Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR162C1171115057990.0
KLLA0C05764g1173115050950.0
Kwal_14.18031174114950290.0
YBR218C (PYC2)1180114849950.0
YGL062W (PYC1)1178114849830.0
CAGL0F06941g1180114849420.0
Scas_686.171176114749280.0
CAGL0K06787g1175114649040.0
Sklu_1458.11132110948760.0
Scas_563.121216115548380.0
CAGL0M05533g18344887182e-77
YBR208C (DUR1,2)18354736817e-73
Sklu_2124.118304876782e-72
Scas_721.4018344836658e-71
ADR051C18194846649e-71
KLLA0E08107g18294596523e-69
Kwal_27.1195118694876425e-68
Scas_720.7422315124785e-48
YMR207C (HFA1)21234364767e-48
CAGL0L10780g22335124741e-47
KLLA0F06072g22315584632e-46
AAR071W22315134599e-46
YNR016C (ACC1)22335194526e-45
Kwal_23.615722305234472e-44
Kwal_33.1406122212321162e-05
Sklu_2331.122202321162e-05
CAGL0L05676g22112321162e-05
Scas_582.4*21931561143e-05
ABR157W11132221134e-05
ACR263C22402321119e-05
YJL130C (URA2)22141561091e-04
Kwal_55.197831121148960.005
CAGL0C04917g1113156920.012
KLLA0E15444g2228165920.015
Sklu_2413.41122218890.029
YJR109C (CPA2)1118156880.039
KLLA0F03190g1117129870.050
Kwal_27.1209039490780.46
Scas_701.3543090780.48
KLLA0E23782g39399770.67
AGR127C56268770.72
Kwal_47.19231795121770.75
Scas_691.191117129751.2
Kwal_56.2440144190732.0
YDL131W (LYS21)44090732.0
KLLA0F05489g44190722.2
CAGL0J09240g43790722.2
YDL182W (LYS20)42890722.3
CAGL0J06402g43190722.3
Scas_704.343890722.6
YMR278W62263713.2
Sklu_2431.239499695.7
ADR107W44274686.5
Scas_712.1779398697.0
Sklu_2433.7796153679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR162C
         (1150 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  2238   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  1967   0.0  
Kwal_14.1803                                                         1941   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  1928   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  1924   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  1908   0.0  
Scas_686.17                                                          1902   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  1893   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        1882   0.0  
Scas_563.12                                                          1868   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   281   2e-77
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   266   7e-73
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          265   2e-72
Scas_721.40                                                           260   8e-71
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   260   9e-71
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   255   3e-69
Kwal_27.11951                                                         251   5e-68
Scas_720.74                                                           188   5e-48
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   187   7e-48
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   187   1e-47
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   182   2e-46
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   181   9e-46
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   178   6e-45
Kwal_23.6157                                                          176   2e-44
Kwal_33.14061                                                          49   2e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            49   2e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    49   2e-05
Scas_582.4*                                                            49   3e-05
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    48   4e-05
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    47   9e-05
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    47   1e-04
Kwal_55.19783                                                          42   0.005
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    40   0.012
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    40   0.015
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          39   0.029
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    39   0.039
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    38   0.050
Kwal_27.12090                                                          35   0.46 
Scas_701.35                                                            35   0.48 
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    34   0.67 
AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH] (992732..99...    34   0.72 
Kwal_47.19231                                                          34   0.75 
Scas_691.19                                                            33   1.2  
Kwal_56.24401                                                          33   2.0  
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    33   2.0  
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    32   2.2  
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    32   2.2  
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    32   2.3  
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    32   2.3  
Scas_704.3                                                             32   2.6  
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    32   3.2  
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            31   5.7  
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    31   6.5  
Scas_712.17                                                            31   7.0  
Sklu_2433.7 YGL234W, Contig c2433 9525-11915                           30   9.9  

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 2238 bits (5799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1092/1150 (94%), Positives = 1092/1150 (94%)

Query: 1    MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQK 60
            MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQK
Sbjct: 1    MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQK 60

Query: 61   ADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGIT 120
            ADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGIT
Sbjct: 61   ADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGIT 120

Query: 121  WIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAF 180
            WIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAF
Sbjct: 121  WIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAF 180

Query: 181  XXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNV 240
                         DDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNV
Sbjct: 181  GGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNV 240

Query: 241  VHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ 300
            VHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ
Sbjct: 241  VHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ 300

Query: 301  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCR 360
            NRHYFIEINPRIQVEHTITEEIT               SLEQLGLMQDRITTRGFAIQCR
Sbjct: 301  NRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCR 360

Query: 361  ITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYE 420
            ITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYE
Sbjct: 361  ITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYE 420

Query: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRA 480
            IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRA
Sbjct: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRA 480

Query: 481  QKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEH 540
            QKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEH
Sbjct: 481  QKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEH 540

Query: 541  GPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWG 600
            GPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYD                  ECWG
Sbjct: 541  GPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWG 600

Query: 601  GATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660
            GATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE
Sbjct: 601  GATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660

Query: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEK 720
            NGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEK 720

Query: 721  IVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAIS 780
            IVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAIS
Sbjct: 721  IVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAIS 780

Query: 781  GADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEA 840
            GADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEA 840

Query: 841  DLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSK 900
            DLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSK
Sbjct: 841  DLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSK 900

Query: 901  VVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXX 960
            VVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSD      
Sbjct: 901  VVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKR 960

Query: 961  XXXXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSV 1020
                  PGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSV
Sbjct: 961  RKLKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSV 1020

Query: 1021 LPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVAD 1080
            LPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVAD
Sbjct: 1021 LPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVAD 1080

Query: 1081 KSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS 1140
            KSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS
Sbjct: 1081 KSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS 1140

Query: 1141 PSDGQVKDVF 1150
            PSDGQVKDVF
Sbjct: 1141 PSDGQVKDVF 1150

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 1967 bits (5095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 942/1150 (81%), Positives = 1021/1150 (88%)

Query: 1    MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQK 60
            M SQLAG R +SNL+GEKNK+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLSMHR K
Sbjct: 1    MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLK 60

Query: 61   ADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGIT 120
            ADEAY+IG +G+YTPVGAYLAIDEI+ IA+ H V+FIHPGYGFLSEN+EFA KV  +GIT
Sbjct: 61   ADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGIT 120

Query: 121  WIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAF 180
            W+GPPA+VI++VGDKVSARNLA  A+VP VPGT GPI +VEEA+ FV KYG+PVIIKAAF
Sbjct: 121  WVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAF 180

Query: 181  XXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNV 240
                         DDI DAFQRA+SEA TAFGNGTCF+ERFLD+PKHIEVQLLADNYGNV
Sbjct: 181  GGGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNV 240

Query: 241  VHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ 300
            VHLFERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK +GYRNAGTAEFLVD Q
Sbjct: 241  VHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ 300

Query: 301  NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCR 360
            NRHYFIEINPRIQVEHTITEEIT               +LEQLGLMQD+ITTRGFAIQCR
Sbjct: 301  NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCR 360

Query: 361  ITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYE 420
            ITTEDPSKNFQPDTGR+DVYRSAGGNGVRLDGGNAFAG+VISPHYDSMLVKCSCSGSTYE
Sbjct: 361  ITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYE 420

Query: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRA 480
            IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF SG+YWTTFIDDTPQLFEMV+SQNRA
Sbjct: 421  IVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRA 480

Query: 481  QKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEH 540
            QKLL YL+DLAVNGSSIKGQ+G+PKL   P+IP LHN  G ++DV ++PPAGWR VLL++
Sbjct: 481  QKLLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDY 540

Query: 541  GPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWG 600
            GPE FAK+VR+F+GTLL DTTWRDAHQSLLATRVRTYD                  ECWG
Sbjct: 541  GPEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWG 600

Query: 601  GATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660
            GATFDV+MRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+
Sbjct: 601  GATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKD 660

Query: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEK 720
            NGVDIFRVFDALNDLEQLKVGVDAVKKA G+VEATICYSGDML PGKKYNLDYYL++TEK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEK 720

Query: 721  IVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAIS 780
            IV  GTHILGIKDMAGT+KP AA+LLIGSIRAKYP+LPIHVHTHDSAGTGVASM  CA+S
Sbjct: 721  IVNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALS 780

Query: 781  GADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEA 840
            GADVVDVATNSMSGLTSQPSI AL A+L G+I   V+  +  ELDAYWAEMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEA 840

Query: 841  DLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSK 900
            DLKGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+WAETKRAY EAN LLGDLVKVTPTSK
Sbjct: 841  DLKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSK 900

Query: 901  VVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXX 960
            VVGDLAQFMVSN+L SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLR+D      
Sbjct: 901  VVGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKR 960

Query: 961  XXXXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSV 1020
                  PGLELAPF+L+KI+E+L +RF +IDECDVASYNMYPKVYEDFRKI+E YGDLSV
Sbjct: 961  RKLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSV 1020

Query: 1021 LPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVAD 1080
            LPT NFLSPP IGEEI+VTIEQGK LIIK QAIGDLNKETG REVYFELNGELRKVSVAD
Sbjct: 1021 LPTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVAD 1080

Query: 1081 KSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISS 1140
            +SQK+E+VSK KADAHD FQ+G+PMAGV++EVKVHKGS + KGQPVAVLSAMKMEMVISS
Sbjct: 1081 RSQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISS 1140

Query: 1141 PSDGQVKDVF 1150
            P+DGQVK+V 
Sbjct: 1141 PADGQVKEVL 1150

>Kwal_14.1803
          Length = 1174

 Score = 1941 bits (5029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 934/1149 (81%), Positives = 1016/1149 (88%), Gaps = 1/1149 (0%)

Query: 3    SQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKAD 62
            S+LAG R  SNLLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLSMHR KAD
Sbjct: 2    SKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKAD 61

Query: 63   EAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWI 122
            EAYMIG++G+YTPVGAYLAIDEIL IA++H+VDFIHPGYGFLSEN+EFA KVE AGITWI
Sbjct: 62   EAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWI 121

Query: 123  GPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXX 182
            GP A VI++VGDKVSARNLAA A+VP VPGT GPI SVEEA+ FV +YGYPVIIKAAF  
Sbjct: 122  GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGG 181

Query: 183  XXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVH 242
                       DDI DAFQRA SEA+T+FGNGTCF+ERFL++PKHIEVQLLAD YGNVVH
Sbjct: 182  GGRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVH 241

Query: 243  LFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNR 302
            LFERDCSVQRRHQKVVEVAPAKTL K+VRDAILTDAVKLA  + Y+NAGTAEFLVD QNR
Sbjct: 242  LFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNR 301

Query: 303  HYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRIT 362
            HYFIEINPRIQVEHTITEEIT               SL+QLGL+QDRITTRGFAIQCRIT
Sbjct: 302  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRIT 361

Query: 363  TEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIV 422
            TEDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG++ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 362  TEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIV 421

Query: 423  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQK 482
            RRKMLRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF+MV+SQNRAQK
Sbjct: 422  RRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481

Query: 483  LLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHG 541
            LL YL+DLAVNGSSIKGQMG+PKL  QP++P +H+A+G VIDV  + PP+GWRQVLLE G
Sbjct: 482  LLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKG 541

