Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR090W65964729630.0
YGR099W (TEL2)6886627788e-94
Scas_716.266866707552e-90
KLLA0D15158g6666416965e-82
Kwal_55.205296916666941e-81
CAGL0G07755g6856655495e-61
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR090W
         (647 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...  1145   0.0  
YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...   304   8e-94
Scas_716.26                                                           295   2e-90
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...   272   5e-82
Kwal_55.20529                                                         271   1e-81
CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...   216   5e-61

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/647 (89%), Positives = 576/647 (89%)

Query: 1   MHFQVLETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGK 60
           MHFQVLETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGK
Sbjct: 1   MHFQVLETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGK 60

Query: 61  SSVLMSXXXXXXXXXRGRPEAGIYQRVLRETLEREPGALAHQLAGGGPTQRRLVTALFFG 120
           SSVLMS         RGRPEAGIYQRVLRETLEREPGALAHQLAGGGPTQRRLVTALFFG
Sbjct: 61  SSVLMSQVVVAAQQVRGRPEAGIYQRVLRETLEREPGALAHQLAGGGPTQRRLVTALFFG 120

Query: 121 SRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPEDAEVLVALLRFHPTQAADALVDLV 180
           SRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPEDAEVLVALLRFHPTQAADALVDLV
Sbjct: 121 SRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPEDAEVLVALLRFHPTQAADALVDLV 180

Query: 181 LCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLFNLL 240
           LCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLFNLL
Sbjct: 181 LCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLFNLL 240

Query: 241 ELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTDDEKRCNLFAILIARMAGPEL 300
           ELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTDDEKRCNLFAILIARMAGPEL
Sbjct: 241 ELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTDDEKRCNLFAILIARMAGPEL 300

Query: 301 EKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAHIKLPVPPLRPKGTI 360
           EKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAHIKLPVPPLRPKGTI
Sbjct: 301 EKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAHIKLPVPPLRPKGTI 360

Query: 361 CFEEITTPRASAYVNNSAVEPQLGALTLXXXXXXXXXXXXXXXXXXIVFLKDLLVELEAP 420
           CFEEITTPRASAYVNNSAVEPQLGALTL                  IVFLKDLLVELEAP
Sbjct: 361 CFEEITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSDGERRGREIVFLKDLLVELEAP 420

Query: 421 DLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNSQSEQDFEEYRINALV 480
           DLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNSQSEQDFEEYRINALV
Sbjct: 421 DLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNSQSEQDFEEYRINALV 480

Query: 481 SLLVAVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXXXXXXXEDKYVLKPVFDFPTRR 540
           SLLVAVPEKVTDLLHLLFQADLSLQQ                  EDKYVLKPVFDFPTRR
Sbjct: 481 SLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALAARELRGLEDKYVLKPVFDFPTRR 540

Query: 541 LPRNDAPSRALXXXXXXXXXXXXXXAHHTVWRSRKLDSAPAPERPNAFRKXXXXXXXXXX 600
           LPRNDAPSRAL              AHHTVWRSRKLDSAPAPERPNAFRK          
Sbjct: 541 LPRNDAPSRALESRESGTSSEGTISAHHTVWRSRKLDSAPAPERPNAFRKHAPAFFFPLA 600

Query: 601 XXWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELMSYV 647
             WLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELMSYV
Sbjct: 601 HAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELMSYV 647

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score =  304 bits (778), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 212/662 (32%), Positives = 326/662 (49%), Gaps = 31/662 (4%)

Query: 15  MEQVLSELEQSPMAP---EAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLMSXXXXX 71
           + + L +L+  P  P   +A++V+++ V+  Y SLP R + +LRRL  KS   +      
Sbjct: 15  IHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRLASKSFTFLCQIVTF 74

Query: 72  XXXXRGRP---EAGIYQRVLRETLEREPGALAHQLAGGGPTQ--RRLVTALFFGSRVFNV 126
                GR    E  IYQ +L + +  EPG L   L     ++  R  + ALFFGS++FNV
Sbjct: 75  SRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRDSIKALFFGSKLFNV 134

