Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ABL013C69868534440.0
KLLA0B13068g6716837572e-90
Kwal_55.203146576636541e-75
YMR232W (FUS2)6776885981e-67
Scas_594.16514153085e-29
CAGL0M04917g5864902523e-22
KLLA0C07381g468136770.36
Sklu_1916.2117750760.60
CAGL0I05720g38296740.75
KLLA0B05489g54586740.89
Kwal_55.20110236138701.9
Sklu_2423.2102489702.9
AER044W1103115684.2
YGR264C (MES1)75194675.5
CAGL0L04532g795164676.2
Kwal_27.9739119886668.1
ADR388C76150668.8
Kwal_56.2269398473669.2
KLLA0E11572g1848125669.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL013C
         (685 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH] (372925..375...  1331   0.0  
KLLA0B13068g complement(1140423..1142438) weakly similar to sp|Q...   296   2e-90
Kwal_55.20314                                                         256   1e-75
YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required fo...   234   1e-67
Scas_594.1                                                            123   5e-29
CAGL0M04917g 537760..539520 weakly similar to sp|Q05670 Saccharo...   101   3e-22
KLLA0C07381g complement(643441..644847) similar to sp|Q03652 Sac...    34   0.36 
Sklu_1916.2 YCL061C, Contig c1916 2062-5595                            34   0.60 
CAGL0I05720g complement(543158..544306) highly similar to sp|P23...    33   0.75 
KLLA0B05489g 488386..490023 similar to sp|P14747 Saccharomyces c...    33   0.89 
Kwal_55.20110                                                          32   1.9  
Sklu_2423.2 YDL077C, Contig c2423 3784-6858 reverse complement         32   2.9  
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    31   4.2  
YGR264C (MES1) [2210] chr7 complement(1019603..1021858) Methiony...    30   5.5  
CAGL0L04532g 522091..524478 highly similar to sp|P13188 Saccharo...    30   6.2  
Kwal_27.9739                                                           30   8.1  
ADR388C [2129] [Homologous to ScYAL041W (CDC24) - SH] (1406345.....    30   8.8  
Kwal_56.22693                                                          30   9.2  
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...    30   9.5  

>ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH]
           (372925..375021) [2097 bp, 698 aa]
          Length = 698

 Score = 1331 bits (3444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/685 (94%), Positives = 650/685 (94%)

Query: 1   MPDTTLTYLSFIYLNIDIYITRPLTAEISSERFSCSIFEPVLAMIKSKNSIYQLAYPATG 60
           MPDTTLTYLSFIYLNIDIYITRPLTAEISSERFSCSIFEPVLAMIKSKNSIYQLAYPATG
Sbjct: 1   MPDTTLTYLSFIYLNIDIYITRPLTAEISSERFSCSIFEPVLAMIKSKNSIYQLAYPATG 60

Query: 61  EMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRTIQRINTQVRNRHRPRSL 120
           EMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRTIQRINTQVRNRHRPRSL
Sbjct: 61  EMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRTIQRINTQVRNRHRPRSL 120

Query: 121 KLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLE 180
           KLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLE
Sbjct: 121 KLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLE 180

Query: 181 LGNSVYRFELQAKKVGSMLLDKERNDELLLFGDLETLASVSKILVKQLEEKIAEAYGGDK 240
           LGNSVYRFELQAKKVGSMLLDKERNDELLLFGDLETLASVSKILVKQLEEKIAEAYGGDK
Sbjct: 181 LGNSVYRFELQAKKVGSMLLDKERNDELLLFGDLETLASVSKILVKQLEEKIAEAYGGDK 240

Query: 241 GDSDQILKELRVHPDKLRAFIERLDIGTVLEHHFERIKYLYLTYSVNHQKQLELLQQIRR 300
           GDSDQILKELRVHPDKLRAFIERLDIGTVLEHHFERIKYLYLTYSVNHQKQLELLQQIRR
Sbjct: 241 GDSDQILKELRVHPDKLRAFIERLDIGTVLEHHFERIKYLYLTYSVNHQKQLELLQQIRR 300

Query: 301 KHSTIYFKWYDRCLQKADLIKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLS 360
           KHSTIYFKWYDRCLQKADLIKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLS
Sbjct: 301 KHSTIYFKWYDRCLQKADLIKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLS 360

Query: 361 DFYDQYCVYLRGVSTSERECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQST 420
           DFYDQYCVYLRGVSTSERECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQST
Sbjct: 361 DFYDQYCVYLRGVSTSERECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQST 420

