Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR036W31731114210.0
KLLA0D15015g3173036901e-89
Kwal_23.39653073056273e-80
YGR096W (TPC1)3143075701e-71
Scas_716.293163045311e-65
CAGL0G03135g3073075264e-65
CAGL0F04213g3062892027e-18
Scas_667.43082691965e-17
YBL030C (PET9)3182691851e-15
YPR011C3262881834e-15
AER184W3052901815e-15
AGL047C3162841791e-14
Scas_718.243372691772e-14
Sklu_2363.23232961762e-14
Scas_721.1293232891763e-14
Kwal_27.124813042871736e-14
Kwal_14.22103152851736e-14
YBR085W (AAC3)3072871728e-14
CAGL0K11616g3203231693e-13
Scas_669.63733381676e-13
YJR095W (SFC1)3222851603e-12
KLLA0D04290g1881111554e-12
KLLA0B12826g3192921561e-11
CAGL0J01661g3272871552e-11
Kwal_55.208683802881552e-11
AFL196W3612891552e-11
Kwal_47.182163333101542e-11
Sklu_2334.23192831523e-11
YMR056C (AAC1)3092851505e-11
KLLA0E12353g3052691471e-10
AGL311C3622811482e-10
YKL120W (OAC1)3242891472e-10
Sklu_2430.103243311435e-10
Kwal_26.76533252921436e-10
AGR383W2932911427e-10
Kwal_23.47313142971418e-10
KLLA0F04697g3071421401e-09
KLLA0E02772g2842861391e-09
Scas_691.43342981347e-09
ADL009W3792811349e-09
YIL006W3732891341e-08
AEL253W3653121331e-08
CAGL0J02002g3612891321e-08
Scas_709.93651491322e-08
AGL064W296651293e-08
Sklu_2037.23103001284e-08
YJL133W (MRS3)3142081275e-08
AGL065C3353211276e-08
YHR002W (LEU5)3571091269e-08
Scas_589.103162921251e-07
YKR052C (MRS4)3042771241e-07
YGR257C (MTM1)3662641241e-07
KLLA0E15532g3262641241e-07
CAGL0M09020g3482651232e-07
YOR222W (ODC2)3072871223e-07
Scas_717.203561091223e-07
AFR131C3442601213e-07
Kwal_26.79723581161214e-07
CAGL0L02079g297621204e-07
Kwal_26.7967297621204e-07
YEL006W3351501205e-07
Scas_632.92922771195e-07
Kwal_33.140503142071196e-07
YBR291C (CTP1)2991251196e-07
KLLA0C11363g5171501207e-07
YNL083W5451491198e-07
KLLA0E08877g2942901179e-07
CAGL0F07711g3681481171e-06
Kwal_55.213353172781161e-06
Sklu_2115.42992911161e-06
CAGL0F08305g3742721162e-06
Sklu_1149.22961251152e-06
CAGL0K12210g3112841152e-06
Scas_489.42971311142e-06
KLLA0E23705g3681491143e-06
CAGL0K02915g3421361133e-06
Sklu_2374.75131501143e-06
YBR104W (YMC2)3292921134e-06
Scas_718.53242821125e-06
Sklu_2127.52782731115e-06
YNL003C (PET8)2841381115e-06
KLLA0E18810g377701125e-06
Scas_578.3*5241491117e-06
Kwal_27.120813693121117e-06
Sklu_2431.53701551109e-06
ACR260W3112861099e-06
Scas_558.22891411099e-06
Scas_721.273742651101e-05
Scas_379.23012001091e-05
Scas_582.73292021091e-05
CAGL0G08910g2891391081e-05
Scas_662.123081551081e-05
YMR166C3681661082e-05
Kwal_23.43543432681072e-05
Kwal_23.30425421201082e-05
Kwal_33.155973051131062e-05
YPR021C (AGC1)902611073e-05
Sklu_1119.13071121053e-05
KLLA0E18788g3811091063e-05
KLLA0F03212g3052841044e-05
Scas_697.473281451054e-05
KLLA0B14454g3051111044e-05
YIL134W (FLX1)3112931045e-05
Scas_602.8885611055e-05
Sklu_2359.69021491055e-05
Scas_645.9391891046e-05
AER366W2931891027e-05
Sklu_2432.52881421027e-05
AER450C3081131027e-05
Kwal_23.57573071081011e-04
Kwal_33.154463051381011e-04
Scas_328.1227101991e-04
CAGL0F00231g3071121002e-04
KLLA0D14036g431981002e-04
CAGL0K08250g297206992e-04
Scas_673.17314112992e-04
Kwal_47.17321881145993e-04
ACR109W299116983e-04
YJR077C (MIR1)311112973e-04
KLLA0D09889g364111974e-04
CAGL0K02365g91961984e-04
KLLA0D07073g297131964e-04
Kwal_23.2913320144965e-04
Sklu_2075.3345140965e-04
CAGL0M05225g381153966e-04
Kwal_0.232274138956e-04
AER419W493121966e-04
Scas_640.25306112956e-04
KLLA0D04312g10389897e-04
CAGL0J04114g303110948e-04
ADL049W912155968e-04
KLLA0E13453g90661958e-04
YOR130C (ORT1)292277948e-04
CAGL0J05522g519149940.001
Scas_687.15*32867930.001
AFR253W34467930.001
AFR146W281286920.001
YOR100C (CRC1)327145920.001
ADL264C329140920.001
Kwal_26.8669296115920.001
ABL023W309289910.002
KLLA0E09680g307113910.002
Scas_702.10302138910.002
KLLA0A09383g366124910.002
Kwal_47.1922828189890.003
YDR470C (UGO1)502100900.003
KLLA0A00979g34367890.003
Kwal_23.3529395111900.003
Kwal_27.11419298200890.003
Scas_714.1830599890.003
YLR348C (DIC1)298139890.003
CAGL0K10362g301297890.003
YPL134C (ODC1)310122890.004
Kwal_56.23011303140890.004
YBR192W (RIM2)377150890.004
CAGL0L05742g305213880.005
KLLA0E02750g304195870.005
Sklu_2260.5302108870.005
Scas_667.22306279870.006
CAGL0B04543g317114860.008
CAGL0H03839g282139850.011
Sklu_2433.842067840.017
CAGL0C02013g32970830.018
CAGL0D01606g305277810.029
YDL119C30743790.052
YPR058W (YMC1)307110790.057
Scas_715.45305121780.072
YER053C300102780.083
Sklu_1275.1311143770.095
KLLA0D04950g27462760.13
Scas_613.2417760750.13
AAL014C271139760.13
KLLA0C13431g328215760.15
CAGL0G01166g295146750.18
AFR373W467112750.21
CAGL0K06545g512111750.23
Kwal_55.2133832387740.27
Sklu_2127.4323274730.30
YFR045W28562730.32
Sklu_1926.2305142720.44
Sklu_2436.1849497710.59
Sklu_2194.331241710.62
CAGL0H10538g297296700.68
Scas_705.932360700.76
KLLA0B08503g303286690.84
Sklu_2398.4309281681.3
Sklu_2442.8275139671.5
YPR128C (ANT1)32893652.9
Scas_696.931241653.3
YMR241W (YHM2)31472644.3
Kwal_34.1590731244635.7
Scas_660.1749754628.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR036W
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....   551   0.0  
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   270   1e-89
Kwal_23.3965                                                          246   3e-80
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...   224   1e-71
Scas_716.29                                                           209   1e-65
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...   207   4e-65
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    82   7e-18
Scas_667.4                                                             80   5e-17
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    76   1e-15
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    75   4e-15
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    74   5e-15
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    74   1e-14
Scas_718.24                                                            73   2e-14
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          72   2e-14
Scas_721.129                                                           72   3e-14
Kwal_27.12481                                                          71   6e-14
Kwal_14.2210                                                           71   6e-14
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    71   8e-14