Query: 542  PEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGG 601
            P  FAK VRE +GTLL DTTWRDAHQSLLATRVRTYD                  ECWGG
Sbjct: 542  PAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGG 601

Query: 602  ATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661
            ATFDVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN
Sbjct: 602  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661

Query: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKI 721
            GVDIFRVFDALNDLEQLKVGVDAVKKA+G+VEATICYSGDMLQ GKKYNLDYYLE+T+KI
Sbjct: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDKI 721

Query: 722  VAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISG 781
            VAMGTHILGIKDMAGT+KP AAKLLIGSIRAKYPDLPIHVHTHDSAGT VASM  CA +G
Sbjct: 722  VAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAG 781

Query: 782  ADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEAD 841
            ADVVDVATNSMSGLTSQPSI AL ASL G+I T ++ +   ELDAYWA+MRLLYSCFEAD
Sbjct: 782  ADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEAD 841

Query: 842  LKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKV 901
            LKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+W+ETKRAY EAN LLGDLVKVTPTSKV
Sbjct: 842  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKV 901

Query: 902  VGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXX 961
            VGDLAQFMVSN+L+SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSD       
Sbjct: 902  VGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRR 961

Query: 962  XXXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021
                 PGLE+APFDL KI+E+L+ RF +I+ECDVASYNMYPKVYEDFRKIRETYGDLSVL
Sbjct: 962  KLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021

Query: 1022 PTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADK 1081
            PT NFLSPP +GEEI+VTIE+GK LIIK QAIG+LNKETG REVYF+LNGELRKV+V DK
Sbjct: 1022 PTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDK 1081

Query: 1082 SQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSP 1141
            SQK++ +SK KADAHD +Q+GAPMAGVIIEVKVH GS V +GQPVAVLSAMKMEMVISSP
Sbjct: 1082 SQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSP 1141

Query: 1142 SDGQVKDVF 1150
             DGQVK+V 
Sbjct: 1142 IDGQVKEVL 1150

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 1928 bits (4995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1148 (80%), Positives = 1012/1148 (88%), Gaps = 1/1148 (0%)

Query: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63
            +LAG R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM T+A+YS+EDRLSMHR KADE
Sbjct: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65

Query: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123
            AY+IG EGQYTPVGAYLA+DEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125

Query: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXX 183
            PPA VI++VGDKVSAR+LAA A+VPTVPGT GPI +V+EA +FV +YGYPVIIKAAF   
Sbjct: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGG 185

Query: 184  XXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243
                      DD+ DAFQRA SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHL
Sbjct: 186  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245

Query: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303
            FERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               +L QLGL+QD+ITTRGF+IQCRITT
Sbjct: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITT 365

Query: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423
            EDPSKNFQPDTGRL+VYRSAGGNGVRLDGGNA+AGA ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485

Query: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542
            L YL+DLAVNGSSIKGQ+G+PKL + PS+P LH+A+G VI+V +S PP+GWRQVLLE GP
Sbjct: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545

Query: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGGA 602
              FAK+VR+F+GTLL DTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605

Query: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665

Query: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722
            VDIFRVFDALNDLEQLKVGV+AVKKA G+VEAT+CYSGDMLQPGKKYNLDYYLE+ EKIV
Sbjct: 666  VDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVEKIV 725

Query: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782
             MGTHILGIKDMAGTMKP AAKLLIGS+R +YPDLPIHVH+HDSAGT VASM  CA++GA
Sbjct: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785

Query: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSI AL ASL G+I TG++ +H  ELDAYWAEMRLLYSCFEADL
Sbjct: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845

Query: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902
            KGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQWAETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905

Query: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXXX 962
            GDLAQFMVSN+L SDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLRSD        
Sbjct: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965

Query: 963  XXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
                PGLEL PFDL+KIRE+L++RF +IDECDVASYNMYP+VYEDF+KIRETYGDLSVLP
Sbjct: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025

Query: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082
            T NFL+P +  EEI VTIEQGK LIIKLQA+GDLNK+TG+REVYFELNGELRK+ VADKS
Sbjct: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085

Query: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142
            Q +++V+K KAD HD  Q+GAPMAGVIIEVKVHKGS V KG+ +AVLSAMKMEMV+SSP+
Sbjct: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145

Query: 1143 DGQVKDVF 1150
            DGQVKDVF
Sbjct: 1146 DGQVKDVF 1153

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 1924 bits (4983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1148 (80%), Positives = 1009/1148 (87%), Gaps = 1/1148 (0%)

Query: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63
            + AG R + NLLGEKNK+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLS H+QKADE
Sbjct: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64

Query: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123
            AY+IG  GQYTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124

Query: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXX 183
            PPA VI++VGDKVSARNLAA A+VPTVPGT GPI +VEEA +FV +YGYPVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGG 184

Query: 184  XXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243
                      DD+ DAFQRA SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHL
Sbjct: 185  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244

Query: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303
            FERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               SL QLGL QD+ITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITT 364

Query: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG +ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484

Query: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542
            L YL+D+AVNGSSIKGQ+G+PKL + PS+P LH+A+G VI+V +S PP+GWRQVLLE GP
Sbjct: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544

Query: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGGA 602
              FA++VR+F+GTLL DTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604

Query: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664

Query: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722
            VDIFRVFDALNDLEQLKVGVDAVKKA G+VEAT+C+SGDMLQPGKKYNLDYYLE+ EKIV
Sbjct: 665  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIAEKIV 724

Query: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782
             MGTHILGIKDMAGTMKP AAKLLIGS+RAKYPDLPIHVHTHDSAGT VASM  CA++GA
Sbjct: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784

Query: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSI AL ASL G+I TG++ +H  ELDAYWAEMRLLYSCFEADL
Sbjct: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844

Query: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902
            KGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQWAETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904

Query: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXXX 962
            GDLAQFMVSN+L SDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP RSD        
Sbjct: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964

Query: 963  XXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
                PGLEL PFDL+KIRE+L++RF ++DECDVASYNMYP+VYEDF+K+RETYGDLSVLP
Sbjct: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024

Query: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082
            T +FLSP +  EEI V IEQGK LIIKLQA+GDLNK+TG+REVYF+LNGE+RK+ VAD+S
Sbjct: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084

Query: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142
            QK+ETV+K KAD HD   +GAPMAGVI+EVKVHKGS + KGQPVAVLSAMKMEM+ISSPS
Sbjct: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144

Query: 1143 DGQVKDVF 1150
            DGQVK+VF
Sbjct: 1145 DGQVKEVF 1152

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 1908 bits (4942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1148 (80%), Positives = 1001/1148 (87%), Gaps = 1/1148 (0%)

Query: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63
            +LAG R + N+LGEK+K+LVANRGEIPIRIFRTAHELSM TVA+YS+EDRLS HR KADE
Sbjct: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68

Query: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123
            AY+IG EGQYTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV+ AGITWIG
Sbjct: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128

Query: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXX 183
            PP  VIE+VGDKVSARNLAA A VPTVPGT GPI +VEEAE FV +YGYPVIIKAA+   
Sbjct: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGG 188

Query: 184  XXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243
                      +DI DAFQRA SEA+TAFGNGTCFVERFLD+PKHIEVQLLADN+GNV+HL
Sbjct: 189  GRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248

Query: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303
            FERDCSVQRRHQKVVEVAPAKTL ++VRDAILTDAVKLAK +GYRNAGTAEFLVD QNRH
Sbjct: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               SL +LGL+QDRITTRGFAIQCRITT
Sbjct: 309  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITT 368

Query: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGR++VY S GGNGVRLDGGNA+AGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483
            RK++RALIEFRIRGVKTNIPFLLTLLTHPVFISG YWTTFIDDTPQLF MV+SQNRAQKL
Sbjct: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488

Query: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHGP 542
            L YL+DLAVNGSSIKGQ+G+PKL  +P+IP LH+ KGE+I V +  PP GWRQVLLE GP
Sbjct: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548

Query: 543  EVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGGA 602
            E FAK VR F GTLL DTTWRDAHQSLLATRVRT+D                  ECWGGA
Sbjct: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGGA 608

Query: 603  TFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668

Query: 663  VDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIV 722
            VDIFRVFDALNDLEQLKVGVDAVKKA G+VEAT+CYSGDMLQPGKKYNLDYYLE+T+KIV
Sbjct: 669  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIV 728

Query: 723  AMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGA 782
             MGTH+LGIKDMAGT+KP AAKLLIGSIRAKYPDLPIHVH+HDSAGT VASM  CA +GA
Sbjct: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788

Query: 783  DVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADL 842
            DVVDVA NSMSG+TSQ SI AL ASL G+I TGV+  HA ELDAYWAEMRLLYSCFEADL
Sbjct: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848

Query: 843  KGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVV 902
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETKRAY EAN LLGD+VKVTPTSKVV
Sbjct: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908

Query: 903  GDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXXX 962
            GDLAQFMV+N+L S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD        
Sbjct: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968

Query: 963  XXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
                PGLEL PFDL+ IRE+L +RF  IDECDVASYNMYPKVYEDF+K++E YGDLSVLP
Sbjct: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028

Query: 1023 THNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKS 1082
            T NFL+PP IGE+I V +EQGK LIIKLQA+GDLNKETG R+VYFELNGE+RK+ V D+S
Sbjct: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088

Query: 1083 QKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPS 1142
            QK+E VSK KAD HD FQ+GAPMAGVI+EVKVHKGS V KGQPVA+LSAMKMEMV+SS +
Sbjct: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148

Query: 1143 DGQVKDVF 1150
            DGQVKDVF
Sbjct: 1149 DGQVKDVF 1156

>Scas_686.17
          Length = 1176

 Score = 1902 bits (4928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 914/1147 (79%), Positives = 999/1147 (87%)

Query: 4    QLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADE 63
            +L+G R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLS HR KADE
Sbjct: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64

Query: 64   AYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIG 123
            +Y+IG EGQ+TPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSEN+EFA KV  AGITWIG
Sbjct: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124

Query: 124  PPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXX 183
            PPA VI++VGDKVSAR LAA ADVPTVPGT GPI SV+EAE+FV +YGYPVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGG 184

Query: 184  XXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHL 243
                      +DI DAFQRA SEA TAFG+GTCFVERFLD PKHIEVQLL DNYGNVVHL
Sbjct: 185  GRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244

Query: 244  FERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRH 303
            FERDCSVQRRHQKVVEVAPAK + +EVRDAILTDAVKLAK  GYRNAGTAEFLVD QNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 304  YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITT 363
            YFIEINPRIQVEHTITEEIT               SL QLGL+QDRITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITT 364

Query: 364  EDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVR 423
            EDP+KNFQPDTGRL+VYRSAGGNGVRLDGGNA+AGAVISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424

Query: 424  RKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKL 483
            RKM+RALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF+MV+SQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484

Query: 484  LQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEHGPE 543
            L YL+DLAVNGSSIKGQ+G+PKL   P +P LH+A+G VI+V + P AGWR+VLLE GP 
Sbjct: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINVATPPTAGWRKVLLEQGPA 544