Query: 421 ALSVNTGTSSAYSEPNVLPSNKISDCKSPDSDYADLDRSICQFFSVRKGXXXXXXXXXXX 480
           ALSVNTGTSSAYSEPNVLPSNKISDCKSPDSDYADLDRSICQFFSVRKG           
Sbjct: 421 ALSVNTGTSSAYSEPNVLPSNKISDCKSPDSDYADLDRSICQFFSVRKGLQDLLVELEQL 480

Query: 481 XXAEIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKH 540
             AEIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKH
Sbjct: 481 DLAEIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKH 540

Query: 541 LKKGVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQAL 600
           LKKGVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQAL
Sbjct: 541 LKKGVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQAL 600

Query: 601 LAKELPQFMAFMHKSISYLLLRYHSLVLEYXXXXXXXXXXXXXXXXXXXXXXRELGDNFD 660
           LAKELPQFMAFMHKSISYLLLRYHSLVLEY                      RELGDNFD
Sbjct: 601 LAKELPQFMAFMHKSISYLLLRYHSLVLEYLKILCGGEKLLKKELTFFEESERELGDNFD 660

Query: 661 ILQMFSSSRFYTKQAVRGNWQFPGI 685
           ILQMFSSSRFYTKQAVRGNWQFPGI
Sbjct: 661 ILQMFSSSRFYTKQAVRGNWQFPGI 685

>KLLA0B13068g complement(1140423..1142438) weakly similar to
           sp|Q05670 Saccharomyces cerevisiae YMR232w FUS2 required
           for cell fusion during mating singleton, start by
           similarity
          Length = 671

 Score =  296 bits (757), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 220/683 (32%), Positives = 359/683 (52%), Gaps = 68/683 (9%)

Query: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRT 103
           MIKS+ S Y L YP+   +TPIR    E +    N  Q     NPYS SLW    EN+  
Sbjct: 1   MIKSRYSTYLLNYPSNNSVTPIRT-CREDKYVLPNFYQ--TNHNPYSNSLWNTSEENREA 57

Query: 104 IQRINTQV---RNRHRPRSLKLEQEADI------PVRKKVDSPLNLRTFGDYMTLKSPKV 154
           ++RI       R R    S  LE+++ I      P  KK  SPL++ TF   M L S + 
Sbjct: 58  LKRIKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARP 117

Query: 155 DPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFE-LQAKKVGSMLLDKERNDELLLFGD 213
           D K L+ +  +++L+++E++Y + L L  S Y+ E    KK  + LL++  NDELLLFG+
Sbjct: 118 DSKTLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGN 177

Query: 214 LETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEHH 273
           L+T+A +SK+  K L E +      D G   +I KE++   DKL   I   D  T+++ H
Sbjct: 178 LDTMAELSKLFCKNLSECLKVT---DAGTQSRIWKEIK-GSDKLCQIILDTDFSTLIKSH 233

Query: 274 FERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILKLPVERL 333
             RIK  Y +Y + H+++   L  I+ +++  ++KWY+ CL+K+   KLED+L+LP+ERL
Sbjct: 234 LHRIKSPYHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQFEKLEDLLELPLERL 293

Query: 334 RTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVS------------------- 374
             WG++ E + L+ + + S   + Q++    +Y  YLR ++                   
Sbjct: 294 GQWGSLFENLCLFGDNLLSPERSVQMNAISKEYISYLRDLNDELNNSGRAKESILGEENA 353

Query: 375 -TSERECNCEAKANLELTPTQI---IHFYECSVDPEVSAIDIKRKKSQSTALSVNTGTSS 430
            T E+E +  +  +     +QI     FY  S  P  + ++ +  + + T   ++    +
Sbjct: 354 VTQEKENDNISSKSGSRGGSQISKSSSFY--SDIPSFTRVEEEVPQGEPTGAVLHNSHLN 411

Query: 431 AY---SEPNVLPSNKISDC-KSPDSDYADL---DRSICQFFSVRKGXXXXXXXXXXXXXA 483
           +     E     SN + DC K  ++ YA+L   D+++C+                    A
Sbjct: 412 SIEEKEESKFNSSNSLKDCIKEFNNIYANLQKWDKALCKL-----------------ELA 454

Query: 484 EIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKK 543
           +++ + L  A TW  L++FEP NE  ++     +IY  +++K++ QR+++ +L+++ L++
Sbjct: 455 KVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERTIYGTYVEKIDKQRQQVMILQLQDLRR 514