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    70   3e-13
Scas_669.6                                                             69   6e-13
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    66   3e-12
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    64   4e-12
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    65   1e-11
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    64   2e-11
Kwal_55.20868                                                          64   2e-11
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    64   2e-11
Kwal_47.18216                                                          64   2e-11
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         63   3e-11
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    62   5e-11
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    61   1e-10
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    62   2e-10
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    61   2e-10
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         60   5e-10
Kwal_26.7653                                                           60   6e-10
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    59   7e-10
Kwal_23.4731                                                           59   8e-10
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    59   1e-09
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    58   1e-09
Scas_691.4                                                             56   7e-09
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    56   9e-09
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    56   1e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    56   1e-08
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    55   1e-08
Scas_709.9                                                             55   2e-08
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    54   3e-08
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         54   4e-08
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    54   5e-08
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    54   6e-08
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    53   9e-08
Scas_589.10                                                            53   1e-07
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    52   1e-07
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    52   1e-07
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    52   1e-07
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    52   2e-07
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    52   3e-07
Scas_717.20                                                            52   3e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    51   3e-07
Kwal_26.7972                                                           51   4e-07
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    51   4e-07
Kwal_26.7967                                                           51   4e-07
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    51   5e-07
Scas_632.9                                                             50   5e-07
Kwal_33.14050                                                          50   6e-07
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    50   6e-07
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    51   7e-07
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    50   8e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    50   9e-07
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    50   1e-06
Kwal_55.21335                                                          49   1e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            49   1e-06
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    49   2e-06
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         49   2e-06
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    49   2e-06
Scas_489.4                                                             49   2e-06
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    49   3e-06
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    48   3e-06
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       49   3e-06
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    48   4e-06
Scas_718.5                                                             48   5e-06
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         47   5e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    47   5e-06
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    48   5e-06
Scas_578.3*                                                            47   7e-06
Kwal_27.12081                                                          47   7e-06
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            47   9e-06
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    47   9e-06
Scas_558.2                                                             47   9e-06
Scas_721.27                                                            47   1e-05
Scas_379.2                                                             47   1e-05
Scas_582.7                                                             47   1e-05
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    46   1e-05
Scas_662.12                                                            46   1e-05
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    46   2e-05
Kwal_23.4354                                                           46   2e-05
Kwal_23.3042                                                           46   2e-05
Kwal_33.15597                                                          45   2e-05
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    46   3e-05
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             45   3e-05
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    45   3e-05
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    45   4e-05
Scas_697.47                                                            45   4e-05
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    45   4e-05
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    45   5e-05
Scas_602.8                                                             45   5e-05
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          45   5e-05