Query: 544  VFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGGAT 603
             FAK+VR F GTLL DTTWRDAHQSLLATRVRT+D                  ECWGGAT
Sbjct: 545  EFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGAT 604

Query: 604  FDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGV 663
            FDVAMRFLHEDPW RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGV
Sbjct: 605  FDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 664

Query: 664  DIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIVA 723
            DIFRVFDALNDL+QLKVGVDAVKKA G+VEAT+CYSGDMLQPGKKYNLDYYLE+TEKIV 
Sbjct: 665  DIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIVQ 724

Query: 724  MGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGAD 783
            MGTHILGIKDMAGTMKP AA+LLIGSIRAKYPDLPIHVHTHDSAGT V+SM   A+SGAD
Sbjct: 725  MGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGAD 784

Query: 784  VVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADLK 843
            VVDVA NSMSGLTSQPSI AL ASL G I TG++  +  ELDAYWAEMRLLYSCFEADLK
Sbjct: 785  VVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADLK 844

Query: 844  GPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVVG 903
            GPD EVY+HEIPGGQLTNLLFQAQQ GLGEQWAETKRAY EAN LLGD+VKVTPTSKVVG
Sbjct: 845  GPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVVG 904

Query: 904  DLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXXXX 963
            DLAQFMV+N+ NSDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLRSD         
Sbjct: 905  DLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRKL 964

Query: 964  XXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLPT 1023
               PGLELAPF++  IRE+L +RF +IDECD+ASYNMYPKVYEDF+KI+E YGDLSVLPT
Sbjct: 965  TTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLPT 1024

Query: 1024 HNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKSQ 1083
             +FLSP  + EEI VTIEQGK LI+KLQAIGDLNK TG REVYF+LNGELRK+ V D+SQ
Sbjct: 1025 KSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRSQ 1084

Query: 1084 KLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSD 1143
            K+ET++K KADAHD +Q+GAPMAGV++EVKVHKGS V KG+ VAVLSAMKMEMVISSP+D
Sbjct: 1085 KVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPAD 1144

Query: 1144 GQVKDVF 1150
            GQVK+V 
Sbjct: 1145 GQVKEVL 1151

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 1893 bits (4904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 910/1146 (79%), Positives = 991/1146 (86%)

Query: 5    LAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEA 64
            L G R + +LLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLS HR KADEA
Sbjct: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66

Query: 65   YMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIGP 124
            Y+IG+EG+YTPVGAYLAIDEI+ IA+ H VDFIHPGYGFLSENAEFA KV+ AGITWIGP
Sbjct: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126

Query: 125  PASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXXX 184
            P  VIE+VGDKVSARNLAA A+VPTVPGT GPI +VEEA++FV KYGYPVIIKAA+    
Sbjct: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGG 186

Query: 185  XXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHLF 244
                     DD+ DAFQRA+SEA TAFGNGTCFVERFLD+PKHIEVQLLADN+GNVVHLF
Sbjct: 187  RGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246

Query: 245  ERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNRHY 304
            ERDCSVQRRHQKVVEVAPAKTL +EVRD+ILTDAV+LAK +GYRNAGTAEFLVD QNRHY
Sbjct: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306

Query: 305  FIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITTE 364
            FIEINPRIQVEHTITEEIT               SL QLGL+QDRITTRGFAIQCRITTE
Sbjct: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366

Query: 365  DPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRR 424
            DP+KNFQPDTGRL+VYRSAGGNGVRLDGG A+AGAVISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426

Query: 425  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKLL 484
            KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLF MV+S+NRAQKLL
Sbjct: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486

Query: 485  QYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQSQPPAGWRQVLLEHGPEV 544
             YL+DLAVNGSSIKGQ+G PKL   P IP+LH+  G  +DV   P  GWR +L   GPE 
Sbjct: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEGPEA 546

Query: 545  FAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXXXECWGGATF 604
            FAK VR   GTL+ DTTWRDAHQSLLATRVRTYD                  ECWGGATF
Sbjct: 547  FAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGGATF 606

Query: 605  DVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGVD 664
            DVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGVD
Sbjct: 607  DVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVD 666

Query: 665  IFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKIVAM 724
            IFRVFDALNDLEQLKVGVDAVKKA G+VEAT+CYSGDMLQPGKKYNLDYYL++TEKIVAM
Sbjct: 667  IFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKIVAM 726

Query: 725  GTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISGADV 784
            GTHILGIKDMAGTMKP AAKLLIG+IRAK+PDLPIHVH+HDSAGT VASM  CA++GADV
Sbjct: 727  GTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGADV 786

Query: 785  VDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEADLKG 844
            VDVA NSMSGLTSQ S+ A+ ASL G I TG++  H  ELDAYWAEMRLLYSCFEADLKG
Sbjct: 787  VDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLKG 846

Query: 845  PDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKVVGD 904
            PDPEVY HEIPGGQLTNLLFQAQQLGLGE+W ETK+AY +ANQLLGD+VKVTPTSKVVGD
Sbjct: 847  PDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGD 906

Query: 905  LAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDXXXXXXXXXX 964
            LAQFMVSN+L  DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D          
Sbjct: 907  LAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRRKLN 966

Query: 965  XXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVLPTH 1024
              PGLELAPFDL KIRE+L +RF +I+ECDVASYNMYPKVYEDF+KI E YGDLSVLPT 
Sbjct: 967  RRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTR 1026

Query: 1025 NFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADKSQK 1084
            NFL+ P++GEEI V IEQGK LIIKLQA+GDLN+ETG REVYFELNGE RK+ +ADKSQ 
Sbjct: 1027 NFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQV 1086

Query: 1085 LETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDG 1144
            ++T++K KAD HD  Q+GAPMAGVI+EVKVHKGS V KGQPVAVLSAMKMEMVISS  +G
Sbjct: 1087 VQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEG 1146

Query: 1145 QVKDVF 1150
             VKDV 
Sbjct: 1147 LVKDVL 1152

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 1882 bits (4876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 910/1109 (82%), Positives = 975/1109 (87%)

Query: 42   MATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGY 101
            M TVA+YS EDRLSMHR KADEAYMIG  G+YTPVGAYLAIDEI+ IA++H V FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 102  GFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVE 161
            GFLSENAEFAAKV  AGITWIGPP  VI +VGDKVSAR+LAA A+VPTVPGT GPI SVE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 162  EAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERF 221
            EAE FV +YGYPVIIKAAF             DDI DAFQRA SEA+TAFGNGTCFVERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 222  LDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKL 281
            LD+PKHIEVQLLADNYGNV+HLFERDCSVQRRHQKVVEVAPAKTL KEVRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 282  AKASGYRNAGTAEFLVDKQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLE 341
            AK + YRNAGTAEFLVD QNRHYFIEINPRIQVEHTITEEIT               SL+
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 342  QLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVI 401
            QLGL+QD+ITTRGFAIQCRITTEDPSKNFQPDTGR++VYRSAGGNGVRLDGGNA+AGAVI
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 402  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWT 461
            SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTH VF SG+YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 462  TFIDDTPQLFEMVASQNRAQKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGE 521
            TFIDDTPQLFEMV+SQNRAQKLL YL+DLAVNGSSIKGQ+G+PKL  QPS+P LH++ G 
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 522  VIDVQSQPPAGWRQVLLEHGPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXX 581
            V+DV + PPAGWR VLLE GPE FAK+VR+++GTLL DTTWRDAHQSLLATRVRT+D   
Sbjct: 481  VVDVLAAPPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLAT 540

Query: 582  XXXXXXXXXXXXXXXECWGGATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGV 641
                           ECWGGATF VAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGV
Sbjct: 541  IAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGV 600

Query: 642  AYSSLPDNAIDHFVKQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGD 701
            AYSSLPDNAIDHFV QAKENGVDIFRVFDALNDLEQLKVGVDAVKKA G+VEAT+CYSGD
Sbjct: 601  AYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGD 660

Query: 702  MLQPGKKYNLDYYLELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHV 761
            MLQPGKKYNLDYYLE+T+KIV MGTHILGIKDMAGT+KP AAKLLIGSIRAKYPDLPIHV
Sbjct: 661  MLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHV 720

Query: 762  HTHDSAGTGVASMVQCAISGADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHA 821
            HTHDSAGT VASM  CA++GADVVDVATNSMSGLTSQPSI AL ASL G+I   VD +  
Sbjct: 721  HTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNMV 780

Query: 822  IELDAYWAEMRLLYSCFEADLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRA 881
             ELDAYWA+MRLLYSCFEADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+WAETKRA
Sbjct: 781  RELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKRA 840

Query: 882  YAEANQLLGDLVKVTPTSKVVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIG 941
            Y EAN LLGDLVKVTPTSKVVGDLAQFMV+N+LNSDDVRRLASSLDFPDSVMDFFEGLIG
Sbjct: 841  YREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLIG 900

Query: 942  QPYGGFPEPLRSDXXXXXXXXXXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMY 1001
            QPYGGFPEPLR+D            PGLEL PFDL++I+E+L SRF +IDECDVASYNMY
Sbjct: 901  QPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNMY 960

Query: 1002 PKVYEDFRKIRETYGDLSVLPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETG 1061
            PKVYEDFRKIRE YGDLSVLPT NFLSPP +GEEI+VTIEQGK LIIK QAIGDLNK+TG
Sbjct: 961  PKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDTG 1020

Query: 1062 KREVYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVT 1121
             REVYFELNGELRKVSV D+SQK+ET+SK KADAHD +QVGAPMAGV++EVKVHKGS V 
Sbjct: 1021 IREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLVK 1080

Query: 1122 KGQPVAVLSAMKMEMVISSPSDGQVKDVF 1150
            KGQPVAVLSAMKMEMVISSP+ G VKDV 
Sbjct: 1081 KGQPVAVLSAMKMEMVISSPAAGLVKDVL 1109

>Scas_563.12
          Length = 1216

 Score = 1868 bits (4838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 897/1155 (77%), Positives = 1001/1155 (86%), Gaps = 5/1155 (0%)

Query: 1    MGSQLAGFRRHSNLLGEKNK----VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSM 56
            +  +L G R + NLLG +N+    ++V +    P+  FR+AHELSM TVA+YS+EDRLS 
Sbjct: 39   INKKLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLST 98

Query: 57   HRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEG 116
            HR KADE+Y+IG   Q+TPVGAYLAIDEI+ IA+ H VD+IHPGYGFLSEN+EFA KV  
Sbjct: 99   HRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAK 158

Query: 117  AGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVII 176
            AGITWIGPPASVI++VGDKVSARNLA  A+VPTVPGT GPI +V++A++FV +YGYPVII
Sbjct: 159  AGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVII 218

Query: 177  KAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADN 236
            KAAF             DD+ DAFQRA SEA TAFG+GTCFVERFL++PKHIEVQLLAD 
Sbjct: 219  KAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADT 278

Query: 237  YGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFL 296
            +GNV+HLFERDCSVQRRHQKVVEVAPAKTL +EVRDAILTDAVKLAK  GY+NAGTAEFL
Sbjct: 279  HGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFL 338