Query: 544 GVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQRD--YHDIKKKVMAQSFEDAQALL 601
            VI PL  LL R  +V+ K+ D   L KEY AY++QRD   HD KK+++A SF+D Q  L
Sbjct: 515 KVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYLRQRDTETHDAKKQILANSFQDLQHQL 574

Query: 602 AKELPQFMAFMHKSISYLLLRYHSLVLEYXXXXXXXXXXXXXXXXXXXXXXRELGDNFDI 661
           A+ LP F  +  ++I+ L+ +Y  L++EY                      R+LGDNFDI
Sbjct: 575 AESLPIFNEYAREAITLLVSQYTLLMMEYMQIISGGDQFLNKELELVNSGQRDLGDNFDI 634

Query: 662 LQMFSSSRFYTKQAVRGNWQFPG 684
           LQ+F SSR+YT+ A+R NW + G
Sbjct: 635 LQLFCSSRYYTRHAIRENWTYHG 657

>Kwal_55.20314
          Length = 657

 Score =  256 bits (654), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 195/663 (29%), Positives = 312/663 (47%), Gaps = 42/663 (6%)

Query: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRR---------NPYSESLW 94
           MIKS NSIY + YPA   +TPIRD   +  +   N   GK  +         NPY++S+W
Sbjct: 1   MIKSTNSIYNIDYPAKSVLTPIRDSGQDFFVTKGN--AGKFGQFGSRIPEDFNPYAKSMW 58

Query: 95  EALGENKRTIQRINTQVRNRHRPRSLKLEQEAD----IPVRKKVDSPLNLRTFGDYMTLK 150
                 K   Q++      R    S    QEAD    I        PL+L+   +  +  
Sbjct: 59  TTEDGYKNNAQKLKKITSMRRDKVSF---QEADSKELIASNLSPTEPLDLKLQKETKSQL 115

Query: 151 SPKVDPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGSMLLDKERNDELLL 210
           S +   K    L      ++ E +Y    +  N VYR EL   K    L+D+  NDE+LL
Sbjct: 116 SSEFTDKGKAFLTSFYSFLKREEDYAYFTDSLNMVYRKELHDHKSKHRLIDRNSNDEILL 175

Query: 211 FGDLETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELR---VHPDKLRAFIERLDIG 267
           FG+++T++ +S+ILVK L+      Y     D+  IL +      H +    F +  D  
Sbjct: 176 FGNMDTISQLSRILVKSLKN-----YMKACCDTGNILFQWDGYDSHMNVTDKFEDLFDPS 230

Query: 268 TVLEHHFERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILK 327
             L  H  +I+  Y TY ++ QKQL+L+ ++R+  S  Y+KWY+ CL+KAD  +LEDIL+
Sbjct: 231 DFLISHLNKIRSTYSTYILSRQKQLQLICELRKLKSAAYYKWYETCLKKADFNRLEDILE 290

Query: 328 LPVERLRTWGAITEQVLLYTEGISSDLATAQLSDFYDQY------CVYLRGVSTSERECN 381
            P++R+  +      V  + EG  S  A  ++  F ++Y      C +L G +  +    
Sbjct: 291 APMKRIHDFYDDLLDVSTHAEGFISPEACGKIKSFLNRYLEFSDECQHLLGSNIPK---- 346

Query: 382 CEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTGTSSAYSEPNVLPSN 441
            E K +  L+P    H    +V    ++      +   ++   +  +S   S     PS+
Sbjct: 347 SEGKLSKPLSPHSDAHL---TVPASDTSCRSSDSRYSLSSSRYSDHSSFELSRKQSAPSS 403

Query: 442 KISDCKSPDSDYADLDRSICQFFSVRKGXXXXXXXXXXXXXAEIICQQLANAKTWHRLMD 501
             +D +  +   AD  R   +F  V                A I+ + L  A+ W  + +
Sbjct: 404 SSTDIQKENPTLADCIR---RFKLVESHAIKLEKELTKLDLAAILDENLRQAEEWRNIFE 460

Query: 502 FEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLVLLARTDSVRG 561
           FEP ++       + SIYT +IDK++ QR+E+ ++++  L++ V+ PL  ++    +V  
Sbjct: 461 FEPLSDLLTEHTNVESIYTIYIDKIHQQRQEVMLIKLGDLQEKVLSPLRHIIQCCKAVHV 520