Query: 127 LAHTLSAAAYVSLLTPQLQTWFEKGAGAPED--AEVLVALLRFHPTQAADALVD--LVLC 182
           LA+ +  A Y+  L  Q +   E     P     E LV+    +P  AAD L+    +L 
Sbjct: 135 LANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPVLAADMLLGELFLLK 194

Query: 183 EVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDY-RLFNLLE 241
           E  +  F KI +    + Q++L+  FLL  +  +V   N+     +L   D  ++ +L  
Sbjct: 195 ESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKILRRFDLDKIISLSV 254

Query: 242 LHKVNSVHLQSAIVQVLPESGCEALLKICLGMFG--TPDTDDEKRCNLFAIL-IARMAGP 298
           L ++ S+ L+  IV+++        +   +  F   T +  D K C L  +  +  +   
Sbjct: 255 LFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTCELLVLFAVHNLNHS 314

Query: 299 ELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAHIKLPVPPLRPKG 358
           + E+I HD++FL+ VT  L S +   R+R M IAK ++G  LKYE+   K+ +P ++ + 
Sbjct: 315 QREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES-DFKINIPNVKFES 373

Query: 359 T-----ICFEEITTPRASAYVNN------SAVEPQLGALTLXXXXXXXXXXXXXXXXXX- 406
                 I F+ +  P       +      + V   + +LTL                   
Sbjct: 374 NSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLDCSDSDDEDENDEREIVKR 433

Query: 407 IVFLKDLLVELEAPDLSERGPLR-LLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNS 465
           IVFLKDL+ E E    S + PL  LLK T+KL+RQK  F  EV +YA  +L+++  ++N 
Sbjct: 434 IVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEVGYYAQGILSSIVCLNNE 493

Query: 466 QSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXXXXXXXE 525
             E  FE++RINAL S+LV +PEKV   +++LF ++LSLQQ                  +
Sbjct: 494 FDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRMSLLSALGLSARELRGLD 553

Query: 526 DKYVLKPVFDFPTRRLPRNDAPSRALXXXXXXXXXXXXXXAHHTVWRSRKLDSAPAPERP 585
           D  ++KP FDFPT RLP +D  S                    TVW+SRKL         
Sbjct: 554 DPTIVKPKFDFPTNRLPWDDQ-SHHNSRLVEVQESTSMIKKTKTVWKSRKLGKDREKGTQ 612

Query: 586 NAFRKXXXXXXXXXXXXWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELMS 645
           N FRK            WLNGID+GT++ LFK HYL+TLR+I + ANP  +F+ M+ELM+
Sbjct: 613 NRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIYSCANPVHDFESMTELMN 672

Query: 646 YV 647
           ++
Sbjct: 673 HI 674

>Scas_716.26
          Length = 686

 Score =  295 bits (755), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 215/670 (32%), Positives = 327/670 (48%), Gaps = 28/670 (4%)

Query: 3   FQVLETTSNVEVMEQVLSELEQSPMAP--EAALVVLQRVVTAYESLPSRLQAMLRRLCGK 60
           F+VL+   + +V+E VL +L     AP  E  L+++Q V+  Y SL    + + + L  +
Sbjct: 4   FKVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSR 63

Query: 61  SSVLMSX-XXXXXXXXRGRPEAGIYQRVLRETLEREPGALAHQL--AGGGPTQRRLVTAL 117
           S   MS          + +PE  +Y+  ++E L  +P  L + L        ++  +  L
Sbjct: 64  SFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKTL 123

Query: 118 FFGSRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPE---DA---EVLVALLRFHPTQ 171
           FFGSRVFN L + +    Y+ LL  Q ++  +          D+   E+LV+ L  +PT 
Sbjct: 124 FFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPTY 183

Query: 172 AADALV-DLVL-CEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLL 229
           A D L  DL L  E    I  KI      + Q++LVN FLL  L  L   SN ++   +L
Sbjct: 184 AMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHIL 243