Query: 297  VDKQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFA 356
            VD QNRHYFIEINPRIQVEHTITEEIT               SLEQLGL+QD+ITTRGFA
Sbjct: 339  VDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFA 398

Query: 357  IQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSG 416
            IQCRITTEDP+KNFQPDTGRL+VY SAGGNGVRLDGGNA+AGA+ISPHYDSMLVKCSCSG
Sbjct: 399  IQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSG 458

Query: 417  STYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVAS 476
            STYE+VRRKM+RALIEFRIRGVKTNIPFLLTLLTHPVFI+GDYWTTFIDDTPQLF+MV+S
Sbjct: 459  STYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSS 518

Query: 477  QNRAQKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDVQS-QPPAGWRQ 535
            QNRAQKLL YL+DLAVNGSSIKGQ+G+P+L   P IP +H+A+G VIDV +  PPAGWRQ
Sbjct: 519  QNRAQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQ 578

Query: 536  VLLEHGPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDXXXXXXXXXXXXXXXXX 595
            VLLE GPE FAK+VR+F GTLL DTTWRDAHQSLLATRVRT+D                 
Sbjct: 579  VLLEQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFA 638

Query: 596  XECWGGATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV 655
             ECWGGATFDVAMRFLHEDPW+RLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV
Sbjct: 639  LECWGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFV 698

Query: 656  KQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYL 715
            KQAK+NGVDIFRVFDALNDL+QLKVGVDAVKKA G+VEAT+CYSGDMLQPGKKYNLDYYL
Sbjct: 699  KQAKDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYL 758

Query: 716  ELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMV 775
            E+TEKIV MGTHILGIKDMAGTMKP AA+LLIGSIRAKYPDLPIHVHTHDSAGT VASM 
Sbjct: 759  EVTEKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMS 818

Query: 776  QCAISGADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLY 835
              A +GADV+DVATNSMSGLTSQPSI AL ASL G+I T ++  H  ELDAYWAEMRLLY
Sbjct: 819  AAAYAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLY 878

Query: 836  SCFEADLKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKV 895
            SCF ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGEQW ETKRAY EAN LLGD+VKV
Sbjct: 879  SCFGADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKV 938

Query: 896  TPTSKVVGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDX 955
            TPTSKVVGDLAQFMVSN+L S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD 
Sbjct: 939  TPTSKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDI 998

Query: 956  XXXXXXXXXXXPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETY 1015
                       PGLEL PF+L+ I+E+L++RF +I+ECD+ASYNMYPKVYEDF+K++E Y
Sbjct: 999  LRNKRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKY 1058

Query: 1016 GDLSVLPTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRK 1075
            GDLSVLPT +FL+P +IGEEI+VTI+QGK LIIKLQAIGDLNKETGKREV+FELNGE+RK
Sbjct: 1059 GDLSVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRK 1118

Query: 1076 VSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKME 1135
            +SV DKSQK+ETV+K KAD HD FQ+GAPMAGVI+EVKVHKGS V KG+ VAVLSAMKME
Sbjct: 1119 ISVTDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKME 1178

Query: 1136 MVISSPSDGQVKDVF 1150
            MVISSP+DG VK+V 
Sbjct: 1179 MVISSPADGLVKEVL 1193

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  281 bits (718), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 176/488 (36%), Positives = 261/488 (53%), Gaps = 30/488 (6%)

Query: 3    SQLAGFRRHSNLL--------GEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54
            S   GFR +   +        G    VLVANRGEI +RI +T   + + ++A+YS  D+ 
Sbjct: 607  SHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKY 666

Query: 55   SMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKV 114
            S H    D A  +     +T    YL +++I+ IA+ +DVD I PGYGFLSENA FA + 
Sbjct: 667  SQHVLDVDMAQALD---GHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRC 723

Query: 115  EGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPV 174
            E  GI +IGP    I  +G K SAR +A  A VP VPG+   + + +EA    +  GYPV
Sbjct: 724  EQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPV 782

Query: 175  IIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLA 234
            ++K+                D+R AF+  + +  + FG+   F+E+F+D  +H+EVQ++ 
Sbjct: 783  MVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMG 842

Query: 235  DNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAE 294
            D  G  + L ERDCS+QRR+QKV+E  PA  L +E R  +LT A +L     YR AGT E
Sbjct: 843  DGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVE 902

Query: 295  FLVDKQ-NRHYFIEINPRIQVEHTITEEIT--XXXXXXXXXXXXXXXSLEQLGLMQDRIT 351
            F+ D+Q ++ YF+E+N R+QVEH ITE +T                 SL++  + Q+   
Sbjct: 903  FIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN--- 959

Query: 352  TRGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLV 410
              G +I+ R+  E+P K+F+P  G L DV      N  R+D      G  ISP +D  L 
Sbjct: 960  --GASIEVRVYAENPLKDFRPSPGELVDVQFP---NDCRVDTW-VKKGTKISPEFDPTLA 1013

Query: 411  KCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVF----ISGDYWTTFIDD 466
            K    G        KM +AL E +I G  TN+ +L +L++  +F    +S +Y  T+ + 
Sbjct: 1014 KIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTY-EY 1072

Query: 467  TPQLFEMV 474
            +P   E++
Sbjct: 1073 SPSAVEII 1080

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 1106 AGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVK 1147
            AG   +  V  G+++ K Q VAV+ AMK EM++SS   G++K
Sbjct: 1771 AGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLK 1812

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  266 bits (681), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 167/473 (35%), Positives = 253/473 (53%), Gaps = 21/473 (4%)

Query: 3    SQLAGFRRHSNLLGEK--------NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54
            ++  GFR +  +L +K        + VL+ANRGEI +RI +T  +L + +VAVYS  D+ 
Sbjct: 610  TKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKY 669

Query: 55   SMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKV 114
            S H   AD +  +      T    YL +++I+  A+  +   I PGYGFLSENA+F+   
Sbjct: 670  SQHVTDADVSVPLHGT---TAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDAC 726

Query: 115  EGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPV 174
              AGIT++GP   +I  +G K SAR +A  A VP VPG+   I+SVEEA++   +  YPV
Sbjct: 727  TSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPV 785

Query: 175  IIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLA 234
            ++K+               +DI   F+  + + ET FG+   F+ERF++  +H+EVQL+ 
Sbjct: 786  MVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMG 845

Query: 235  DNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAE 294
            D +G  + L ERDCS+QRR+QKV+E  PA  L ++ R A+   A  L     Y+ AGT E
Sbjct: 846  DGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVE 905

Query: 295  FLVD-KQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTR 353
            F+ D K++  YF+E+N R+QVEH ITE +T               + +       ++   
Sbjct: 906  FIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPD---FDSTKVEVN 962

Query: 354  GFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKC 412
            G +++ R+  E+P KNF+P  G L DV      +  R+D      G  ISP YD  L K 
Sbjct: 963  GVSMEARLYAENPLKNFRPSPGLLVDVKFP---DWARVDTW-VKKGTNISPEYDPTLAKI 1018

Query: 413  SCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFID 465
               G   +    K+ +AL E ++ G  TNI +L +++T   F      T  ++
Sbjct: 1019 IVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 1078 VADKSQKLETVSKLKADAHDQFQVGAPM-----AGVIIEVKVHKGSAVTKGQPVAVLSAM 1132
            + + + +L+    +K D  + F  GA +     +G   +     G  +  GQ + ++ AM
Sbjct: 1738 IQNANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAM 1797

Query: 1133 KMEMVISSPSDGQV 1146
            K EM+IS+P  G++
Sbjct: 1798 KAEMIISAPKSGKI 1811

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  265 bits (678), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/487 (34%), Positives = 256/487 (52%), Gaps = 26/487 (5%)

Query: 3    SQLAGFRRHSNLLGEKN--------KVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54
            ++  GF+++ + L ++          VL+ANRGEI +RI +T  +L++ +VAVYS  D+ 
Sbjct: 603  TKYGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKY 662

Query: 55   SMHRQKADEAYMI-GREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAK 113
            S H   AD    + GR    T    YL ID+I++ A+D +   I PGYGFLSENAEFA K
Sbjct: 663  SQHVIDADLGVALNGRTAAET----YLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADK 718

Query: 114  VEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYP 173
                GI ++GP    I  +G K SAR +A  A VP VPG+ G ++S +EA+E   K  YP
Sbjct: 719  CVEEGIVFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYP 777

Query: 174  VIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLL 233
            V++K+               ++I   F+  + + +  FG+   F+ERF++  +H+E+Q++
Sbjct: 778  VMVKSTAGGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMM 837

Query: 234  ADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTA 293
             D YG  + + ERDCS+QRR+QK++E  PA  L +  R  +   A  L     Y+ AGT 
Sbjct: 838  GDGYGKAIAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTV 897

Query: 294  EFLVD-KQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITT 352
            EF+ D +++  YF+E+N R+QVEH ITE +T               + +        I  
Sbjct: 898  EFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPD---FESANIVV 954

Query: 353  RGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVK 411
             G +I+ R+  E+P+K+F+P  G L DV+        R+D   +  G  +S  YD  L K
Sbjct: 955  TGASIEARLYAENPAKDFRPSPGLLTDVHFP---EWARVDTWVS-KGTTVSAEYDPTLAK 1010

Query: 412  CSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TP 468
                G        KM +AL E  + G  TNI +L ++ +  +F +    T  +D     P
Sbjct: 1011 IIVHGKDRNDAIMKMNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKP 1070

Query: 469  QLFEMVA 475
              FE+ +
Sbjct: 1071 CAFEVTS 1077

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 1074 RKVSVADKSQKLETVSKLKADAHDQFQVGAPM-----AGVIIEVKVHKGSAVTKGQPVAV 1128
            R + VA+  Q+LE+ +  K+   +++   A M     +G   +  V  G  VTKG  + +
Sbjct: 1734 RLIQVAN--QELESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVI 1791

Query: 1129 LSAMKMEMVISSPSDGQV 1146
            + AMK EMV+ +   G+V
Sbjct: 1792 VEAMKTEMVVPAKKSGKV 1809

>Scas_721.40
          Length = 1834

 Score =  260 bits (665), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 157/483 (32%), Positives = 251/483 (51%), Gaps = 21/483 (4%)

Query: 3    SQLAGFRRHSNLLGEKNK-------VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLS 55
            ++  GF+ +   L    K       VLVANRGEI +RI +T  ++ + +VA++S  DR S
Sbjct: 605  TKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYS 664

Query: 56   MHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVE 115
             H   AD    +  +G  +    YL I++I+  A+      I PGYGFLSENA+F+ + +
Sbjct: 665  QHVIDAD--LTVDLKG-VSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCD 721

Query: 116  GAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVI 175
              GIT++GP   V+  +G K SAR +A  A+VP VPG+   I++  EA+E   K  YP++
Sbjct: 722  AEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSS-LITTAHEAKEIAAKLEYPIM 780

Query: 176  IKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLAD 235
            +K+               DDI   F+  + +    FG+   F+ERF++  +H+EVQ++ D
Sbjct: 781  VKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGD 840

