Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR087C23222812191e-172
KLLA0D15103g2212194845e-61
CAGL0G03201g2152174411e-54
Kwal_55.205442082364235e-52
Scas_716.27d2212164081e-49
AEL238C32043633.0
Scas_662.1230837608.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR087C
         (228 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR087C [273] [Homologous to NOHBY] (499168..499866) [699 bp, 23...   474   e-172
KLLA0D15103g complement(1275080..1275745) similar to ca|CA0389|I...   191   5e-61
CAGL0G03201g complement(299021..299668) similar to KLLA0D15103g ...   174   1e-54
Kwal_55.20544                                                         167   5e-52
Scas_716.27d                                                          161   1e-49
AEL238C [2268] [Homologous to ScYPL069C (BTS1) - SH] (189143..19...    29   3.0  
Scas_662.12                                                            28   8.3  

>AAR087C [273] [Homologous to NOHBY] (499168..499866) [699 bp, 232
           aa]
          Length = 232

 Score =  474 bits (1219), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%)

Query: 1   MLSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTSSMKGVTLGSATSLALQ 60
           MLSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTSSMKGVTLGSATSLALQ
Sbjct: 1   MLSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTSSMKGVTLGSATSLALQ 60

Query: 61  PRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMPTRP 120
           PRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMPTRP
Sbjct: 61  PRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMPTRP 120

Query: 121 FEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLIC 180
           FEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLIC
Sbjct: 121 FEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLIC 180

Query: 181 ECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG 228
           ECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG
Sbjct: 181 ECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG 228

>KLLA0D15103g complement(1275080..1275745) similar to
           ca|CA0389|IPF14465 Candida albicans unknown function,
           start by similarity
          Length = 221

 Score =  191 bits (484), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 132/219 (60%), Gaps = 36/219 (16%)

Query: 20  HYVTQQKFKETMSRISNQVMILTTS--------SMKGVTLGSATSLALQPRPMIQFNLQL 71
           H +TQQKF+ETM RI NQ MILTT+          +GVTL S TSL+L P P+IQFNLQL
Sbjct: 21  HDITQQKFRETMGRICNQAMILTTAVPIHCNSDRFRGVTLSSVTSLSLMPIPLIQFNLQL 80

Query: 72  PSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSG-VMPTRPFEALAAGADF 130
           PSFTS  LH    FALHLM P EQS+ LAR FSKGA++   +G ++PT+PF  L  G ++
Sbjct: 81  PSFTSDFLHDFNHFALHLMKPNEQSIHLARNFSKGAMKNTHNGEIVPTQPFVGLQEGVEY 140

Query: 131 ALHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLICECIRCFRVGD 190
                                     D   +    + +P+L +AERV++C+ ++ F VGD
Sbjct: 141 --------------------------DTYDINGTNLRIPLLKNAERVIVCQGLKTFNVGD 174

Query: 191 HEIWVGMVEEILS-PANNAPNSAVTGGLMYCNRQFFKIG 228
           HEIWVG VE+I++  +    +  ++GGL+YCNR F  +G
Sbjct: 175 HEIWVGKVEDIVNRTSEEGADDPISGGLLYCNRNFHTLG 213

>CAGL0G03201g complement(299021..299668) similar to KLLA0D15103g
           Kluyveromyces lactis, hypothetical start
          Length = 215

 Score =  174 bits (441), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 124/217 (57%), Gaps = 42/217 (19%)

Query: 20  HYVTQQKFKETMSRISNQVMILTTSS--------MKGVTLGSATSLALQPRPMIQFNLQL 71
           H VTQQKFKE+M++++NQ M+LT +S          G+T+ S TSLAL+P PMIQFNLQL
Sbjct: 30  HVVTQQKFKESMAKVANQAMVLTAASPVGTSHELFHGLTISSMTSLALKPHPMIQFNLQL 89

Query: 72  PSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMPTRPFEALAAGADFA 131
           PS TS  LH+ R FA+HL+ PT +S+ + R FSKGA++    G+  T PF+ L     + 
Sbjct: 90  PSATSDTLHQNRYFAIHLLNPTNESIDIIRNFSKGALQ----GINRTMPFKDLEMNEHYM 145

Query: 132 LHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLICECIRCFRVGDH 191
           +HK    T                           +LP+L  A+  +IC+    FRVGDH
Sbjct: 146 IHKIGNKT-------------------------NYDLPILKEAQLAIICKKKNVFRVGDH 180

