Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR160W1891867561e-103
YBR217W (ATG12)1861943237e-38
Sklu_752.22001643056e-35
Scas_686.181801582898e-33
KLLA0C05720g1891822708e-30
CAGL0K06765g1811612653e-29
Kwal_14.18111961682639e-29
CAGL0C01309g111089670.84
ADL046C147488608.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR160W
         (186 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   295   e-103
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   129   7e-38
Sklu_752.2 YBR217W, Contig c752 791-1393                              122   6e-35
Scas_686.18                                                           115   8e-33
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   108   8e-30
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   106   3e-29
Kwal_14.1811                                                          105   9e-29
CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces c...    30   0.84 
ADL046C [1695] [Homologous to ScYGL173C (KEM1) - SH] (603396..60...    28   8.1  

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  295 bits (756), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 161/186 (86%), Positives = 161/186 (86%)

Query: 1   MVPLLESETENSISQSQFDSESASAEPTPPQHTQESLQNRLEEYHERLSRLQLPSSSDSE 60
           MVPLLESETENSISQSQFDSESASAEPTPPQHTQESLQNRLEEYHERLSRLQLPSSSDSE
Sbjct: 1   MVPLLESETENSISQSQFDSESASAEPTPPQHTQESLQNRLEEYHERLSRLQLPSSSDSE 60

Query: 61  CSDIEQESLELEQEVPLSTSVYLAGARSAGGXXXXXXXXXXXXXXKVAIRFQPIGSVGQV 120
           CSDIEQESLELEQEVPLSTSVYLAGARSAGG              KVAIRFQPIGSVGQV
Sbjct: 61  CSDIEQESLELEQEVPLSTSVYLAGARSAGGLPSSSELSETPEPPKVAIRFQPIGSVGQV 120

Query: 121 MPQVCRISSAQSFGAXXXXXXXXXXXDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVV 180
           MPQVCRISSAQSFGA           DTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVV
Sbjct: 121 MPQVCRISSAQSFGAVLVFLRRRLRLDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVV 180

Query: 181 SYCATV 186
           SYCATV
Sbjct: 181 SYCATV 186

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  129 bits (323), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 105/194 (54%), Gaps = 19/194 (9%)

Query: 1   MVPLLESETENSISQSQFDSESASAEPTPPQHTQE------SLQNRLEEYHERLSRLQLP 54
           M  +LESE E    +S   S +        ++ QE      ++QNRLE +  RLS+L L 
Sbjct: 1   MSRILESENETESDESSIISTNNGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA 60

Query: 55  S--SSDSECSDIEQESLELEQEVPLSTSVYLAGARSAGGXXXXXXXXXXXXXXKVAIRFQ 112
           S  S D +  D    S   EQE  + T+   +  +S                 K+ I+FQ
Sbjct: 61  SDISVDQQVED--SSSGTYEQEETIKTNAQTSKQKS---------HKDEKNIQKIQIKFQ 109

Query: 113 PIGSVGQVMPQVCRISSAQSFGAXXXXXXXXXXXDTVHCYVSNSFAPTPQQNVGQLWEQF 172
           PIGS+GQ+ P VC+IS +QSF             D V+CY++NSFAP+PQQN+G+LW QF
Sbjct: 110 PIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQF 169

Query: 173 KVNDELVVSYCATV 186
           K NDEL+VSYCA+V
Sbjct: 170 KTNDELIVSYCASV 183

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  122 bits (305), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 92/164 (56%), Gaps = 15/164 (9%)

Query: 37  LQNRLEEYHERLSRLQL------------PSSSDSECSDIEQESLELEQEVPLSTSVYLA 84
           +Q++LE Y +RLS+L++            PS SD     IE   +   QE+PL+TS+ L 
Sbjct: 35  VQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVP-RQEIPLTTSLILN 93

Query: 85  GA--RSAGGXXXXXXXXXXXXXXKVAIRFQPIGSVGQVMPQVCRISSAQSFGAXXXXXXX 142
               R+                 K+ I+FQPIGS+ Q+ PQVC+IS  QSF         
Sbjct: 94  NLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLRR 153

Query: 143 XXXXDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATV 186
                 V+CY++NSFAPTPQQNVG LW QFK+ +ELVVSYC++V
Sbjct: 154 KLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSV 197

>Scas_686.18
          Length = 180

 Score =  115 bits (289), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 32/158 (20%)

Query: 36  SLQNRLEEYHERLSRL------QLPSSSD-SECSDIEQESLELEQEVPLSTSVYLAGARS 88
           +L+NRLE Y  RLS+L      Q+P  +D +  S  E+E ++ E+   +++         
Sbjct: 45  ALRNRLELYSRRLSQLGLEETPQIPLETDNTSLSQAEKEKIKNEEGPDVNS--------- 95

Query: 89  AGGXXXXXXXXXXXXXXKVAIRFQPIGSVGQVMPQVCRISSAQSFGAXXXXXXXXXXXDT 148
                            KV I+FQPIGSV Q+ P VC+IS+ QSF +           + 
Sbjct: 96  ----------------FKVKIKFQPIGSVPQIKPPVCKISATQSFSSIISFLRKRLRMEN 139