Query: 236  NYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEF 295
              GN + + ERDCS+QRR+QK++E  PA  L +  R  +   A +L     Y+ AGT EF
Sbjct: 841  GLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEF 900

Query: 296  LVDK-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRG 354
            + D+ ++  YF+E+N R+QVEH ITE +T               + +     Q +I   G
Sbjct: 901  IYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPD---FNQLKIDVNG 957

Query: 355  FAIQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSC 414
             A++ R+  E+P  +F+P  G+L           R+D   +  G +++P YD  L K   
Sbjct: 958  VAMEARLYAENPVHDFKPSPGQL--VEVEFPKWARIDTWVS-KGTIVTPEYDPTLAKIIV 1014

Query: 415  SGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFI---DDTPQLF 471
             G        K+ +AL+E ++ G  TNI +L ++ +  +F      T  +   D  P   
Sbjct: 1015 HGKDRHDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAM 1074

Query: 472  EMV 474
            E++
Sbjct: 1075 EII 1077

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query: 1059 ETGKREVYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQ-------------VGAPM 1105
            E  K    F+L   L++   A+K  KL  +S  + D +D+ +             + +  
Sbjct: 1712 ENSKSITEFQL---LQEGENAEKFAKLIELSNAELDENDEIEKDQVNDYPENSVMIYSEY 1768

Query: 1106 AGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQV 1146
            +G   +  V +G  V  GQ + ++ AMK EM++ +  DG+V
Sbjct: 1769 SGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLVPTLHDGKV 1809

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  260 bits (664), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 171/484 (35%), Positives = 244/484 (50%), Gaps = 26/484 (5%)

Query: 3    SQLAGFRRHSNLLGEK-------NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLS 55
            + L GFRR+   L  +       + VLVANRGEI +RI RT   L + +VAVYS  DR S
Sbjct: 600  THLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHS 659

Query: 56   MHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVE 115
             H + AD A  +G     +    YL ID+IL  A+  D   I PGYGFLSENA FA +  
Sbjct: 660  QHVRDADVAVALGGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG 716

Query: 116  GAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVI 175
              GI ++GP    I  +G K  AR LAA A VP   GT G + S   A E  ++ GYP++
Sbjct: 717  AEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLM 775

Query: 176  IKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLAD 235
            +K+                ++  AF++ + + E  F +   F+E F+ + +H+EVQ++ D
Sbjct: 776  VKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD 835

Query: 236  NYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEF 295
             +G  V L ERDCS+QRR+QK++E  PA  L    R  +   A +L  A  Y+ AGT EF
Sbjct: 836  GHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEF 895

Query: 296  LVDKQ-NRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRG 354
            + D+Q +  YF+E+N R+QVEH ITE +T                 +        +   G
Sbjct: 896  MYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEG 951

Query: 355  FAIQCRITTEDPSKNFQPDTGRLD--VYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKC 412
             +++ R+  E+P K F P  G L   V+ S      R+D      G  ++  YD  L K 
Sbjct: 952  VSMEARVYVENPVKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKI 1006

Query: 413  SCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQ 469
               G   E    K+L AL E RI G  TN+ +L ++ +   F     +T  ++D   TP 
Sbjct: 1007 IVHGKDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPT 1066

Query: 470  LFEM 473
             FE+
Sbjct: 1067 AFEV 1070

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 11/96 (11%)

Query: 1059 ETGKREVYFELNGELRKVSVADKSQKLETVSKLKADA----HDQFQVGAPMAGVIIEVKV 1114
            ++G+R   F     L KV+ +D    LET  + +A+      D   V +  AG   +  V
Sbjct: 1712 QSGERAAEF---ARLIKVANSD----LETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVV 1764

Query: 1115 HKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVKDVF 1150
              G  V +G  + ++ AMK EMV+S+ +DG+V ++ 
Sbjct: 1765 SVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINIL 1800

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  255 bits (652), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/459 (34%), Positives = 240/459 (52%), Gaps = 14/459 (3%)

Query: 21   VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYL 80
            VL+ANRGEI +RI +T   + + +VAVYS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 81   AIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARN 140
             ID+I+  A+      I PGYGFLSENA+F+ +     I ++GP    I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 141  LAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAF 200
            +A  A VP VPG+ G I   +EA+E  +K  YPV++K+               DDI   F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 201  QRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260
            +  + + ++ FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 261  APAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ-NRHYFIEINPRIQVEHTIT 319
             PA  L +  R  +   + +L     Y+ AGT EF+ D+Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 320  EEITXXXXXXXXXXXXXXXSLEQLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLDV 379
            E +T               S +       +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 380  YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 439
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 440  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFEMVA 475
            TNI +L ++ +  +F      T  +D     P  FE++A
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075

>Kwal_27.11951
          Length = 1869

 Score =  251 bits (642), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 169/487 (34%), Positives = 257/487 (52%), Gaps = 26/487 (5%)

Query: 3    SQLAGFRRHSNLLG----EKNK----VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRL 54
            ++L  F+ + + L     EK K    VLVANRGEI +RI +T  +L + +VAVYS  D+ 
Sbjct: 642  TELGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKY 701

Query: 55   SMHRQKADEAYMI-GREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAK 113
            S H   AD A  + GR    T    YL ID+I+  A++   + I PGYGFLSENA+F+ +
Sbjct: 702  SQHVTDADVAVALKGR----TAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDR 757

Query: 114  VEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYP 173
                GI ++GP    I  +G K SAR +A  A VP VPG+ G + + +EA E  +   YP
Sbjct: 758  CASEGIVFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGS-GLVKTPQEAREIAKALEYP 816

Query: 174  VIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLL 233
            V++K+               +DI   F+  + + +  FG+   F+ERF++  +H+E+Q++
Sbjct: 817  VMVKSTAGGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMM 876

Query: 234  ADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTA 293
             D  G  + + ERDCS+QRR+QKV+E  PA  LS++ R  +   +  L     YR AGT 
Sbjct: 877  GDGKGKAIAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTV 936

Query: 294  EFLVD-KQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQDRITT 352
            EF+ D +++  YF+E+N R+QVEH ITE +T                 +       +IT 
Sbjct: 937  EFIYDERRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPD---FDATKITV 993

Query: 353  RGFAIQCRITTEDPSKNFQPDTGRL-DVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVK 411
             G +I+ R+  E+P K+F+P  G+L DV   +     R+D   +  G  IS  YD  L K
Sbjct: 994  TGASIEARLYAENPVKDFRPSPGQLTDV---SFPEWARVDTWVS-KGTTISAEYDPTLAK 1049

Query: 412  CSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TP 468
                G   +   +K+ +AL E  I G  TNI +L ++ +  +F +    T  +D     P
Sbjct: 1050 IIVHGKDRDEAIQKLNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRP 1109

Query: 469  QLFEMVA 475
              FE+ +
Sbjct: 1110 SAFEITS 1116

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 12/98 (12%)

Query: 1057 NKETGKREVYF-----ELNGELRKVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIE 1111
            NK+ G++   F     E N EL K   +  + + E          D   V +  +G   +
Sbjct: 1761 NKQNGEKAEEFAKLIQESNAELEKAPDSQGAVEEEF-------PEDAEMVYSEYSGRFWK 1813

Query: 1112 VKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVKDV 1149
              V  G  V  G  + V+ AMK EM++S+P  G+V  V
Sbjct: 1814 PLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKV 1851

>Scas_720.74
          Length = 2231

 Score =  188 bits (478), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 225/512 (43%), Gaps = 71/512 (13%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEAY--MIGREGQYTPV 76
           +K+L+AN G   ++  R+  + +  T         ++M   +  EA    I    QY  V
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEV 119

Query: 77  GA------YLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAG--ITWIGPPASV 128
                   Y  +D I+ IA   DVD +  G+G  SEN     K+  +   + +IGPP S 
Sbjct: 120 PGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSA 179

Query: 129 IEAVGDKVSARNLAAVADVPTVP--GT----------------------EGPISSVEEAE 164
           + ++GDK+S+  +A  A VP +P  GT                      +G  SS E+  
Sbjct: 180 MRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGL 239

Query: 165 EFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQ 224
           E  +K G+PV+IKA+              +D    + +A +E          F+ +   +
Sbjct: 240 EKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIMKLAGK 295

Query: 225 PKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKA 284
            +H+EVQLLAD YGN + LF RDCSVQRRHQK++E AP    + E    +   AV+L K 
Sbjct: 296 ARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKL 355

Query: 285 SGYRNAGTAEFLVDKQNRH-YFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQL 343
            GY +AGT E+L   +++  YF+E+NPR+QVEH  TE +T                + ++
Sbjct: 356 VGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRI 415

Query: 344 GLM--------------------------QDRITTRGFAIQCRITTEDPSKNFQPDTGRL 377
             +                          Q +   +G    CRIT+EDP + F+P  G L
Sbjct: 416 SDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSL 475

Query: 378 DV--YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 435
               +RS+         GN      I    DS        G   +  R+ M+ AL E  I
Sbjct: 476 HELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSI 532

Query: 436 RG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 466
           RG  +T + +L+ LL    F      T ++DD
Sbjct: 533 RGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%)

Query: 1085 LETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDG 1144
            +++++ L    +D  Q+  P  G +++  V  G  +  GQP A +  MKM+M + +   G
Sbjct: 687  VDSMTTLLEVENDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLVAQETG 746

Query: 1145 QVK 1147
             ++
Sbjct: 747  IIQ 749

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  187 bits (476), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 134/436 (30%), Positives = 204/436 (46%), Gaps = 55/436 (12%)

Query: 79  YLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGA--GITWIGPPASVIEAVGDKV 136
           Y  ID IL +A   DVD +  G+G  SEN      +  +   I +IGPP   + ++GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 137 SARNLAAVADVPTVPGT------------------------EGPISSVEEAEEFVQKYGY 172
           S+  +A  A +P +P +                         G  SS E+A E  +  G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 173 PVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQL 232
           PV+IKA+              DD    +++A +E   +      FV + +   +H+EVQL
Sbjct: 174 PVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGS----PMFVMKVVTDARHLEVQL 229

Query: 233 LADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGT 292
           LAD YG  + LF RDCS+QRRHQK++E AP      E    +   A++L +  GY +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 293 AEFLVD-KQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQLGLMQ---- 347
            E+L   K ++ YF+E+NPR+QVEH  TE I+                +  +  ++    
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 348 --------------DRITTRGFAIQCRITTEDPSKNFQPDTGRLDV--YRSAGGNGVRLD 391
                          R + +G  I CRIT+EDP++ F+P TG++    +RS+        
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 392 GGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLT 450
            GN      I    DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL 
Sbjct: 410 VGN---NGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLE 466

Query: 451 HPVFISGDYWTTFIDD 466
              F S +  T ++DD
Sbjct: 467 TRDFESNNISTGWLDD 482

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 1100 QVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVK 1147
            QV +P  G +++  V  G  V  GQ  A +  MKM+M + + SDG ++
Sbjct: 621  QVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIE 668

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 227/512 (44%), Gaps = 71/512 (13%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEAY--MIGREGQYTPV 76
           +KVL+AN G   ++  R+  + +  T         ++M   +  EA    I    QY  V
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEV 119

