Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR158W57156018930.0
KLLA0C05676g511512902e-27
Kwal_14.1817547502771e-25
YBR215W (HPC2)623502719e-25
Scas_686.20515482476e-22
CAGL0K06721g438382003e-16
CAGL0I01870g54978730.92
YBR033W91953721.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR158W
         (560 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH] complement(6...   733   0.0  
KLLA0C05676g 506539..508074 weakly similar to sp|Q01448 Saccharo...   116   2e-27
Kwal_14.1817                                                          111   1e-25
YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for ...   108   9e-25
Scas_686.20                                                           100   6e-22
CAGL0K06721g 654788..656104 some similarities with sp|Q01448 Sac...    82   3e-16
CAGL0I01870g 154612..156261 weakly similar to sp|P38848 Saccharo...    33   0.92 
YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with simil...    32   1.4  

>AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH]
           complement(628892..628910,628995..630691) [1716 bp, 571
           aa]
          Length = 571

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/560 (71%), Positives = 398/560 (71%)

Query: 1   MIPGREVIEDEERQAGTSGGAAKRALDSGGTEVDGMKKQKSIPNIANELAKNRAEVRAPI 60
           MIPGREVIEDEERQAGTSGGAAKRALDSGGTEVDGMKKQKSIPNIANELAKNRAEVRAPI
Sbjct: 1   MIPGREVIEDEERQAGTSGGAAKRALDSGGTEVDGMKKQKSIPNIANELAKNRAEVRAPI 60

Query: 61  SSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKLSPSPQFPALSPTVVPKLESPAEQV 120
           SSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKLSPSPQFPALSPTVVPKLESPAEQV
Sbjct: 61  SSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKLSPSPQFPALSPTVVPKLESPAEQV 120

Query: 121 LGAPHAPQVPAFQLPVLDSXXXXXXXXXXXXXXXXXSVNNPSGQAEAAVANXXXXXXXXX 180
           LGAPHAPQVPAFQLPVLDS                 SVNNPSGQAEAAVAN         
Sbjct: 121 LGAPHAPQVPAFQLPVLDSGAIGGGARAGVAPAAEASVNNPSGQAEAAVANAPARKSAPR 180

Query: 181 XXXXXXXXXXXXXXXEGSRPAAKKASSRPVKKEEPAAVPSDASAGGAGTNKVVLPSQEGG 240
                          EGSRPAAKKASSRPVKKEEPAAVPSDASAGGAGTNKVVLPSQEGG
Sbjct: 181 KKKADGAGAAAKKKAEGSRPAAKKASSRPVKKEEPAAVPSDASAGGAGTNKVVLPSQEGG 240

Query: 241 QANDSPLPSDANTEDQGATPLRASPPANKTNKSLKRTQSNLSSGQKAGSQESQKARKSLS 300
           QANDSPLPSDANTEDQGATPLRASPPANKTNKSLKRTQSNLSSGQKAGSQESQKARKSLS
Sbjct: 241 QANDSPLPSDANTEDQGATPLRASPPANKTNKSLKRTQSNLSSGQKAGSQESQKARKSLS 300

Query: 301 ASNLGNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVP 360
           ASNLGNG                                                   VP
Sbjct: 301 ASNLGNGTTSTSPPPAAGASTAPASKKASGTSGAKKESKGKSKSAASKKKETAAASTTVP 360

Query: 361 DTSSAAAIASHTPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEEXXXXXXXXXXLYQVDTN 420
           DTSSAAAIASHTPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEE          LYQVDTN
Sbjct: 361 DTSSAAAIASHTPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEEDDPVIVVDVPLYQVDTN 420

Query: 421 DYLDENGQVVFNFYNLVHEKFNXXXXXXXXXXXXXXKDRLEQGXXXXXXXXXXXXXXXXX 480
           DYLDENGQVVFNFYNLVHEKFN              KDRLEQG                 
Sbjct: 421 DYLDENGQVVFNFYNLVHEKFNTQQNSQSRTTSSATKDRLEQGDDIAMADDDDDDDEDDE 480

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVGKYDIEDPFIDDSELLWEEQRAATKDGFF 540
                                        RVGKYDIEDPFIDDSELLWEEQRAATKDGFF
Sbjct: 481 DDDDPSASGAAGASPSKSKKKSNPMKGKSRVGKYDIEDPFIDDSELLWEEQRAATKDGFF 540

Query: 541 VYFGPLIQKGQYATFERVDG 560
           VYFGPLIQKGQYATFERVDG
Sbjct: 541 VYFGPLIQKGQYATFERVDG 560

>KLLA0C05676g 506539..508074 weakly similar to sp|Q01448
           Saccharomyces cerevisiae YBR215w HPC2 cell cycle
           regulatory protein singleton, start by similarity
          Length = 511

 Score =  116 bits (290), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 51/51 (100%)

Query: 510 RVGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDG 560
           R+GKYDIEDPFIDDSELLWEEQRAAT+DGFFVYFGPLI+KGQYA+F+RVDG
Sbjct: 450 RIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRVDG 500

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 14/73 (19%)

Query: 371 HTPKVLAPAQPIKSPSV--MDVLDQKFIGTQAAEEXXXXXXXXXXLYQVDTNDYLDENGQ 428
            TP+ L PA  IKSP V  M+V  +  +                 L+ V +NDYLDENGQ
Sbjct: 307 ETPRKLVPAPSIKSPKVTSMEVNGKPIV------------VLDIPLHDVSSNDYLDENGQ 354