Query: 562 KIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQALLAKELPQFMAFMHKSISYLLL 621
           KI DLK L K+Y A+++ +D  ++K +++ + F   Q  L  ELP F+    +   YL+ 
Sbjct: 521 KIQDLKYLKKDYMAFLQAKDTRNVKMEIVVKHFLSLQGELLSELPTFLHLTSQFTIYLIS 580

Query: 622 RYHSLVLEYXXXXXXXXXXXXXXXXXXXXXXRELGDNFDILQMFSSSRFYTKQAVRGNWQ 681
            Y+ ++L+Y                      RE GDNFDILQ FSSSRFYTKQ +  NW 
Sbjct: 581 FYNRIMLDYLRVLSGGSRLLKRELQLLETGEREPGDNFDILQSFSSSRFYTKQLIHENWN 640

Query: 682 FPG 684
             G
Sbjct: 641 CHG 643

>YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required for
           cell fusion during mating, localizes to dots beneath the
           tip of mating projection (shmoo) [2034 bp, 677 aa]
          Length = 677

 Score =  234 bits (598), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 188/688 (27%), Positives = 323/688 (46%), Gaps = 72/688 (10%)

Query: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRT 103
           M K+  ++Y L YP    +TPIRDY  +   +N +     VR+     S  E        
Sbjct: 1   MFKTSYNLYDLNYPKNDSLTPIRDYKNDYFHKNDDKLPEIVRKPTRKLSKHE-------- 52

Query: 104 IQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNT-- 161
             ++N +     RP SL L    +    KK+ SP+N   F + + L    + P++ N+  
Sbjct: 53  -NKLNDKKFTNKRPASLDLHSIVESLSNKKIYSPINTEIFQNVVRLN---LSPQIPNSPH 108

Query: 162 -----LDVVKRLVQTEREYIKKLELGNSVYRFELQAK-KVGSMLLDKERNDELLLFGDLE 215
                  +V+    +E EY   L   N+VYR  L +  +  + L+  + +DELLLFG+++
Sbjct: 109 EGCKFYKIVQEFYLSEVEYYNNLLTANNVYRKALNSDPRFKNKLVKLDSSDELLLFGNID 168

Query: 216 TLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEHHFE 275
           T+AS+SKILV  +++ +     G   D+++  +++    +  +      DI    E H  
Sbjct: 169 TIASISKILVTAIKDLLLAKQRGKMLDANE-WQKIFTKNEVQQQLYSTFDISEAFEQHLL 227

Query: 276 RIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILKLPVERLRT 335
           RIK  Y +Y V+HQKQ+EL   +R   +  + KWY+ CL+++  IKLEDILK P++RL  
Sbjct: 228 RIKSTYTSYFVSHQKQMELFTTLRMNKNHFFNKWYEYCLKESGCIKLEDILKSPMKRLTQ 287

Query: 336 WGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVSTSERECNCEAKANLELTPTQI 395
           W    E +    E I S     +LS    +Y ++   + T   E    +  N  LTP++I
Sbjct: 288 WIDTLETLESCYEDILSPELGLKLSPTRRKYSLFSNKLETEVSEYKSNSMYNFSLTPSEI 347

Query: 396 IHFYE------------------CSVDPEVSAIDIKR----------KKSQSTALSVNTG 427
           I  Y+                  C+   + S +D  R            S  + L + T 
Sbjct: 348 IQSYDEDQFTHLLKPPDKQNKNICNASRQESNLDNSRVPSLLSGSSSYYSDVSGLEIVTN 407

Query: 428 TSSAYSEPNVLPSNKISDCKSPDSDYADLDRSICQFFSVRKGXXXXXXXXXXXXXAEIIC 487
           TS+A +E   L  ++       ++++  L   I +F  V KG             + II 
Sbjct: 408 TSTASAEMINLKMDE-------ETEFFTLADHISKFKKVMKGLLELKKNLLKNDLSGIID 460

Query: 488 QQLANAKTWHRLMDFE-PHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVI 546
             L     W ++++ E P      +   IS++ +++IDKL+ Q+ ++++L++  L+  V+
Sbjct: 461 ISLRRINAWKKVIECERPSGAFFAHDNLISTMCSSYIDKLHEQKNQVTILKLTELETDVM 520