Query: 149 VHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATV 186
           V+CYV++SFAPTPQQNVG LW QFKVNDEL++SYC  V
Sbjct: 140 VYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAV 177

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  108 bits (270), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 99/182 (54%), Gaps = 10/182 (5%)

Query: 13  ISQSQFDSESASAEPTPPQHTQESLQNRLEEYHERLSRLQLPSSSDSECSDIEQESL--- 69
           +S+S+ D+   S   +      ES++ +LEE+  +L+ L+L +  +S+  D E+ESL   
Sbjct: 7   LSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNELRL-ADGNSDGGD-EEESLSPD 64

Query: 70  ---ELEQEVPLSTSVYLAGARS--AGGXXXXXXXXXXXXXXKVAIRFQPIGSVGQVMPQV 124
              + E+    S +V  + +R                    KV IR QPIG++ Q+ P+V
Sbjct: 65  TKSQREESSENSENVSRSTSRPPLTSSIVSSVEREQLKSQVKVKIRLQPIGAIPQIQPRV 124

Query: 125 CRISSAQSFGAXXXXXXXXXXXDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCA 184
           C+IS+ Q F A             +HCY++N+FAP+  QN+G LW QFKVNDEL+VSYC 
Sbjct: 125 CQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCE 184

Query: 185 TV 186
           TV
Sbjct: 185 TV 186

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  106 bits (265), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 84/161 (52%), Gaps = 19/161 (11%)

Query: 31  QHTQESLQNRLEEYHERLSRLQLPSSSDSECSD-----IEQESLELEQEVPLSTSVYLAG 85
           Q  +  ++NRLE+Y  RLS+L L  +++S  S        Q SL  +Q +  S      G
Sbjct: 32  QKRELGVENRLEQYSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSSSHG 91

Query: 86  ARSAGGXXXXXXXXXXXXXXKVAIRFQPIGSVGQVMPQVCRISSAQSFGAXXXXXXXXXX 145
              A                KV I+FQ IGS+  + P VC+IS+ + F            
Sbjct: 92  HTGA--------------PQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRKLK 137

Query: 146 XDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATV 186
            + +HCY++NSFAP P QNVG LW QFKVNDEL+VSYC +V
Sbjct: 138 MENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSV 178

>Kwal_14.1811
          Length = 196

 Score =  105 bits (263), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 85/168 (50%), Gaps = 20/168 (11%)

Query: 36  SLQNRLEEYHERLSRL----------------QLPSSSDSECSDIEQESLELEQEVPLST 79
           ++++ LE+Y  RL+ L                 L SS D++ S +E          P+ST
Sbjct: 29  TVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNR---AHTAPVST 85

Query: 80  SVYLAGARSAGGXXXXXXXXXXXXX-XKVAIRFQPIGSVGQVMPQVCRISSAQSFGAXXX 138
           S  L     AG                K+ IRF+PIGSV QV PQ+ RIS++Q F     
Sbjct: 86  SAILGHLSVAGDQALKKMAEREQELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVVT 145

Query: 139 XXXXXXXXDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATV 186
                   + V+CY++NSF+P PQQ+VG LW  F++ DELVVSYC+ V
Sbjct: 146 FLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGV 193

>CAGL0C01309g 136270..139602 similar to sp|P40480 Saccharomyces
           cerevisiae YIL112w, hypothetical start
          Length = 1110

 Score = 30.4 bits (67), Expect = 0.84,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 8   ETENSISQSQFDSESASAEPTPPQHTQESLQNRL--EEYHERLSRLQ------LPSSSDS 59
           +T+N  +  +   +  S  PT P    +  + RL   +  ER S L          SSDS
Sbjct: 195 KTKNPRNYDEVKDDELSDTPTEPASPPKPRRGRLVRGDQIERSSSLHKDGASSFAGSSDS 254

Query: 60  ECSDIEQESLELEQEVPLSTSVYLAGARS 88
           E SDI+       + VPLS+SV+L G  S
Sbjct: 255 ELSDIDDI-----KSVPLSSSVFLEGGLS 278

>ADL046C [1695] [Homologous to ScYGL173C (KEM1) - SH] (603396..607820)
            [4425 bp, 1474 aa]
          Length = 1474

 Score = 27.7 bits (60), Expect = 8.1,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 19/88 (21%)

Query: 11   NSISQSQFDSESASAEPT----PPQHTQESLQNRLEEY-----HERLSRLQLPSSSDSEC 61
            +S +  Q+  ++A  + T    PP+ T E  + R+EE      HE L+R++  +SS  + 
Sbjct: 1241 HSKASKQYTDKAAKKKQTNVRQPPKITPEQRRKRVEETKKQQAHEMLNRIRNENSSVPDN 1300

Query: 62   SD----------IEQESLELEQEVPLST 79
            S+          I+  S+ +  +VPL+T
Sbjct: 1301 SNQLSGTNFANGIKGPSIIMNTQVPLNT 1328

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.124    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,968,926
Number of extensions: 164041
Number of successful extensions: 1033
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1018
Number of HSP's successfully gapped: 57
Length of query: 186
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 90
Effective length of database: 13,272,781
Effective search space: 1194550290
Effective search space used: 1194550290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 58 (26.9 bits)