Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR167C35935217870.0
Sklu_2171.436235415610.0
Kwal_14.178936335515520.0
Scas_686.2241635315550.0
KLLA0F09603g35434615460.0
CAGL0K06831g35834515280.0
YBR221C (PDB1)36632814960.0
Sklu_2101.356869720.63
AAR136W61775691.3
Scas_640.2216046617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR167C
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   692   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           605   0.0  
Kwal_14.1789                                                          602   0.0  
Scas_686.22                                                           603   0.0  
KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   600   0.0  
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   593   0.0  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   580   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            32   0.63 
AAR136W [323] [Homologous to ScYDR419W (RAD30) - SH] complement(...    31   1.3  
Scas_640.22                                                            28   7.8  

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/352 (96%), Positives = 338/352 (96%)

Query: 1   MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVA 60
           MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVA
Sbjct: 1   MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVA 60

Query: 61  QYNGAYKVTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQAID 120
           QYNGAYKVTKGLLDRFGERRVVDTPITEM              KPIVEFMSFNFSMQAID
Sbjct: 61  QYNGAYKVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLKPIVEFMSFNFSMQAID 120

Query: 121 HVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAE 180
           HVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAE
Sbjct: 121 HVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAE 180

Query: 181 DARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITY 240
           DARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITY
Sbjct: 181 DARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITY 240

Query: 241 SRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGV 300
           SRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGV
Sbjct: 241 SRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGV 300

Query: 301 GSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAA 352
           GSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAA
Sbjct: 301 GSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAA 352

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/354 (83%), Positives = 316/354 (89%), Gaps = 3/354 (0%)

Query: 1   MSSRFSLVSNLTRSLSSVG-RMQQMRFASSKS--MTVRDALNSAMAEEMDRDDDVFIIGE 57
           MSS FS     T  L++   R+   R AS+K+  MTVR+ALNSAMAEE+DRDDDVFIIGE
Sbjct: 1   MSSTFSAAVARTAKLAAAPFRLNATRMASTKTTKMTVREALNSAMAEELDRDDDVFIIGE 60

Query: 58  EVAQYNGAYKVTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQ 117
           EVAQYNGAYKVTKGLLDR+GERRVVDTPITEM              KP+VEFMSFNFSMQ
Sbjct: 61  EVAQYNGAYKVTKGLLDRYGERRVVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNFSMQ 120

Query: 118 AIDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPY 177
           AIDHVVNSAAKTYYMSGG Q CQIVFRGPNGAAVGV AQHSQDYTAWYGSIPGLKVL PY
Sbjct: 121 AIDHVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVLSPY 180

Query: 178 SAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISI 237
           SAEDARGLLKAAIRDPNPVVFLENELLYGESF+VSEEVLS DFTLPYT+KVEREG+DISI
Sbjct: 181 SAEDARGLLKAAIRDPNPVVFLENELLYGESFDVSEEVLSTDFTLPYTAKVEREGSDISI 240

Query: 238 ITYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPA 297
           +TY+RNVQFSL AAEIL+KQ+GVS EV+N+RSIRPLD+DAIIKTVKKTNHLITVE+TFPA
Sbjct: 241 VTYTRNVQFSLQAAEILEKQHGVSVEVVNLRSIRPLDVDAIIKTVKKTNHLITVESTFPA 300

Query: 298 FGVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRA 351
           FGVGSEIIAQIMESEAFD+LDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRA
Sbjct: 301 FGVGSEIIAQIMESEAFDYLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRA 354

>Kwal_14.1789
          Length = 363

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/355 (82%), Positives = 314/355 (88%), Gaps = 4/355 (1%)

Query: 1   MSSRFS--LVSNLTRSLSSVGRMQQM--RFASSKSMTVRDALNSAMAEEMDRDDDVFIIG 56
           M+ +FS  ++S   + L   GR   +  R AS+K+MTVRDALNSAMAEEMDRDDDVFIIG
Sbjct: 1   MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIG 60

Query: 57  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSM 116
           EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEM              KPIVEFMSFNFSM
Sbjct: 61  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSM 120