Query: 547 DPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQR--DYHDIKKKVMAQSFEDAQALLAKE 604
           +PL  ++A   +V+ K+ DL+ L K+Y  +++++  +  DIK+ ++   F++ Q  + +E
Sbjct: 521 NPLERIIAHCTTVKSKLKDLQALKKDYMLFLQEKKANVRDIKRDLLGMHFQNLQNQMKRE 580

Query: 605 LPQFMAFMHKSISYLLLRYHSLVLEYXXXXXXXXXXXXXXXXXXXXXXRELGD------- 657
           LP F+  +H +I  +LL Y  + L+Y                        L D       
Sbjct: 581 LPVFITLIHDTIECILLNYIKVFLKYLEIIAGGKKYLQKDLENM-----SLNDSIATGQI 635

Query: 658 -NFDILQMFSSSRFYTKQAVRGNWQFPG 684
            N DILQ +S SR+ TK+ VR +W FPG
Sbjct: 636 KNLDILQCYSKSRYMTKRMVRKDWPFPG 663

>Scas_594.1
          Length = 651

 Score =  123 bits (308), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 103/415 (24%), Positives = 186/415 (44%), Gaps = 48/415 (11%)

Query: 303 STIYFKWYDRCLQKADLIKLEDILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLSDF 362
           S ++  WY+  L+  +L KLEDI K P+ R+  W  I   ++  ++  +      +L + 
Sbjct: 2   SDLFNAWYESXLKIGNLQKLEDIFKRPINRVNEWILILNDLISASKEATHTSNYERLIET 61

Query: 363 YDQYCVYLRGVSTSERECNCEAKANLELTPTQIIHFYECSV------DPEV-------SA 409
            ++Y  + + +     E N     N  LTP +II  Y+ ++       P+V        A
Sbjct: 62  RNRYKDFQKHIREQADEYNGNTMYNFSLTPNEIIQSYDNAICSPKHDQPQVVVYPPLNDA 121

Query: 410 IDIKRKKSQSTALSVNTGTSSAYSEPNVLP-------------SNKISDCKSPDSDYA-- 454
           I      + +T  S+ +  S + +  +                SNK + CK  DS +   
Sbjct: 122 IPYTDSFAANTYGSLQSRRSLSVASTSSSHYSSNNGSVDLKDHSNKENICK--DSVFQPP 179

Query: 455 --DLDRSICQFFSVRKGXXXXXXXXXXXXXAEIICQQLANAKTWHRLMDFE-PHNENCNN 511
              L+  I +F  + K                ++   L   KTW +++DF+ PH+ +   
Sbjct: 180 QLTLNDHIHKFKHIHKKLKILVGLIGNLDFHAVLDFNLRLGKTWKKMLDFDHPHDSH--- 236

Query: 512 SIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLVLLARTDSVRGKIDDLKVLSK 571
                + Y+ ++D +   +E+ ++L++  L+  V+ PL  +    + V+ ++ DLK L K
Sbjct: 237 ----DTKYSRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVVKLRLKDLKSLKK 292

Query: 572 EYKAYMKQR--DYHDIKKKVMAQSFEDAQALLAKELPQFMAFMHKSISYLLLRYHSLVLE 629
           +Y  Y+++R    HD+K+ V+ + FE+ Q  L  ELP F+   H+    +++ Y  ++L+
Sbjct: 293 DYMIYLQERKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLK 352

Query: 630 YXXXXXXXXXXXXXXXXXXXXXXRELGDNFDILQMFSSSRFYTKQAVRGNWQFPG 684
           Y                           NFDIL+ FS SR+ TK+A+R NW FPG
Sbjct: 353 YLETMSGGEADLSQDVSSLQKK------NFDILEAFSESRYNTKRAIRENWSFPG 401

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 7/173 (4%)

Query: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRT 103
           M K+      L YPAT  +TPIRDY  +   ++ N +   V R P   +  +     K T
Sbjct: 423 MFKTSKLFDDLHYPATDSLTPIRDYKNDYFHRDDN-KLPNVTRFPVLNNSTKISSHLKDT 481

Query: 104 IQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLD 163
                    N  RP SL L +  + P+ KK+ SPLNL  F   + L++P  +   +  LD
Sbjct: 482 TNF----YENIKRPASLDLSEIGE-PLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLD 536

Query: 164 VVKRLVQTEREYIKKLELGNSVYRFEL-QAKKVGSMLLDKERNDELLLFGDLE 215
           +++RL ++E EY + L + +S YR  L +       LL K+ N+ELLLFG+L+
Sbjct: 537 IIRRLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589