Scas_645.9                                                             45   6e-05
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    44   7e-05
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       44   7e-05
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    44   7e-05
Kwal_23.5757                                                           44   1e-04
Kwal_33.15446                                                          44   1e-04
Scas_328.1                                                             43   1e-04
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    43   2e-04
KLLA0D14036g complement(1203522..1204817) some similarities with...    43   2e-04
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    43   2e-04
Scas_673.17                                                            43   2e-04
Kwal_47.17321                                                          43   3e-04
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    42   3e-04
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    42   3e-04
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    42   4e-04
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    42   4e-04
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    42   4e-04
Kwal_23.2913                                                           42   5e-04
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                42   5e-04
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    42   6e-04
Kwal_0.232                                                             41   6e-04
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    42   6e-04
Scas_640.25                                                            41   6e-04
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    39   7e-04
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    41   8e-04
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    42   8e-04
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    41   8e-04
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    41   8e-04
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    41   0.001
Scas_687.15*                                                           40   0.001
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    40   0.001
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    40   0.001
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    40   0.001
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    40   0.001
Kwal_26.8669                                                           40   0.001
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    40   0.002
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    40   0.002
Scas_702.10                                                            40   0.002
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    40   0.002
Kwal_47.19228                                                          39   0.003
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    39   0.003
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    39   0.003
Kwal_23.3529                                                           39   0.003
Kwal_27.11419                                                          39   0.003
Scas_714.18                                                            39   0.003
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    39   0.003
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    39   0.003
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    39   0.004
Kwal_56.23011                                                          39   0.004
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    39   0.004
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    39   0.005
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    38   0.005
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         38   0.005
Scas_667.22                                                            38   0.006
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    38   0.008
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    37   0.011
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       37   0.017
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    37   0.018
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    36   0.029
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    35   0.052
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    35   0.057
Scas_715.45                                                            35   0.072
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    35   0.083
Sklu_1275.1 , Contig c1275 314-1249                                    34   0.095
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    34   0.13 
Scas_613.24                                                            33   0.13 
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    34   0.13 
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    34   0.15 
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    33   0.18 
AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH] complement(...    33   0.21 
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    33   0.23 
Kwal_55.21338                                                          33   0.27 
Sklu_2127.4 , Contig c2127 6322-7293                                   33   0.30 
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    33   0.32 
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          32   0.44 
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      32   0.59 
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            32   0.62 
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    32   0.68 
Scas_705.9                                                             32   0.76 
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    31   0.84 
Sklu_2398.4 , Contig c2398 9476-10405                                  31   1.3  
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          30   1.5  
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    30   2.9  
Scas_696.9                                                             30   3.3  
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    29   4.3  
Kwal_34.15907                                                          29   5.7  
Scas_660.17                                                            28   8.6  