Query: 77  ------GAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAG--ITWIGPPASV 128
                   Y  +D I+ IA   DVD +  G+G  SEN     K+  +   I +IGPP + 
Sbjct: 120 PGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNA 179

Query: 129 IEAVGDKVSARNLAAVADVPTVP--GT----------------------EGPISSVEEAE 164
           + ++GDK+S+  +A  A VP +P  GT                      +G  SS E+  
Sbjct: 180 MRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGL 239

Query: 165 EFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQ 224
           E  +K G+PV+IKA+              +D  + + +A +E          F+ +   +
Sbjct: 240 EKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFIMKLAGK 295

Query: 225 PKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKA 284
            +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      E    +   AV+L K 
Sbjct: 296 ARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKL 355

Query: 285 SGYRNAGTAEFLVDK-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQL 343
            GY +AGT E+L     N+ YF+E+NPR+QVEH  TE +T                + ++
Sbjct: 356 VGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRI 415

Query: 344 -------GL-------------MQDRITT------RGFAIQCRITTEDPSKNFQPDTGRL 377
                  GL              +D + T      +G    CRIT+EDP+  F+P  G L
Sbjct: 416 SDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTL 475

Query: 378 DV--YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 435
           +   +RS+         GN      I    DS        G   +  R+ M+ AL E  I
Sbjct: 476 NELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSI 532

Query: 436 RG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 466
           RG  +T + +L+ LL    F      T ++DD
Sbjct: 533 RGDFRTTVEYLIKLLETEDFEENTITTGWLDD 564

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  182 bits (463), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 154/558 (27%), Positives = 246/558 (44%), Gaps = 93/558 (16%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMAT---------VAVYSYEDRLSMHRQKADEAYMIGR 69
           +KVL+AN G   ++  R+  + +  T         VA+ + ED       +A+  Y I  
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDL------EANAEY-IRM 113

Query: 70  EGQYTPV------GAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGA--GITW 121
             QY  V        Y  +D I+ +A   DVD +  G+G  SEN     ++  +   I +
Sbjct: 114 ADQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIF 173

Query: 122 IGPPASVIEAVGDKVSARNLAAVADVPTVP--GT----------------------EGPI 157
           IGPP + + ++GDK+S+  +A  A VP +P  GT                      EG  
Sbjct: 174 IGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCC 233

Query: 158 SSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCF 217
           SS E+  +  ++ G+P+++KA+              D+    +Q+A +E          F
Sbjct: 234 SSPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIF 289

Query: 218 VERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTD 277
           + +   + +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   
Sbjct: 290 IMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKA 349

Query: 278 AVKLAKASGYRNAGTAEFLVDK-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXX 336
           AV+L +  GY +AGT E+L    +++ YF+E+NPR+QVEH  TE +T             
Sbjct: 350 AVRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAM 409

Query: 337 XXSLEQL--------------------------GLMQDRITTRGFAIQCRITTEDPSKNF 370
              + ++                             Q + T +G    CRIT+EDP++ F
Sbjct: 410 GIPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGF 469

Query: 371 QPDTGRLDV--YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLR 428
           +P  G L    +RS+         GN      I    DS        G   +  R+ M+ 
Sbjct: 470 KPSGGALHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVV 526

Query: 429 ALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQKLLQYL 487
           AL E  IRG  +T + +L+ LL    F      T ++DD      +++ +  A+K  + L
Sbjct: 527 ALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEKPDRTL 580

Query: 488 SDLAVNGSSIKGQMGVPK 505
           S   + G++ K  +   K
Sbjct: 581 S--VICGAATKAHIASQK 596

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 1065 VYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQ 1124
            +Y++      ++S+  K+  LE         +D  Q+  P  G +++  V  G  V  GQ
Sbjct: 675  IYWKEEVAATRLSIDSKTTLLEV-------ENDPTQLRTPSPGKLVKFLVENGDHVIAGQ 727

Query: 1125 PVAVLSAMKMEMVISSPSDGQVK 1147
            P A +  MKM+M + S  +G V+
Sbjct: 728  PYAEVEVMKMQMPLISQENGVVQ 750

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  181 bits (459), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 147/513 (28%), Positives = 226/513 (44%), Gaps = 73/513 (14%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMATVA---VYSYEDRLSMHRQKADEAYMIGREGQYTP 75
           +K+L+AN G   ++  R+  + +  T     V  +    +    +A+  Y I    QY  
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEY-IRMADQYVE 118

Query: 76  V------GAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAG--ITWIGPPAS 127
           V        Y  +D I+ +A   DVD +  G+G  SEN     K+  +   + +IGPP S
Sbjct: 119 VPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGS 178

Query: 128 VIEAVGDKVSARNLAAVADVPTVPGTEGPISSVE---------EAEEFVQK--------- 169
            + ++GDK+S+  +A  A VP +P +   +  VE          A++  QK         
Sbjct: 179 AMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDG 238

Query: 170 ------YGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLD 223
                  G+PV++KA+              +D    +Q+A +E          F+ +   
Sbjct: 239 LNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE----IPGSPIFIMKLAG 294

Query: 224 QPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAK 283
           + +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   AV+L K
Sbjct: 295 KARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGK 354

Query: 284 ASGYRNAGTAEFLVD-KQNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXXXXSLEQ 342
             GY +AGT E+L   ++++ YF+E+NPR+QVEH  TE +T                L +
Sbjct: 355 LVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHR 414

Query: 343 L-------GL-------------------MQDRITTRGFAIQCRITTEDPSKNFQPDTGR 376
           +       GL                    Q R   +G    CRIT+EDP++ F+P  G 
Sbjct: 415 IRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGS 474

Query: 377 LDV--YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFR 434
           L    +RS+         GN      I    DS        G   +  R+ M+ AL E  
Sbjct: 475 LHELNFRSSSNVWGYFSVGN---NGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELS 531

Query: 435 IRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 466
           IRG  +T + +L+ LL    F      T ++DD
Sbjct: 532 IRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 1065 VYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQ 1124
            VY++      ++S+  ++  LET        +D  Q+  P  G ++   V  G  +  GQ
Sbjct: 674  VYWKEEVAATRLSIDHQTTLLET-------ENDPTQLRTPSPGKLVNFLVESGDHLEAGQ 726

Query: 1125 PVAVLSAMKMEMVISSPSDG 1144
            P A +  MKM+M + +   G
Sbjct: 727  PYAEIEVMKMQMPLIAQESG 746

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  178 bits (452), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 226/519 (43%), Gaps = 85/519 (16%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMAT---------VAVYSYEDRLSMHRQKADEAYMIGR 69
           +K+L+AN G   ++  R+  + +  T         VA+ + ED       +A+  Y I  
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDL------EANAEY-IRM 112

Query: 70  EGQYTPV------GAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAG--ITW 121
             QY  V        Y  +D I+ IA   DVD +  G+G  SEN     K+  +   + +
Sbjct: 113 ADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIF 172

Query: 122 IGPPASVIEAVGDKVSARNLAAVADVPTVP--GT----------------------EGPI 157
           IGPP + + ++GDK+S+  +A  A VP +P  GT                      +G  
Sbjct: 173 IGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCC 232

Query: 158 SSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCF 217
           +S E+  +  ++ G+PV+IKA+              +D    + +A +E          F
Sbjct: 233 TSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIF 288

Query: 218 VERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTD 277
           + +   + +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      E    +   
Sbjct: 289 IMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKA 348

Query: 278 AVKLAKASGYRNAGTAEFLVDKQN-RHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXX 336
           AV+L K  GY +AGT E+L    + + YF+E+NPR+QVEH  TE ++             
Sbjct: 349 AVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAM 408

Query: 337 XXSLEQLGLM--------------------------QDRITTRGFAIQCRITTEDPSKNF 370
              + ++  +                          Q R   +G    CRIT+EDP+  F
Sbjct: 409 GIPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGF 468

Query: 371 QPDTGRLDV--YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLR 428
           +P  G L    +RS+         GN      I    DS        G   +  R+ M+ 
Sbjct: 469 KPSGGTLHELNFRSSSNVWGYFSVGN---NGNIHSFSDSQFGHIFAFGENRQASRKHMVV 525

Query: 429 ALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 466
           AL E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 526 ALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%)

Query: 1075 KVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKM 1134
            K  VA     +++++ L    +D  Q+  P  G +++  V  G  + KGQP A +  MKM
Sbjct: 677  KEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKM 736

Query: 1135 EMVISSPSDGQVK 1147
            +M + S  +G V+
Sbjct: 737  QMPLVSQENGIVQ 749

>Kwal_23.6157
          Length = 2230

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 149/523 (28%), Positives = 229/523 (43%), Gaps = 93/523 (17%)

Query: 19  NKVLVANRGEIPIRIFRTAHELSMAT---------VAVYSYEDRLSMHRQKADEAYMIGR 69
           +KVL+AN G   ++  R+  + +  T         VA+ + ED       +A+  Y+   
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDL------EANAEYLRMA 114

Query: 70  EGQYTPV------GAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGA--GITW 121
           + QY  V        Y  +D I+ +A   DVD +  G+G  SEN     ++  +   + +
Sbjct: 115 D-QYVEVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIF 173

Query: 122 IGPPASVIEAVGDKVSARNLAAVADVPTVP--GT----------------------EGPI 157
           IGPP + + ++GDK+S+  +A  A VP +P  GT                      +G  
Sbjct: 174 IGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCC 233

Query: 158 SSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCF 217
            S E+     +K G+PV++KA+               D    +++A +E          F
Sbjct: 234 DSPEDGLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIF 289

Query: 218 VERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTD 277
           + +     +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   
Sbjct: 290 IMKLAGNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERS 349

Query: 278 AVKLAKASGYRNAGTAEFLVDK-QNRHYFIEINPRIQVEHTITEEITXXXXXXXXXXXXX 336
           AV+L K  GY +AGT E+L     ++ YF+E+NPR+QVEH  TE ++             
Sbjct: 350 AVRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAM 409

Query: 337 XXSLEQLG---LM-----------------------QDRITTRGFAIQCRITTEDPSKNF 370
              + ++    LM                       Q R T +G    CRIT+EDP++ F
Sbjct: 410 GIPMHRIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGF 469

Query: 371 QPDTGRLDV--YRSA----GGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRR 424
           +P  G L    +RS+    G   V   GG       I    DS        G   +  R+
Sbjct: 470 KPSGGSLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRK 522

Query: 425 KMLRALIEFRIRG-VKTNIPFLLTLLTHPVFISGDYWTTFIDD 466
            M+ AL E  IRG  +T + +L+ LL    F      T ++DD
Sbjct: 523 HMVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD 565

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%)

Query: 1075 KVSVADKSQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKM 1134
            K  V+     +++++ L    +D  Q+  P  G +++     G  V  GQP A +  MKM
Sbjct: 678  KEEVSATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKM 737

Query: 1135 EMVISSPSDGQVK 1147
            +M + S   G ++
Sbjct: 738  QMPLVSQESGIIQ 750

>Kwal_33.14061
          Length = 2221

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISS 159
           G   LS   E   + E  G+  +G P   +    D+    N  A+ ++          ++
Sbjct: 523 GQTALSVGIEMKDEFEALGVKVLGTPIDTVITTEDRELFSN--AMDEINEKCAKSKAAAT 580