>CAGL0M04917g 537760..539520 weakly similar to sp|Q05670
           Saccharomyces cerevisiae YMR232w FUS2 required for cell
           fusion during mating, hypothetical start
          Length = 586

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 112/490 (22%), Positives = 216/490 (44%), Gaps = 58/490 (11%)

Query: 155 DPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGSM-LLDKERNDELLLFGD 213
           D K +N  +++K+ + +E +YI+  E   + YRF +Q KK+ S  + D    ++++LFG+
Sbjct: 78  DMKNINLREMLKKFIFSEEKYIEMTEKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGN 137

Query: 214 LETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEHH 273
           LET+ +VS + +  L                +I+ +L ++P  +    + L     +E H
Sbjct: 138 LETICAVSYLYLNSLS---------------KIVTKLELNPSSIDVIYDEL-----VELH 177

Query: 274 ---FERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILKLPV 330
              F R+K  Y +Y + +Q Q  L++ +    S I   WY R    A  IKL +IL+ P 
Sbjct: 178 VTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYDDARQIKLSEILQCPY 237

Query: 331 ERLRTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVSTSERECNCEAKANLEL 390
           + +  W    E + +  E +    +  +     + +  Y+  ++  + E N  +  +   
Sbjct: 238 KHVHDW---LENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNI-DNEDNVRSSQHRH- 292

Query: 391 TPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTGTSSAYSE---PNVLPSNKISDCK 447
             + I       ++PE S          +    + +  SS Y+E   P + P  KIS  +
Sbjct: 293 PISSIQISKSSDLNPESSG----PSDDGNFVAYIPSVASSVYTEVIKPRMSP--KISLDE 346

Query: 448 SPDSDYADLDRSICQFFSVRKGXXXXXXXXXXXXXAEIICQQLAN----AKTWHRLMD-- 501
            P +  AD + ++     + K                 I     N      +W  L+   
Sbjct: 347 KPCN--ADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIE 404

Query: 502 ----FEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLVLLARTD 557
               F+  +E  NN I +       +     ++EE+   +   L+  +I  L  +LA   
Sbjct: 405 KDSVFQNIHEQLNNKINLC------VKLYKEKKEELGAFKFLKLESFIIKKLETVLALMK 458

Query: 558 SVRGKIDDLKVLSKEYKAYMKQRDY--HDIKKKVMAQSFEDAQALLAKELPQFMAFMHKS 615
           +V+G I+DLKVL K+Y  + K++     DIK+ ++   +E  Q  L ++LP+F+ ++++ 
Sbjct: 459 TVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQF 518

Query: 616 ISYLLLRYHS 625
           +   LL +++
Sbjct: 519 MVLFLLSFNA 528

>KLLA0C07381g complement(643441..644847) similar to sp|Q03652
           Saccharomyces cerevisiae YMR211w singleton, start by
           similarity
          Length = 468

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 56/136 (41%), Gaps = 16/136 (11%)

Query: 33  FSCSIFEPVLAMIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGK------VRR 86
           ++C   EP+L     +N ++    P   +++    Y     L +  L  G       V  
Sbjct: 21  YNC--LEPLLHDADQENDVF--LNPNIDKVSKTVSYTPRALLWDAKLGNGSLGTYQYVSE 76

Query: 87  NPYSESLWEALGENKRTIQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDY 146
           N Y+++L    G   +T  R+ T  R R  P  L L+Q A   V  K++  +  + + DY
Sbjct: 77  NDYADTLDSEQGATAKTAHRVQTHDRIRKSPYQLALDQGA--TVLPKINDEI-AKYWSDY 133

Query: 147 MTLKSPKVDPKLLNTL 162
             L     DP   NTL
Sbjct: 134 SKL---IYDPSSFNTL 146

>Sklu_1916.2 YCL061C, Contig c1916 2062-5595
          Length = 1177

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 378 RECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTG 427
           ++C+C+++   +L PTQ    YE  V P ++ + +    S++  +S+N G
Sbjct: 113 QDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQV----SETIPVSINDG 158

>CAGL0I05720g complement(543158..544306) highly similar to sp|P23644
           Saccharomyces cerevisiae YMR203w TOM40, start by
           similarity
          Length = 382

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 49  NSIYQLAYPATGEMTPIRDYAAECQLQNRNL-QQGKVRRNPYSESLWEALGENKRTIQRI 107
           N  +Q ++  +   T + +YA      N NL  QG +  N +S S     G NK  I +I
Sbjct: 90  NPAFQTSHTFSIGSTSLPNYAFSALFANDNLFMQGNID-NDFSLSGRMNYGWNKNNISKI 148