Query: 230 LTLD-YRLFNLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPD-TDDEKRCNL 287
             L  ++   L  + ++ S  LQ  I++ + E    +++   +  FGT D + DE  C +
Sbjct: 244 RELPLHKCITLDVILRMKSHILQEIIIRQMSEFAS-SIIPSLISKFGTLDESQDEDICII 302

Query: 288 FAILIA-RMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAH 346
           F +++   +   + E++ HD  FL A+T RL+ ++   R+RTM IAK  +   L+Y++  
Sbjct: 303 FVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSDF 362

Query: 347 -IKLPVPPLRPKGTICFEEITTPRASAYVNNSAVE---PQLGALTLXXXXXXXXXXXXXX 402
            IKLP   +     I  +     R+S+ V+ S V         + L              
Sbjct: 363 VIKLPDLDITNNEKIEIDPALFKRSSSGVSASKVSRISSGFHEMVLQEDSDDEVQDDEQE 422

Query: 403 XXXXIVFLKDLLVELEAPDLSERGP---LRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAV 459
               IVFLKDL+ E E       GP   + LLK TI LVRQK+ F  EV +Y   +LT +
Sbjct: 423 IINRIVFLKDLVKEFEKN--GNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNI 480

Query: 460 ATISNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXX 519
           A ++N+  E +FEE+RINALVSLLV VPEKV +L+ +   ++LSLQQ             
Sbjct: 481 AYLNNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSAR 540

Query: 520 XXXXXEDKYVLKPVFDFPTRRLP--RNDAPSRALXXXXXXXXXXXXXXAHHTVWRSRKLD 577
                +DK + KP  DFPT RLP  +                         T W+S+KL 
Sbjct: 541 ELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIETKTTWKSKKLT 600

Query: 578 SAPAPERPNAFRKXXXXXXXXXXXXWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEF 637
            A   ++PN FR+            WLNGID+GTFD LFK H+L+TLR+I   A+P  ++
Sbjct: 601 LAAKEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDY 660

Query: 638 DRMSELMSYV 647
           + M++LM  +
Sbjct: 661 ESMTQLMEQI 670

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score =  272 bits (696), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 188/641 (29%), Positives = 305/641 (47%), Gaps = 18/641 (2%)

Query: 13  EVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLMSXXXXXX 72
           +V+E++ S+ + S       L +++ VV  Y SLP  L+  LRRLCG + + +S      
Sbjct: 20  QVLERMSSKKQHSS---NEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIFISLVIEYA 76

Query: 73  XXXRGRPEAGIYQRVLRETLEREPGALAHQLAGGGPTQRRLVTALFFGSRVFNVLAHTLS 132
                  E  I+   L + L+ E   L + L          + ++ FGSR +N L+ ++S
Sbjct: 77  KELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSRRDLPFIKSILFGSRCYNALSSSIS 136

Query: 133 AAAYVSLLTPQLQTWFEKGAGAPEDA-EVLVALLRFHPTQAADALVD--LVLCEVRWQIF 189
              Y+  +  Q +  F++     +   E+ V+ L+ +     D  ++      E  W   
Sbjct: 137 IVEYLKFMKMQWEFVFKETKQYDKTHLEMFVSCLQLNIPYGVDIFIEGLATTSEFSWNAL 196

Query: 190 CKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLFNLLELHKVNSVH 249
             + ++   V QR+     L+  L ++    N    + LL  L + +   ++  K  + +
Sbjct: 197 IMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTSIDCFKWGNPY 256

Query: 250 LQSAIVQVLPESGCEALLKICLGMFGTPD-TDDEKRCNLFAILIARMAGPELEKIVHDQQ 308
            +   +  + E+    L +  L  F   D   D+    +  +++  M+    +++ HD  
Sbjct: 257 FKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKDSRDELSHDAI 316

Query: 309 FLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAAH-IKLPVPPLRPKGTICF---EE 364
            L+ VT RL SED  VR+RTM +AK +  + L+YE+   I LP   L     + F   E 
Sbjct: 317 SLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPRIELIKLSKLEFPIKEG 376

Query: 365 ITTPRASAYVNNSAVEPQLGALTLXXXXXXXXXXXXXXXXXXIVFLKDLLVELEAPDLSE 424
           +          N  V+ Q   +TL                  I+FLKDLL+E E    ++
Sbjct: 377 LQNLPKGNSTKNELVQ-QFNTITLQDSDDESDEEDSRD----ILFLKDLLLEFEKVIKND 431

Query: 425 RGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNSQSEQDFEEYRINALVSLLV 484
              LRLLK T+KLVRQK+ F +EVSFY+  +L  +ATISN   E+ FEE++ NALVS+LV
Sbjct: 432 GSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEEWKANALVSILV 491

Query: 485 AVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXXXXXXXEDKYVLKPVFDFPTRRLPRN 544
             P+K+ DL  +LF  +LSLQQ                  +D++V+KP +DFPT RLP +
Sbjct: 492 VCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPKYDFPTNRLPWD 551

Query: 545 DAPSRALXXXXXXXXXXXXXXAHHTVWRSRKLDS-APAPERPNAFRKXXXXXXXXXXXXW 603
           ++ +                      WRS++L++ +   ++ N FRK            W
Sbjct: 552 ESATEQ-QPENNKIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYATLFFYPLAHAW 610

Query: 604 LNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSELM 644
           LNGI+LG FD +FK+HY+S L++IL  A+PH E + M  LM
Sbjct: 611 LNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILM 651

>Kwal_55.20529
          Length = 691

 Score =  271 bits (694), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 196/666 (29%), Positives = 326/666 (48%), Gaps = 35/666 (5%)

Query: 4   QVLETTSNVEVMEQVLSELE-QSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSS 62
           + L+T  + EV+++ LS ++ Q+ +  E+A V+ + V+  Y SLPS  + +L  +  +S 
Sbjct: 15  ETLKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEESF 74

Query: 63  VLMSXXXXXXXXXRGRPEAGIYQRVLRETLEREPGALAHQLAGGGP-TQRRLVTALFFGS 121
           +L+          +   EA IY+R L E L    G +   + G    T+ +++ + FFGS
Sbjct: 75  LLLGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEHITELQMLRSAFFGS 134

Query: 122 RVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPED--AEVLVALLRFHPTQAADALVD- 178
           ++ N +   +    Y+ ++  Q +  F++     +   A+ L A +  H   A + +   
Sbjct: 135 KILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSLLAPEVVFGG 194

Query: 179 LVLC-EVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLF 237
           LVL  E  +  F +I      + Q++LV   +     R+ +A N  +A+++   +   L 
Sbjct: 195 LVLSSEDHFSKFVQILRCASLLSQKKLVKALIFFLDSRVSQA-NTDSAFNIFQRVGVELL 253

Query: 238 NLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTD-DEKRCNLFAILIARMA 296
           +   L KV++  L + +V+ L E     L    L  F   + + D   C L  + + R+ 
Sbjct: 254 STDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQRLP 313

Query: 297 GPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAA------HIKLP 350
                ++ H ++FL+AVTFRL S+D A+R+RTM IAK +  +S +YE+       HIK P
Sbjct: 314 HSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIETPHIKTP 373

Query: 351 VPPLRPKGTI-----CFEEITTPRASAYVNNSAVEPQLGALTLXXXXXXXXXXXXXXXXX 405
              +    T+       +     + SA ++N+ V   L                      
Sbjct: 374 KSSIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSE------------SETDENGV 421

Query: 406 XIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNS 465
            +VFLKDL+ E E         L LLK T++L+RQK+ F  E+S Y+P +L  + +++N+
Sbjct: 422 TLVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLANN 481

Query: 466 QSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXXXXXXXE 525
             E  FEE+RINALVS+L A PEKV +L+ +LF  +LSLQQ                  +
Sbjct: 482 LEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMSILSALSLAARELRGID 541

Query: 526 DKYVLKPVFDFPTRRLPRNDAPSRALXXXXXXX---XXXXXXXAHHTVWRSRKL-DSAPA 581
           D  ++K   DFPT+RLP +      +                  + T W+S+KL  SA  
Sbjct: 542 DSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENKTTWKSKKLTTSAKD 601

Query: 582 PERPNAFRKXXXXXXXXXXXXWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMS 641
               N FRK            WLNGI++GT+D +FKKHYL+T++++L+AA PH EF+ M 
Sbjct: 602 ILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSMC 661

Query: 642 ELMSYV 647
           + M+ +
Sbjct: 662 QQMAII 667

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score =  216 bits (549), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 191/665 (28%), Positives = 292/665 (43%), Gaps = 31/665 (4%)

Query: 6   LETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLM 65
           LE    V  ++ V  E + S    +  L V++ VV+ ++ +P  +   L      S +  
Sbjct: 15  LEVDELVTTLDTVFQE-KDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGF 73

Query: 66  SXXXXXXXXXRGR-PEAGIYQRVLRETLEREPGALAHQL--AGGGPTQRRLVTALFFGSR 122
           S           +  E  IY   + + L+     L + L       T+  ++   F GS 
Sbjct: 74  SQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGST 133

Query: 123 VFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPED-----AEVLVALLRFHPTQAADALV 177
           VFN +   L+   Y+ LL  QL    +K      D        + +L  FH   A D ++
Sbjct: 134 VFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCDFHNIFAPDVIL 193

Query: 178 D--LVLCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDY- 234
               ++ + R +       +     + ++   +LL  L ++   +N Q  + +L TL   
Sbjct: 194 SKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHILGTLGIG 253

Query: 235 RLFNLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTD-DEKRCNLF-AILI 292
           +L  + ++ ++NS  LQ  I+ +L     ++++   L  F + + + D   C L   IL 
Sbjct: 254 KLILVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILK 313

Query: 293 ARMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEA-------- 344
             +      K+ H  QFL+A+T RL+ +D  +R+R+M IAK  +   + YE+        
Sbjct: 314 NHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGK 373

Query: 345 --AHIKLPVPPLRPKGTICFEEITTPRASAYVNNSAVEPQLGALTLXXXXXXXXXXXXXX 402
             AH    VP       +          S+  N S     L AL L              
Sbjct: 374 SIAHENYEVPESDWSLILNSVNSNVNTNSSDTNISTSTHALEALNLDDSDDEEDEEGDQL 433

Query: 403 XXXXIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATI 462
                VFLKDL   LE    S+RG   +LK T+KLVRQK+ F SEV++YA AM+  +  +
Sbjct: 434 KY---VFLKDLTAALENK--SQRGLTNILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVIL 488

Query: 463 SNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQXXXXXXXXXXXXXXXX 522
           +N   E+ FEE R+NALVS+LV VPEK+ +LL +LF A+LSLQQ                
Sbjct: 489 NNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAELSLQQRLSLLLSVSMSARELR 548

Query: 523 XXEDKYVLKPVFDFPTRRLPRNDAPSRALXXXXXXXXXXXXXXAHHTVWRSRKLDSAPAP 582
             +DK +LKP FDFPT  LP  D                        +W+S KL +    
Sbjct: 549 GYDDKQILKPQFDFPTSMLPW-DRRQENNRIEEIDDNGSDNTSGGKVLWKSSKL-TKNTE 606

Query: 583 ERPNAFRKXXXXXXXXXXXXWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMSE 642
           E  N FR+            WLNGIDLGTFD LFK +YLSTL+ +   A    +F+ M+ 
Sbjct: 607 EINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDMTT 666

Query: 643 LMSYV 647
            M  +
Sbjct: 667 TMDTI 671

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,417,653
Number of extensions: 567180
Number of successful extensions: 1241
Number of sequences better than 10.0: 6
Number of HSP's gapped: 1239
Number of HSP's successfully gapped: 10
Length of query: 647
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 539
Effective length of database: 12,857,365
Effective search space: 6930119735
Effective search space used: 6930119735
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)