Query: 160 VEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFV 218
           VEEA E V++ G+PVI +AA+              ++ D           AF +     V
Sbjct: 581 VEEALEAVKEIGFPVICRAAYALGGLGSGFANNEKELVDL-------CNIAFASSPQVLV 633

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRD 272
           ER +   K +E +++ D + N + +    C+++            + VAP++TLS E  +
Sbjct: 634 ERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYN 689

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 690 MLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S+EEAE+F     +PV+++ ++             DD+     +A   +     +   
Sbjct: 1115 LTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPV 1170

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVERIV 1230

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ KA         +F+  K N    IE N R
Sbjct: 1231 VATAKIGKALKITGPFNIQFIA-KNNDIKVIECNVR 1265

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 98/232 (42%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISS 159
           G   LS   E   + E  G+  +G P   +    D+    N  A+ ++          S+
Sbjct: 523 GQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFSN--AMDEINEKCAKSKAAST 580

Query: 160 VEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFV 218
           V+EA E V++ G+PVI++AA+              ++ D           AF +     V
Sbjct: 581 VKEALEAVKEIGFPVIVRAAYALGGLGSGFASNETELVDL-------CNVAFASSPQVLV 633

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRD 272
           ER +   K +E +++ D + N + +    C+++            + VAP++TLS E  +
Sbjct: 634 ERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYN 689

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 690 MLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 741

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S++EAE F +  GYPV+++ ++             DD+     +A   +     +   
Sbjct: 1115 LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPV 1170

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A +   V+H+          H      + P + L  E  + I+
Sbjct: 1171 VITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIV 1230

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ KA         +F+  K N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIA-KNNDIKVIECNVR 1265

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 96/232 (41%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISS 159
           G   LS   E   + E  G+  +G P   I    D+    N  A+ ++          +S
Sbjct: 521 GQTALSVGIEMKDEFESLGVKVLGTPIDTIITTEDRELFAN--AIDEIDEKCAKSQAANS 578

Query: 160 VEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFV 218
           VEEA   V+  G+PVI++AA+              ++ D           AF +     V
Sbjct: 579 VEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQELIDL-------CNVAFASSPQVLV 631

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRD 272
           ER +   K +E +++ D + N + +    C+++            + VAP++TLS E  +
Sbjct: 632 ERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYN 687

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 688 MLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 739

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 67/156 (42%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S++EAE+F +K GYPV+++ ++             +D+     +A   +     +   
Sbjct: 1113 LTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR----DYPV 1168

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A N   V+H+          H      + P + L+ E  D I+
Sbjct: 1169 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1228

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ KA         +F+  K N    IE N R
Sbjct: 1229 VATAKIGKALKITGPYNIQFIA-KDNEIKVIECNVR 1263

>Scas_582.4*
          Length = 2193

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S++EAE F +K GYPV+++ ++             +D+     +A   +     +   
Sbjct: 1090 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR----DYPV 1145

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A N   V+H+          H      + P + L+KE  D I+
Sbjct: 1146 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETVDRIV 1205

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ KA         +F+  K N    IE N R
Sbjct: 1206 VATAKIGKALKITGPYNIQFIA-KDNEIKVIECNVR 1240

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 94/232 (40%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISS 159
           G   LS   E   + E  G+  +G     I    D+    N  A+ ++          +S
Sbjct: 518 GQTALSVGIEMKDEFESLGVKVLGTQIDTIITTEDRELFAN--AIDEINEKCAKSHAANS 575

Query: 160 VEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFV 218
           VEEA   V+  G+PVI++AA+              ++ D           AF +     V
Sbjct: 576 VEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQELIDL-------CNVAFASSPQVLV 628

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRD 272
           ER +   K IE +++ D + N V +    C+++            + VAP++TLS E  +
Sbjct: 629 ERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYN 684

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            +   AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 685 MLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 736

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 96/222 (43%), Gaps = 23/222 (10%)

Query: 111 AAKVEGAGITWIGPPASVIEAVGDK-VSARNLAAVADVPTVPGTEG-PISSVEEAEEFVQ 168
           A  +E  G+T +G P SV+E   D+ + AR L  +     +P  E    S+VE+A     
Sbjct: 126 AVTLEKYGVTVLGTPISVLETTEDRELFARALKEI----NMPIAESVACSTVEDAVAAAN 181

Query: 169 KYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHI 228
             GYPVI+++A+                 D  Q  +  A++   +    VE+ L   K I
Sbjct: 182 DIGYPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQSLALSPQVLVEKSLKGWKEI 235

Query: 229 EVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLA 282
           E +++ D  GN + +    C+++            + +AP++TLS E    + T A+++ 
Sbjct: 236 EYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEII 291

Query: 283 KASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
           +  G       ++ +      +  IE+N R+     +  + T
Sbjct: 292 RHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKAT 333

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 96/232 (41%), Gaps = 21/232 (9%)

Query: 100 GYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISS 159
           G   LS   E   + E  G+  +G     I    D+    N  A+ ++          S+
Sbjct: 539 GQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDRELFAN--AMDEINEKCAKSKAAST 596

Query: 160 VEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFV 218
           V+EA E V+  G+PVI++AA+              ++ D           AF +     V
Sbjct: 597 VDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQELVDL-------CNVAFASSPQVLV 649

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRD 272
           ER +   K +E +++ D + N + +    C+++            + VAP++TLS E  +
Sbjct: 650 ERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYN 705

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + T AV + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 706 MLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKAT 757

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S+EEAE+F  K GYPV+++ ++             DD+     +A  E    +     
Sbjct: 1131 LTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQA-VEVSREY---PV 1186

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A +   ++H+          H      + P + L  E    I+
Sbjct: 1187 VITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIV 1246

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ +A         +F+  K N    IE N R
Sbjct: 1247 DATAKIGRALKITGPYNIQFIA-KNNEIKVIECNVR 1281

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 66/156 (42%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S++EAE F +K GYPV+++ ++             +D+     +A   +     +   
Sbjct: 1115 LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR----DYPV 1170

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A N   V+H+          H      + P + L+ E  D I+
Sbjct: 1171 VITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIV 1230

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ KA         +F+  K N    IE N R
Sbjct: 1231 VATAKIGKALKITGPYNIQFIA-KDNEIKVIECNVR 1265

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 92/216 (42%), Gaps = 19/216 (8%)

Query: 115 EGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPV 174
           E  G+  +G P   I    D+    N  A+ ++          +SV+EA   V++ G+PV
Sbjct: 538 EALGVKVLGTPIDTIITTEDRELFSN--AIDEINEKCAKSQAANSVDEALAAVKEIGFPV 595

Query: 175 IIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLA 234
           I++AA+              ++ D    A S +          VE+ +   K +E +++ 
Sbjct: 596 IVRAAYALGGLGSGFANNEKELVDLCNVAFSSSP------QVLVEKSMKGWKEVEYEVVR 649

Query: 235 DNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYR 288
           D + N + +    C+++            + VAP++TLS E  + + T AV + +  G  
Sbjct: 650 DAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVV 705

Query: 289 NAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
                ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 706 GECNIQYALNPVSKDYCIIEVNARLSRSSALASKAT 741

>Kwal_55.19783
          Length = 1121

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 65/148 (43%), Gaps = 7/148 (4%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           +SSV EA++F +  GYPV+I+ ++             D++      A   +     +   
Sbjct: 717 LSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSEDELETKLTNASDVSP----DHPV 772

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
            + +F++  + I+V  +A N   +VH           H      + P ++LS+ +++ + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVHSGDATLILPPQSLSESIKERLY 832

Query: 276 TDAVKLAKASGYRNAGTAEFLVDKQNRH 303
             A K+A A  ++  G     + K +RH
Sbjct: 833 DIAKKVAHA--WKITGPFNMQIIKDDRH 858

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 90/214 (42%), Gaps = 21/214 (9%)

Query: 118 GITWIGPPASVIEAVGDK-VSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVII 176
           G+  +G P   +E   D+ + A+ L  + ++PT         +V+EA     + GYPVI+
Sbjct: 136 GVKVLGTPIKTLETSEDRDLFAQALKEI-NIPTAESF--ACETVDEALSAASRVGYPVIV 192

Query: 177 KAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADN 236
           ++A+              ++++   +A S +          VE+ L   K +E +++ D 
Sbjct: 193 RSAYALGGLGSGFAENEAEMKELAAQALSLSP------QILVEKSLKGWKEVEYEVVRDR 246

Query: 237 YGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNA 290
             N + +    C+++            +  AP++TLS E    + T A+K+ +  G    
Sbjct: 247 VDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHLGVVGE 302

Query: 291 GTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
              ++ +      Y  IE+N R+     +  + T
Sbjct: 303 CNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 5/156 (3%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           ++SVEEA+ F  K  YPV+I+ ++              ++ D    A   +     +   
Sbjct: 714 LTSVEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPV 769

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
            + +F+   + I+V  +A N   +VH           H      + P + LS+ V+  + 
Sbjct: 770 VMSKFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLK 829

Query: 276 TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
           T A K+AKA         + +   +N    IE N R
Sbjct: 830 TIAKKVAKAWNITGPFNMQVIKAGENDLKVIECNIR 865

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 68/160 (42%), Gaps = 17/160 (10%)

Query: 171 GYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEV 230
           GYPVII++A+             +++++   ++ S A          VE+ L   K +E 
Sbjct: 183 GYPVIIRSAYALGGLGSGFANNPEELKELASQSLSLAPQV------LVEKSLRGWKEVEY 236

Query: 231 QLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLAKA 284
           +++ D   N + +    C+++            +  AP++TLS E    + + A+K+ + 
Sbjct: 237 EVVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRH 292

Query: 285 SGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            G       ++ +   +  Y  IE+N R+     +  + T
Sbjct: 293 LGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKAT 332

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 71/165 (43%), Gaps = 19/165 (11%)

Query: 167 VQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNG-TCFVERFLDQP 225
           V+  G+PVI++AA+              ++ D           AF +     VER +   
Sbjct: 586 VKDIGFPVIVRAAYALGGLGSGFASNEKELVDL-------CNVAFASSPQVLVERSMKGW 638

Query: 226 KHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAV 279
           K IE +++ D + N + +    C+++            + +AP++TLS E  + + T AV
Sbjct: 639 KEIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAV 694

Query: 280 KLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + +  G       ++ ++  ++ Y  IE+N R+     +  + T
Sbjct: 695 NVIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKAT 739

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

Query: 157  ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
            ++S++EAE+F +K  YPV+++ ++             DD+     +A  E    +     
Sbjct: 1113 LTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQA-VEVSREY---PV 1168

Query: 217  FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
             + ++++  K IE+  +A +   ++H+          H      + P + L  E    I+
Sbjct: 1169 VITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIV 1228

Query: 276  TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
                K+ +A         +F+  K N    IE N R
Sbjct: 1229 EATAKIGRALQITGPYNIQFIA-KNNEIKVIECNVR 1263

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 91/218 (41%), Gaps = 23/218 (10%)