Query: 108 NTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTF 143
           N Q+ N  +P   +LEQ+      +  DS LN ++ 
Sbjct: 149 NLQIAN-GQPTMCQLEQD-----YQASDSSLNFKSL 178

>KLLA0B05489g 488386..490023 similar to sp|P14747 Saccharomyces
           cerevisiae YML057w CMP2 calcineurin B, catalytic
           subunit, start by similarity
          Length = 545

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 35/86 (40%), Gaps = 3/86 (3%)

Query: 274 FERIKYLYLTYSVNHQKQLELLQQIRR-KHSTIYFKWYDRCLQKADLIKLEDILKLPVER 332
           FE + YLY    +N  K   LL+     KH T YF +   CL K DL   +   K     
Sbjct: 160 FECLIYLY-ALKINFPKTFWLLRGNHECKHLTSYFTFKAECLHKYDLSIFDACCK-SFNY 217

Query: 333 LRTWGAITEQVLLYTEGISSDLATAQ 358
           L     +  Q      GIS DL + Q
Sbjct: 218 LPLAAVMNNQYFCTHGGISPDLVSVQ 243

>Kwal_55.20110
          Length = 236

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 10/138 (7%)

Query: 112 RNRHRPRSLKLEQEADI--PVRKKVDSPLNLRTFGDYMTLKSPKVDPKLLNTLDVVKRLV 169
           R  ++ + LKL+   D   PV  + ++P  +RT  +   LK PKV  +  ++ +V K L 
Sbjct: 44  RQVNQAKQLKLKTALDTVDPVFGRKNTPFVVRTLAE---LKEPKVLSQGYDSQEVEKLLA 100

Query: 170 QTEREYIKKLEL---GNSVYRFELQAKKVGSMLLDKERNDELLLFGDLETLASVSKILVK 226
             E    ++LEL    N+   FE +A     + + +E    +L   +     ++ K++V+
Sbjct: 101 AVEAAKTEQLELSGFNNAPLSFEAEANGTDGLEVRRESIMRILSMRNACNKDAM-KLVVR 159

Query: 227 QLEEKIAEAYGGDKGDSD 244
           Q  E+  + + GD G S+
Sbjct: 160 QAREEF-QRFEGDTGSSE 176

>Sklu_2423.2 YDL077C, Contig c2423 3784-6858 reverse complement
          Length = 1024

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 484 EIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIYTAFIDKL---NHQREEISVLRVKH 540
           EI+ + L + + +  L+DF  H E    ++ I +     +D++   NH  E I +L + +
Sbjct: 617 EIVVKLLKDKQMFQELIDFYYHKEQHVCALEILTHLEEEVDEVKDPNHLEESIKMLVIDY 676

Query: 541 LKKGVIDPLLVLLARTDSVRGKIDDLKVL 569
           LKK   D L ++   TD +  + D+ +++
Sbjct: 677 LKKLSNDSLNIIFQYTDWLLERFDEDEII 705

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 13/115 (11%)

Query: 187 RFELQAKKVGSM-----LLDKERNDELLLFGDLETLASVSKILVKQLEEKIAEAYGGDKG 241
           +FE   +++G       +L +ER         LE      +  VKQLE+++AEA GG K 
Sbjct: 359 KFEEAEQELGQFREKHEVLKEERRKVEREIASLEVSLKAHRQQVKQLEQELAEALGGSK- 417

Query: 242 DSDQILKELRVHPDKLRAFIERLDIGTVLEHHFERIKYLYLTYSVNHQKQLELLQ 296
             +Q++ E R   ++++     L     LE  F++ +   L YS  HQ+   + Q
Sbjct: 418 --EQMVTEKRQVDEEIKTLKGNL---PSLEDKFQQCRDRELEYS--HQRNTAIQQ 465

>YGR264C (MES1) [2210] chr7 complement(1019603..1021858)
           Methionyl-tRNA synthetase, cytoplasmic, member of class
           I aminoacyl tRNA synthetase family, involved in
           Los1p-independent tRNA nuclear export [2256 bp, 751 aa]
          Length = 751

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)

Query: 152 PKVDPKLLNTLD-VVKRLVQTEREYIKKLELGNSVYRFE------------LQAKKVGSM 198
           PK DPK ++  D +VK + +    Y+K++ELG+     E            LQ  K+ + 
Sbjct: 602 PKFDPKKVSNYDGLVKDINEILSNYVKEMELGHERRGLEIAMSLSARGNQFLQENKLDNT 661