Query: 429 VVFNFYNLVHEKF 441
           VVFN YNL+ EK+
Sbjct: 355 VVFNVYNLIQEKY 367

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 22/75 (29%)

Query: 37  KKQKSIPNIANELAKNRAEVRAPISSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKL 96
           KK K +PNIA ELAKNR+    P+S+ +  + +         I +SSLLS          
Sbjct: 31  KKMKVVPNIAEELAKNRS---PPLSNSHNNVKK--------QISISSLLS---------- 69

Query: 97  SPSPQFPAL-SPTVV 110
            P P  P + +PT++
Sbjct: 70  DPQPPKPVIRAPTII 84

>Kwal_14.1817
          Length = 547

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%)

Query: 511 VGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDG 560
           +GKYD EDPFIDDSELLWEEQR ATKDGFFVYFGPLI+KGQYA+FERV+G
Sbjct: 487 IGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNG 536

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 372 TPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEEXXXXXXXXXXLYQVDTNDYLDENGQVVF 431
           +P+ L P  P+K PS++D LD+        ++          LY  ++N+YLDENGQVVF
Sbjct: 351 SPRKLLPTAPLKMPSLLDSLDE---TKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVF 407

Query: 432 NFYNLVHEKF 441
           NFY LV++KF
Sbjct: 408 NFYKLVNDKF 417

>YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for
           regulation of histone gene transcription throughout the
           cell cycle [1872 bp, 623 aa]
          Length = 623

 Score =  108 bits (271), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%)

Query: 511 VGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDG 560
           +GKYD+EDPFIDDSELLWEEQRAATKDGFFVYFGPLI+KG YA+ ER +G
Sbjct: 564 IGKYDVEDPFIDDSELLWEEQRAATKDGFFVYFGPLIEKGHYASLERANG 613

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/29 (68%), Positives = 24/29 (82%)

Query: 414 LYQVDTNDYLDENGQVVFNFYNLVHEKFN 442
           LYQ DTNDYLDENGQV+FN   L+ EK++
Sbjct: 456 LYQADTNDYLDENGQVIFNLSTLIKEKYH 484

>Scas_686.20
          Length = 515

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 46/48 (95%)

Query: 511 VGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERV 558
           +GKYDIEDPFIDDSELLWEEQ+A+TK+GFFVYFGPLI+KGQ A+ E+V
Sbjct: 455 IGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKV 502

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 414 LYQVDTNDYLDENGQVVFNFYNLVHE 439
           LY    N+YLDENG VVFN + L+ E
Sbjct: 332 LYSTQNNEYLDENGSVVFNVFKLIQE 357

>CAGL0K06721g 654788..656104 some similarities with sp|Q01448
           Saccharomyces cerevisiae YBR215w Histone promoter
           control 2 protein, hypothetical start
          Length = 438

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 36/38 (94%)

Query: 511 VGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQ 548
           +GKYDIEDPFIDDSEL WEE RAAT+DGFFV+FGPL++
Sbjct: 378 IGKYDIEDPFIDDSELQWEEYRAATRDGFFVFFGPLVE 415

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 372 TPKVLAPAQPI---KSPSVMDVLDQKFIGTQAAEEXXXXXXXXXXLYQVDTNDYLDENGQ 428
           TPK  +P + +   KSP++M VL++     +              L   D+N YL E+ Q
Sbjct: 236 TPKPRSPKRALPTTKSPNIMSVLEKGKTDIKTLSRPDIIIDVPLSLD--DSNAYLSEDNQ 293

Query: 429 VVFNFYNLVHEKF 441
           V+FNF  L+ EK+
Sbjct: 294 VIFNFQKLIDEKY 306

>CAGL0I01870g 154612..156261 weakly similar to sp|P38848
           Saccharomyces cerevisiae YHR150w, hypothetical start
          Length = 549

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 217 AVPSDASAGGAGTNKVVLPSQE----GGQANDSPLPS--DAN-TEDQGATPLRASPPANK 269
           ++  D   GG  TN V+LPS E    G Q N++ L +  D N T D+       SP A K
Sbjct: 234 SLIHDLFHGGKKTNNVLLPSNENDCNGEQENEADLGTSDDCNGTSDENVV---ISPAAAK 290

Query: 270 TNKSLKRTQSNLSSGQKA 287
            +K++  +  NL+ G K 
Sbjct: 291 IDKNI--STYNLNHGTKV 306

>YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2760 bp, 919 aa]
          Length = 919

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 73  RPRMHAIPLSSLLSPSVDYGYPKLSPSPQFPALSPTVVPKLESPAEQVLGAPH 125
           RPR H+ P++S      +Y  P L+ +  FP++S   VP + + ++Q +  P+
Sbjct: 119 RPRTHSYPMNS----GNNY-LPSLARNSSFPSISSLFVPSITAQSQQFVKVPY 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.126    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,188,174
Number of extensions: 502889
Number of successful extensions: 1838
Number of sequences better than 10.0: 65
Number of HSP's gapped: 1864
Number of HSP's successfully gapped: 81
Length of query: 560
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 453
Effective length of database: 12,891,983
Effective search space: 5840068299
Effective search space used: 5840068299
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)