Query: 117 QAIDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCP 176
           QAID VVNSAAKTYYMSGG Q CQIVFRGPNGAAVGV AQHSQD++AWYGSIPG+KVL P
Sbjct: 121 QAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVP 180

Query: 177 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDIS 236
           YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEE LS DFTLPYT+KVEREGTDIS
Sbjct: 181 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDIS 240

Query: 237 IITYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFP 296
           IITY+RNVQFSL AAEILDKQYGVSAEVIN+RSIRP+D++AIIKTVKKTNHLITVE+TFP
Sbjct: 241 IITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFP 300

Query: 297 AFGVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRA 351
            FGVGSEI+AQIMESEAFD+LDAPV+RVTGADVPTPYAKELEDFAFPDPD IV A
Sbjct: 301 NFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSA 355

>Scas_686.22
          Length = 416

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/353 (82%), Positives = 318/353 (90%), Gaps = 3/353 (0%)

Query: 1   MSSRFSLVSNLTRSLSSVG--RMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEE 58
           MS R    +N+TR ++S    R Q +R+ASSK+MTVR+ALN+AMAEE+DRDDDVFIIGEE
Sbjct: 57  MSFRLPF-TNVTRRIASSSPLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEE 115

Query: 59  VAQYNGAYKVTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQA 118
           VAQYNGAYKVTKGLLDRFGERRVVDTPITEM              KPIVEFMSFNFSMQA
Sbjct: 116 VAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQA 175

Query: 119 IDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYS 178
           ID VVNSAAKT+YMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGSIPGLKVL PYS
Sbjct: 176 IDQVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYS 235

Query: 179 AEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISII 238
           AEDARGLLKAAIRDPNPVVFLENELLYGESFE+S+E LSPDFTLPY +KVEREGTDISII
Sbjct: 236 AEDARGLLKAAIRDPNPVVFLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISII 295

Query: 239 TYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAF 298
           TY+RNVQFSL AA IL+KQYGVS EVIN+RSIRPLD+DAI+KTVKKTNHLITVE+TFP+F
Sbjct: 296 TYTRNVQFSLEAAAILEKQYGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSF 355

Query: 299 GVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRA 351
           GVG+EIIA++MESEAFD+LDAP+QRVTGADVPTPYAKELEDFAFPDPDTIVRA
Sbjct: 356 GVGAEIIARVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRA 408

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/346 (82%), Positives = 314/346 (90%), Gaps = 2/346 (0%)

Query: 7   LVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAY 66
           L +   R++ SV  +Q MRFAS+K+MTVR+ALNSAMAEEMDRDDDVFIIGEEVAQYNGAY
Sbjct: 4   LSNTFKRAVPSV--VQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAY 61

Query: 67  KVTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNSA 126
           KVTKGLLDRFGERRVVDTPITEM              KPIVEFMSFNFSMQA+D V+NSA
Sbjct: 62  KVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSA 121

Query: 127 AKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLL 186
           AKTYYMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGS+PG+KVL PYSAEDARGLL
Sbjct: 122 AKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLL 181

Query: 187 KAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQF 246
           KAAIRDPNPVVFLENELLYG+SFEVSEE LS DFTLPY +KVEREG+DISII+Y+RNVQF
Sbjct: 182 KAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQF 241

Query: 247 SLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIA 306
           SL AAEIL KQYGVSAEVIN+R+IRPLD++AII TVKKTNHLITVE+TFPAFGVG+EIIA
Sbjct: 242 SLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIA 301

Query: 307 QIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAA 352
           QIMESEAFD+LDAP+QRVTGA+VPTPYAKELEDFAFPDPDTIVRAA
Sbjct: 302 QIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAA 347

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/345 (82%), Positives = 314/345 (91%), Gaps = 4/345 (1%)

Query: 11  LTRSLSSVGRM---QQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYK 67
           LTR L+ + R+     +R AS+K+MTVR+ALNSA+AEE+DRDDDVFIIGEEVAQYNGAYK
Sbjct: 8   LTR-LTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGAYK 66