Query: 192 EIWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG 228
           EIWVG+VE+ +       N    GG++YCNR F K+G
Sbjct: 181 EIWVGVVEDTI-----VMNDDTNGGVLYCNRNFHKLG 212

>Kwal_55.20544
          Length = 208

 Score =  167 bits (423), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 143/236 (60%), Gaps = 45/236 (19%)

Query: 2   LSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTSS--------MKGVTLGS 53
           ++R   T+ R+AL         QQKFK++M+R+ +Q MILT++          +GVTL S
Sbjct: 5   IARYQCTINRNAL--------IQQKFKDSMARMGSQAMILTSAGKSSLPHKLYRGVTLSS 56

Query: 54  ATSLALQPRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDS 113
            +SL+L+P+P++QFNLQLPSFTS  LH    FA+HL+ P   S++LAR+FSKGA++  +S
Sbjct: 57  VSSLSLKPQPLLQFNLQLPSFTSDSLHSHGFFAVHLLKPDLDSMQLARIFSKGAMKHKES 116

Query: 114 G-VMPTRPFEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLA 172
           G ++PT PF+ L     + L+                          AL    + +PVL 
Sbjct: 117 GEIIPTEPFKDLTESVHYELY--------------------------ALNNCDLSVPVLK 150

Query: 173 SAERVLICECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG 228
           ++ERV +C     FRVGDHEIWVG+V++I+   N   +++V+GGL+YC+R+F K+G
Sbjct: 151 NSERVFVCRKKDVFRVGDHEIWVGLVDDIIE--NTTDSASVSGGLLYCDRRFHKLG 204

>Scas_716.27d
          Length = 221

 Score =  161 bits (408), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 124/216 (57%), Gaps = 39/216 (18%)

Query: 22  VTQQKFKETMSRISNQVMILTTS--------SMKGVTLGSATSLALQPRPMIQFNLQLPS 73
           VTQ +FKETMSR+SN V I+T +        +  G+T+ S TSLAL P P+IQFNL+LPS
Sbjct: 18  VTQTRFKETMSRVSNSVSIVTAAVGIDQKQDTYHGLTISSMTSLALNPFPLIQFNLKLPS 77

Query: 74  FTSQELHKRRKFALHLMAPTEQSVKLARLFSKGAIRRPDSGVMP-TRPFEALAAGADFAL 132
           FTS+ LHK   F +HL+   E++VKLA  FSKGA R+ ++G+   T+PF  L  GADF  
Sbjct: 78  FTSESLHKYGYFGVHLLGSNERAVKLANQFSKGA-RQCENGLFERTKPFIGLKEGADFET 136

Query: 133 HKTSASTGGSLEPVVEDEILDHGLDKPALGARTVELPVLASAERVLICECIRCFRVGDHE 192
           H    S                            ++P+L    R+LIC+ +  FR+GDHE
Sbjct: 137 HYIKHSE--------------------------FKIPLLKYCRRILICKKVEVFRIGDHE 170

Query: 193 IWVGMVEEILSPANNAPNSAVTGGLMYCNRQFFKIG 228
           IWVG V +I+    N  + +  GGL++ NR F K+G
Sbjct: 171 IWVGKVNDIII---NDVHDSDHGGLLHYNRGFHKLG 203

>AEL238C [2268] [Homologous to ScYPL069C (BTS1) - SH]
          (189143..190105) [963 bp, 320 aa]
          Length = 320

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 10 QRDALRQYYSHYVTQ--QKFKETMSRISNQVMILTTSSMKGVT 50
          Q + LRQ Y+H VTQ  + F+ T+ R+ N    L+   +  VT
Sbjct: 18 QEELLRQPYNHLVTQPGKNFRNTLIRVFNGFYGLSERQVAAVT 60

>Scas_662.12
          Length = 308

 Score = 27.7 bits (60), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%)

Query: 46 MKGVTLGSATSLALQPRPMIQFNLQLPSFTSQELHKR 82
          + G++ GS T+L + P  +I+  LQL + T+ + H++
Sbjct: 12 ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQK 48

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,675,332
Number of extensions: 244943
Number of successful extensions: 644
Number of sequences better than 10.0: 10
Number of HSP's gapped: 631
Number of HSP's successfully gapped: 10
Length of query: 228
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 130
Effective length of database: 13,203,545
Effective search space: 1716460850
Effective search space used: 1716460850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)