Query: 115 EGAGITWIGPPASVIEAVGDK-VSARNLAAVADVPTVPGTEG-PISSVEEAEEFVQKYGY 172
           E  G+  +G P   +E   D+ + A+ L  +     +P  E     ++++A E   K  Y
Sbjct: 133 EKYGVKVLGTPIKTLETSEDRDLFAQALKEI----NIPIAESFACETIDQALEAAAKVKY 188

Query: 173 PVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQL 232
           PVI+++A+              ++++   ++ S A          VE+ L   K IE ++
Sbjct: 189 PVIVRSAYALGGLGSGFANDEQEMKELASQSLSLAP------QILVEKSLKGWKEIEYEV 242

Query: 233 LADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASG 286
           + D  GN + +    C+++            +  AP++TLS E    + + A+K+ +  G
Sbjct: 243 VRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLG 298

Query: 287 YRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
                  ++ +      Y  IE+N R+     +  + T
Sbjct: 299 VVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 336

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 55/129 (42%), Gaps = 5/129 (3%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           ++SV EA+ F  K GYPV+I+ ++             D++      A   +     +   
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELEVKLTNASDVSP----DHPV 772

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVE-VAPAKTLSKEVRDAIL 275
            + +F++  + I+V  +A +   +VH           H      + P + LS+E +  + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLILPPQHLSEETKQRLK 832

Query: 276 TDAVKLAKA 284
             A K+AKA
Sbjct: 833 DIADKVAKA 841

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 66/156 (42%), Gaps = 5/156 (3%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           ++SVEEA+ F  K  YPV+I+ ++             ++++     A   +     +   
Sbjct: 714 LTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP----DHPV 769

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
            + +F++  + I+V  +A N   +VH           H      V P + LS +V+ A+ 
Sbjct: 770 VMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALK 829

Query: 276 TDAVKLAKASGYRNAGTAEFLVDKQNRHYFIEINPR 311
             A K+AKA         + + D ++    IE N R
Sbjct: 830 DIADKVAKAWKITGPFNMQIIKDGEHTLKVIECNIR 865

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 74/172 (43%), Gaps = 17/172 (9%)

Query: 159 SVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFV 218
           +V+EA E  ++  YPVI+++A+              ++++   ++ S A          V
Sbjct: 172 TVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLAP------QILV 225

Query: 219 ERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV------APAKTLSKEVRD 272
           E+ L   K +E +++ D  GN + +    C+++      V        AP++TLS E   
Sbjct: 226 EKSLKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFH 281

Query: 273 AILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
            + + A+K+ +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 282 MLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKAT 333

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           +SSVEEA+ F  + GYPV+I+ ++              ++      A   +     +   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVSP----DHPV 769

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLSKEVRDAIL 275
            + +F++  + I+V  +A N   +VH           H      V P + LS+ ++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 276 TDAVKLAKA 284
             A K+AKA
Sbjct: 830 EIADKVAKA 838

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 89/214 (41%), Gaps = 21/214 (9%)

Query: 118 GITWIGPPASVIEAVGDK-VSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVII 176
            I  +G P   +E   D+ + A+ L  + D+PT         +V+ A E     G+PVI+
Sbjct: 134 NIKVLGTPIKTLETSEDRDLFAQALKEI-DIPTAESI--ACETVDAALEAADIVGFPVIV 190

Query: 177 KAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADN 236
           ++A+              +++    ++ S A          VE+ L   K +E +++ D 
Sbjct: 191 RSAYALGGLGSGFANNAQEMKQLASQSLSLAP------QILVEKSLKGWKEVEYEVVRDR 244

Query: 237 YGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNA 290
            GN + +    C+++            +  AP++TLS E    + + A+K+ +  G    
Sbjct: 245 VGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGE 300

Query: 291 GTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
              ++ +   +  Y  IE+N R+     +  + T
Sbjct: 301 CNVQYALSPDSLDYRVIEVNARLSRSSALASKAT 334

>Kwal_27.12090
          Length = 394

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + + A+G + +GI D  G   P     L+ +++       I  H HD  G  + + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                +GA ++DV   S+ G+  +  IT L
Sbjct: 224 YSALEAGAKLIDV---SVLGIGERNGITPL 250

>Scas_701.35
          Length = 430

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + + ++G + +GI D  G   P     L+ ++R+      I  H H+  G  +A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 229 YTALEGGARLIDV---SVLGIGERNGITPL 255

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      I  H HD  G  + + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITALQASLGGDIA 813
                +GA ++DV   S+ G+  +  IT    SLGG +A
Sbjct: 224 YSALEAGARLIDV---SVLGIGERNGIT----SLGGLMA 255

>AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH]
           (992732..994420) [1689 bp, 562 aa]
          Length = 562

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 689 EGL--VEATICYSGDMLQPGKKYNLDYYLELTEKIVAMGTHILGIKDMAGTMKPGAAKLL 746
           EGL  +E T+C    +++  KKY    Y++    I AMG H  G+ D  G + P    +L
Sbjct: 301 EGLYSMEGTMCNLPKLIELKKKYKCYLYVDEAHSIGAMGPHGRGVCDYFG-VDPTEVDIL 359

Query: 747 IGSIRAKY 754
           +G++   +
Sbjct: 360 MGTLTKSF 367

>Kwal_47.19231
          Length = 795

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 117 AGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVII 176
           AGI   GP A      G K  +++  A  ++PT           E+A+E+++K  Y V++
Sbjct: 93  AGIPVFGPSAKAAIFEGSKTFSKDFMAKHNIPTA--RYANFDDYEKAKEYLEKVDYQVVL 150

Query: 177 KAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADN 236
           KA                + +DA +    E +      +  +E FL +   I +  ++D 
Sbjct: 151 KADGIAAGKGVLIPTTPQEAQDALKALMVERQFGAAGDSIVIEEFL-EGDEISILTISDG 209

Query: 237 Y 237
           Y
Sbjct: 210 Y 210

>Scas_691.19
          Length = 1117

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 157 ISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTC 216
           ++SV+EA+ F  K GYPV+I+ ++             D+++     A   +     +   
Sbjct: 714 LTSVDEAKVFADKVGYPVLIRPSYVLSGAAMSVVNNEDELKLKLTLASDVSP----DHPV 769

Query: 217 FVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVE-VAPAKTLSKEVRDAIL 275
            + +F++  + I+V  +A N   ++H           H      + P + LS +V+  + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAYNGKVLIHAISEHVENAGVHSGDASLILPPQNLSDKVKANLK 829

Query: 276 TDAVKLAKA 284
             A K+A A
Sbjct: 830 EIADKVADA 838

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 71/173 (41%), Gaps = 17/173 (9%)

Query: 158 SSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRARSEAETAFGNGTCF 217
           ++V+EA        YPVII++A+              +++    ++ S +          
Sbjct: 171 ATVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQELKQLSSQSLSLSP------QIL 224

Query: 218 VERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLSKEVR 271
           VER +   K +E +++ D  GN + +    C+++            +  AP++TLS E  
Sbjct: 225 VERSMKGWKEVEYEVVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEY 280

Query: 272 DAILTDAVKLAKASGYRNAGTAEFLVDKQNRHY-FIEINPRIQVEHTITEEIT 323
             + + A+K+ +  G       ++ +      Y  IE+N R+     +  + T
Sbjct: 281 HMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKAT 333

>Kwal_56.24401
          Length = 441

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + + A+G + +GI D  G   P     L+ +++       +  H H+  G  +A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DVA   + G+  +  IT L
Sbjct: 238 YTALEGGAKLIDVA---VLGIGERNGITPL 264

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     LI ++++      I  H H+  G  +A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 239 YTALEGGARLIDV---SVLGIGERNGITPL 265

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DVA   + G+  +  IT L
Sbjct: 241 YTALEGGARLIDVA---VLGIGERNGITPL 267

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 236 YTALEGGAKLIDV---SVLGIGERNGITPL 262

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     LI ++++      I  H H+  G  +A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 225 YTALEGGARLIDV---SVLGIGERNGITPL 251

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 224 YTALEGGAKLIDV---SVLGIGERNGITPL 250

>Scas_704.3
          Length = 438

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      I  H H+  G  +A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITAL 804
                 GA ++DV   S+ G+  +  IT L
Sbjct: 238 YTALEGGARLIDV---SVLGIGERNGITPL 264

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 42  MATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGY 101
           MA +  + YED L+  +   + A ++ ++G Y P G   AI  +   A +HD D I    
Sbjct: 391 MAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFP-AMEHDKDGISASI 449

Query: 102 GFL 104
            FL
Sbjct: 450 VFL 452

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G   +GI D  G   P     L+ ++++      I  H H+  G  + + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 775 VQCAISGADVVDVATNSMSGLTSQPSITALQASLGGDIA 813
                +GA ++DV   S+ G+  +  IT    SLGG +A
Sbjct: 224 YSALEAGARLIDV---SVLGIGERNGIT----SLGGLMA 255

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASM 774
           L + + +  +G + +GI D  G   P     L+ ++++      +  H H+  G  +A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 775 VQCAISGADVVDVA 788
                 GA +VDV+
Sbjct: 241 YTALDGGAKLVDVS 254

>Scas_712.17
          Length = 793

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 83  DEILRIARDHDVDFIHPG--YGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARN 140
           D +   A +HD++ + PG     +        KV   GI   GP A V +  G KV ++ 
Sbjct: 61  DALREFALNHDINLVIPGPEQPLVDGITTIFNKV---GIPVFGPSAKVAQLEGSKVFSKR 117

Query: 141 LAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKA 178
                 +PT        +  E+A++++ +  Y V++KA
Sbjct: 118 FMDKHGIPT--AKYASFTDFEKAKKYLAEVDYNVVLKA 153

>Sklu_2433.7 YGL234W, Contig c2433 9525-11915
          Length = 796

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 62/153 (40%), Gaps = 8/153 (5%)

Query: 87  RIARDHDVDFIHPG--YGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAV 144
           + A D  ++ + PG     +   ++  AKV   GI   GP A      G K  +++  A 
Sbjct: 64  KFALDKSINLVVPGPEQPLVDGISDVFAKV---GIPVFGPSAKAAAFEGSKTFSKDFMAK 120

Query: 145 ADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFXXXXXXXXXXXXXDDIRDAFQRAR 204
            ++PT        S  E+A+ ++    + V++KA               ++ ++A +   
Sbjct: 121 HNIPT--AAYANFSDYEKAKSYLDTVDHQVVLKADGIAAGKGVLIPTTKEEAQEALKTIM 178

Query: 205 SEAETAFGNGTCFVERFLDQPKHIEVQLLADNY 237
            E +      +  +E FL+    I +  ++D Y
Sbjct: 179 VEKQFGSAGESVVIEEFLEG-DEISILTISDGY 210

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,658,624
Number of extensions: 1371821
Number of successful extensions: 3604
Number of sequences better than 10.0: 61
Number of HSP's gapped: 3568
Number of HSP's successfully gapped: 94
Length of query: 1150
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1037
Effective length of database: 12,684,275
Effective search space: 13153593175
Effective search space used: 13153593175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)