Query: 68  VTKGLLDRFGERRVVDTPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNSAA 127
           VTKGLLDRFGERRVVDTPITE               KPIVEFMSFNFSMQAIDHVVNSAA
Sbjct: 67  VTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAA 126

Query: 128 KTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLK 187
           KT+YMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGSIPGLKVL PYSAEDARGLLK
Sbjct: 127 KTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLK 186

Query: 188 AAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQFS 247
           AAIRDPNPVVFLENELLYGE FEVSEE LSPDFTLPYT+KVE+EG DISIITY+RN +FS
Sbjct: 187 AAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTEFS 246

Query: 248 LAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIAQ 307
           LAAA+IL+++YGVSAEVIN+RSIRPLDIDAI+KTVKKTNHLITVE+TFP+FGVG+EIIAQ
Sbjct: 247 LAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEIIAQ 306

Query: 308 IMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAA 352
           +MESEAFD+LDAP+QRVTGADVPTPYAKELEDFAFPDP+TIVRAA
Sbjct: 307 VMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAA 351

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/328 (82%), Positives = 301/328 (91%)

Query: 24  MRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVD 83
           +RF+S+K+MTVR+ALNSAMAEE+DRDDDVF+IGEEVAQYNGAYKV+KGLLDRFGERRVVD
Sbjct: 31  LRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRVVD 90

Query: 84  TPITEMXXXXXXXXXXXXXXKPIVEFMSFNFSMQAIDHVVNSAAKTYYMSGGVQTCQIVF 143
           TPITE               KPIVEFMSFNFSMQAIDHVVNSAAKT+YMSGG Q CQ+VF
Sbjct: 91  TPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQMVF 150

Query: 144 RGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLKAAIRDPNPVVFLENEL 203
           RGPNGAAVGV AQHSQD++ WYGSIPGLKVL PYSAEDARGLLKAAIRDPNPVVFLENEL
Sbjct: 151 RGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENEL 210

Query: 204 LYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQFSLAAAEILDKQYGVSAE 263
           LYGESFE+SEE LSP+FTLPY +K+EREGTDISI+TY+RNVQFSL AAEIL K+YGVSAE
Sbjct: 211 LYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKYGVSAE 270

Query: 264 VINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIAQIMESEAFDHLDAPVQR 323
           VIN+RSIRPLD +AIIKTVKKTNHLITVE+TFP+FGVG+EI+AQ+MESEAFD+LDAP+QR
Sbjct: 271 VINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAPIQR 330

Query: 324 VTGADVPTPYAKELEDFAFPDPDTIVRA 351
           VTGADVPTPYAKELEDFAFPD  TIV+A
Sbjct: 331 VTGADVPTPYAKELEDFAFPDTPTIVKA 358

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 173 VLCPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREG 232
           +L P+ +ED++G+L   I D   + F+E E ++   F+       PD  LP  + +    
Sbjct: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245

Query: 233 TDISIITYS 241
           T+I+ + Y+
Sbjct: 246 TEITFLNYN 254

>AAR136W [323] [Homologous to ScYDR419W (RAD30) - SH]
           complement(584208..586061) [1854 bp, 617 aa]
          Length = 617

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 32/75 (42%), Gaps = 12/75 (16%)

Query: 122 VVNSAAKTYYMSGGVQTCQIVFRGPN----GAAVGVAAQHSQDYTAWYGSIPGLKVLCPY 177
           V N+A +T+   GG       F  P+    G A+G       +     GSIP L+ LCP 
Sbjct: 277 VRNAAVETFLDQGG-------FELPSFWTLGGAIGKELLDLLELPP-AGSIPALRALCPE 328

Query: 178 SAEDARGLLKAAIRD 192
           S E     L   IRD
Sbjct: 329 SPEQLHACLLRRIRD 343

>Scas_640.22
          Length = 160

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 147 NGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLKAAIRD 192
           NG +V  AA+      A   S+P +K+ C   AEDA   +KAAI+D
Sbjct: 106 NGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAEDA---IKAAIKD 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,935,947
Number of extensions: 381144
Number of successful extensions: 1027
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1048
Number of HSP's successfully gapped: 11
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)