Query: 199 LLDK--ERNDELLLFGDLETLASVSKILVKQLEE 230
           L  +  E++D ++  G L  + +VS I+   + E
Sbjct: 662 LFSQSPEKSDAVVAVG-LNIIYAVSSIITPYMPE 694

>CAGL0L04532g 522091..524478 highly similar to sp|P13188
           Saccharomyces cerevisiae YOR168w GLN4, hypothetical
           start
          Length = 795

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 66/164 (40%), Gaps = 33/164 (20%)

Query: 88  PYSESLWEALGENKRTIQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNL---RTFG 144
           PY+ S      +    I RI+ +  N  +P   +   +  +P+ KK +SP+ +   R + 
Sbjct: 636 PYTVSFKSVEKDADGKITRIHVKYDNEDKPVKPRTYIQW-VPISKKYNSPVRVSETRVYN 694

Query: 145 DYMTLKSPKVDPK--------------------------LLNTLDVVKRLVQTEREYIKK 178
                ++P   P                           + N+  VV  +  +E  Y+K+
Sbjct: 695 QLFKSENPSAHPDGYLKDINPESEVIYDKSVIEHNFDHVIKNSPWVVDSVKNSEF-YVKE 753

Query: 179 LELGNSVYRFELQAKKVGSMLLDKERNDELLLFGDLETLASVSK 222
            + G  + RF  QA +VG   LDKE  D+ ++   + +L   +K
Sbjct: 754 DKSGKEICRF--QAMRVGYFTLDKESTDDKIILNRIVSLKDNTK 795

>Kwal_27.9739
          Length = 1198

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 199 LLDKERNDELLL-FGDLETLASVSKILVKQLEEKIAEAYGGDKGDSD---QILKELRVHP 254
           LL  +R+D +L  F D     + +++++K LEE I + +G D G      Q LK +    
Sbjct: 536 LLQPKRSDSMLSSFLDYALQLNDTEVVMKLLEESIVKKFGFDMGVYSYIFQFLKNIHCPD 595

Query: 255 DKLRAFIERLDIGTVLEHHFERIKYL 280
           D L  FI     G  L H  +R + L
Sbjct: 596 DYLLRFIN--SHGQYLSHSNDRFELL 619

>ADR388C [2129] [Homologous to ScYAL041W (CDC24) - SH]
           (1406345..1408630) [2286 bp, 761 aa]
          Length = 761

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 148 TLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGS 197
           T++ P+V+  L +   +VK  V+TER+Y+  LE+  S YR +L   ++ S
Sbjct: 251 TMEEPQVNGYLSDHNKIVKEFVETERKYVHDLEVL-SKYRQQLLENQIIS 299

>Kwal_56.22693
          Length = 984

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 551 VLLARTDSVRGKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQALLAKELPQFMA 610
           V+LAR++   GK   +KVL+KEY    K+  Y +I+K  + Q   D + ++      +  
Sbjct: 172 VMLARSND-SGKKYAVKVLNKEYLIRQKKVKYVNIEKNTL-QRLNDGRGVIK----LYFT 225

Query: 611 FMHKSISYLLLRY 623
           F  ++  Y LL Y
Sbjct: 226 FQDEASLYFLLEY 238

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 30/125 (24%)

Query: 225 VKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEHHFERIKYLYLTY 284
           VKQLE K+AE+                      ++    +D   ++E   E++K L L  
Sbjct: 812 VKQLENKLAESE---------------------KSTTVMVDAKRLVEQELEKVKALLLKE 850

Query: 285 SVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLE--------DILKLPVERLRTW 336
           +   Q+  ELL+  + K   I  KW D  L   D ++ E        D L+L +E+ +  
Sbjct: 851 TSELQQSQELLEATKTKQIQIQQKW-DETLSIKDSLETENLELSKEADNLRLELEKTKNA 909

Query: 337 GAITE 341
             ++E
Sbjct: 910 SDLSE 914

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,609,334
Number of extensions: 855142
Number of successful extensions: 2983
Number of sequences better than 10.0: 50
Number of HSP's gapped: 3060
Number of HSP's successfully gapped: 54
Length of query: 685
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 577
Effective length of database: 12,857,365
Effective search space: 7418699605
Effective search space used: 7418699605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)