124 MRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKM 183
              ++LS+ L + LGE +LPRTQVVK VWDYIK+H LQ+P+DRREI+CD  M P+FG KM
Sbjct: 136 SMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRPIFGDKM 195

Query: 184 TMFSMNKILSQHLT 197
           TMF++NKILS+HLT
Sbjct: 196 TMFALNKILSKHLT 209

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score =  149 bits (376), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 96/142 (67%), Gaps = 3/142 (2%)

Query: 73  LSQEELVQRDSEMAAALVXXXXXXXXXXXXXXXXXXXXXXXNQSDNPNSFHMRPVQLSEP 132
           +SQEELV+RD+++AA L                          S+N NS   R V LS+ 
Sbjct: 1   MSQEELVKRDAKLAAKL--QKQEDDAKRKKKRKTDKPKKKRKVSENANSIQARKVLLSKK 58

Query: 133 LQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKIL 192
           L++ LGE +LPRTQVVK VWDYIK+H LQNP+DRREILCD AMEP+FGKKMTMFSMNKIL
Sbjct: 59  LEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKIL 118

Query: 193 SQHLTNPKD-VSGSDQDANTEE 213
           S+HL NP+D V+GS +    +E
Sbjct: 119 SKHLFNPEDVVNGSKEKEELQE 140

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score =  137 bits (346), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 83/101 (82%), Gaps = 3/101 (2%)

Query: 116 SDNPNSFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAM 175
           +DNPNS H++ V LS  LQ  L  E++PRTQVVK+VWDYIK+H LQNP+DRREI+CD AM
Sbjct: 24  NDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAM 83

Query: 176 EPVFGKKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSD 216
           +P+FG+KMTMF++NKILS+HL N   ++ S++D  TE+HSD
Sbjct: 84  KPIFGEKMTMFTLNKILSKHLFN---LAKSEKDEITEQHSD 121

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score =  121 bits (304), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (55%), Gaps = 8/189 (4%)

Query: 21  ILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLSQEELVQ 80
           +LS  D + ++ K++R AL+E++A+D++   K I  LI +  DL+++R     S E+L++
Sbjct: 14  LLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVKERPRFERSLEDLLK 73

Query: 81  RDSEMAAALVXXXXXXXXXX------XXXXXXXXXXXXXNQSDNPNSFHMRPVQLSEPLQ 134
            ++ +A  L                                S +P S   R V LS+ L 
Sbjct: 74  ENATLAIELTKEITVSKRSSGEEKNDSETKGTHVEKKKGTVSKSPIS--TRKVTLSKSLA 131

Query: 135 RLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQ 194
            LLGE +L RT+VV+ +W YIK H LQNP++++EILCD  +E + GK   MF M+KIL+ 
Sbjct: 132 SLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKSTNMFEMHKILAS 191

Query: 195 HLTNPKDVS 203
           H+T PK +S
Sbjct: 192 HMTEPKKIS 200

>Kwal_55.20308
          Length = 78

 Score = 87.0 bits (214), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (83%)

Query: 142 LPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQHL 196
           + RTQ+VK VW++IK +QLQNPDDRREI CD  M+PVFG+K TMF++NK LS H+
Sbjct: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHI 55

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 78.2 bits (191), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (64%), Gaps = 4/82 (4%)

Query: 133 LQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKIL 192
           LQ ++G     RT++V+ +W YIK+H LQNPDD+R+I+ DA +EPV GK   +F M++ L
Sbjct: 134 LQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTSDIFMMHRAL 193

Query: 193 SQHLTNP----KDVSGSDQDAN 210
             H+  P     +V  +DQ++ 
Sbjct: 194 KHHILGPAPIEAEVIRTDQEST 215

>Scas_324.1
          Length = 103

 Score = 65.5 bits (158), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (81%)

Query: 20 AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDR 68
          AILS S+PDE+S K+IR+ALQELF VDLD  +K +  LI+ERF+ L+DR
Sbjct: 15 AILSASNPDEVSPKKIRRALQELFNVDLDAQRKAVNDLIIERFNALQDR 63

>Scas_665.26
          Length = 249

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 87/178 (48%), Gaps = 10/178 (5%)

Query: 20  AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILERFDLLRDRQSKVLSQEELV 79
           A+L+ S  D  + K +R  LQE+FA++++  + D   +I  R ++ + R   ++++ +L 
Sbjct: 24  ALLNSSFTDNPTVKELRMDLQEVFALNIEPLRGDFNDIIQSRIEMWQQRSKIIINEIDLE 83

Query: 80  QRDSEMAAALVXXXXXXXXXXXXXXXXXXXXXXXNQSDNPNSFHMRPV-QLSEPLQRLLG 138
           + +  +                            +  D      + P  ++SEPL+   G
Sbjct: 84  KENISLLRKF---------NEKLDRHSNNKDDIISPRDKRQKVDVEPTYKISEPLRGFFG 134

Query: 139 EEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQHL 196
           E +L +++++  +WDYI+ H+L+  ++  EILCD  +  VFG+ +    +  + S++L
Sbjct: 135 ETELTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKLGLVFGEVVLAHKIPTMTSKYL 192

>CAGL0H09416g 921571..923823 highly similar to sp|P39925
           Saccharomyces cerevisiae YER017c AFG3 or sp|P40341
           Saccharomyces cerevisiae YMR089c YTA12, hypothetical
           start
          Length = 750

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 143 PRTQVVKAVWDYIKQHQLQN 162
           PR +++KA W Y+K  + QN
Sbjct: 81  PREEMMKAFWQYVKSKEFQN 100

>Scas_667.24
          Length = 285

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 14  LTPLPKAILSVSDPDEISAKRIRKALQ---ELFAVDLDGDKKDIKALILERFDLLRDRQS 70
           L P P  I ++++P++I+ K ++K      +L+  D  G+   +K   LE+        +
Sbjct: 52  LNPSPYDIFAIAEPEKINKKAMKKLYHHYVKLYHPDRCGNLNILKNPSLEK------SSN 105

Query: 71  KVLSQEELVQR 81
           ++LSQ E ++R
Sbjct: 106 QMLSQAEKIRR 116

>Kwal_14.1670
          Length = 599

 Score = 28.1 bits (61), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 150 AVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQHL 196
           ++WD++K +   NP+  R  L D +++P    +    +    L QHL
Sbjct: 129 SLWDFVKLYAKDNPETVRS-LIDGSLKPTINAQKAQINRVYQLHQHL 174

>CAGL0F07425g complement(722699..724543) similar to sp|P53137
           Saccharomyces cerevisiae YGL110c, hypothetical start
          Length = 614

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 150 AVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQHL 196
            +W+ +K +  +NP+  R +L D +++P      T  +  K +  HL
Sbjct: 127 TIWNLVKYYANRNPNSVRALL-DGSLKPQINTTRTQLNWAKQIQTHL 172

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,188,395
Number of extensions: 223057
Number of successful extensions: 774
Number of sequences better than 10.0: 19
Number of HSP's gapped: 771
Number of HSP's successfully gapped: 21
Length of query: 216
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 119
Effective length of database: 13,238,163
Effective search space: 1575341397
Effective search space used: 1575341397
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)