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/311 (89%), Positives = 277/311 (89%)

Query: 1   MAASSGSPQLATEDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEH 60
           MAASSGSPQLATEDHLRKGEAVSGLH               TAPMDTVKIRRQLQLASEH
Sbjct: 1   MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH 60

Query: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH 120
           KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH
Sbjct: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH 120

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXX 180
           SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR     
Sbjct: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWA 180

Query: 181 XXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD 240
                         YETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD
Sbjct: 181 IAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD 240

Query: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
           AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY
Sbjct: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300

Query: 301 QRCLRLLEPTR 311
           QRCLRLLEPTR
Sbjct: 301 QRCLRLLEPTR 311

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  270 bits (690), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 186/303 (61%), Gaps = 8/303 (2%)

Query: 13  EDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYHGILHTFRTV 72
           +DHLRKGE VS  +               TAPMDTVKIR QLQ   E KY GI  T RT+
Sbjct: 7   KDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTI 66

Query: 73  AREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP---PQAHSLAVGALAG 129
            +EEG+RALWKGN+PA+AMYV+YG++QFG+Y+W N    SA  P    Q  +L VGALAG
Sbjct: 67  MKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNN-VWSAKFPRFSQQGQTLTVGALAG 125

Query: 130 LVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXX 189
           + SS+++YPLDLLRTRL+ANR++H  S+  + R +W  EG  GFF               
Sbjct: 126 MTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTA 185

Query: 190 XXXXXYETCTIAADTYGLPW----LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIP 245
                YET  I  + +   +    ++A++   AG VSK  VFP+DT+RRR+Q++++K   
Sbjct: 186 IMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTV 245

Query: 246 FFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
            FT+ P  Y   R      +   ++R EG+++LY+GLTM LCKS PTT I+L+VY+R + 
Sbjct: 246 HFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMD 305

Query: 306 LLE 308
           L +
Sbjct: 306 LFD 308

>Kwal_23.3965
          Length = 307

 Score =  246 bits (627), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 180/305 (59%), Gaps = 9/305 (2%)

Query: 13  EDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYHGILHTFRTV 72
           EDHLRKG+ V                   TAP+DT+KIR QLQLA+E +Y GIL TF+ +
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62

Query: 73  AREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVS 132
            R+EGVRALWKGNVPA AMY+LYGS QF +YA LN   + + LP Q H+  VGAL+G  S
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCS 122

Query: 133 SLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXX 192
           ++ +YP D+LRTR +AN S    ++   A+ IW  EG  GFF+                 
Sbjct: 123 AIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSIL 182

Query: 193 XXYETCTIAA------DTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHI-- 244
             YE+  I        D+  +  L ++AS  AG+VSK  VFP+DTVR+R Q++D + +  
Sbjct: 183 ATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242

Query: 245 PFFTRDP-GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
           P  T     AY +   T FL LA+ +V  EG+ +LY G T+ + KS P+TV++L VY+ C
Sbjct: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWC 302

Query: 304 LRLLE 308
           LR +E
Sbjct: 303 LRRME 307

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score =  224 bits (570), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 168/307 (54%), Gaps = 12/307 (3%)

Query: 13  EDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYHG--ILHTFR 70
           ED LRKG+ V+                  TAPMDT+KIR QL  A+  K  G  ++   R
Sbjct: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64

Query: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGL 130
           ++ + EG+R+ WKGN+P S +YV YGS QF +Y+  N      GL  + HSL VGA AG+
Sbjct: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGI 124

Query: 131 VSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXX 190
            SS+++YP D+LRTRLVAN   H  S+ R+ R IW  EG  GFF+               
Sbjct: 125 TSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASI 184

Query: 191 XXXXYETCTIAAD----------TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD 240
               YET  I  D           + L  L  +A    G+++K   FPL+T+RRR+Q ++
Sbjct: 185 MFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMN 244

Query: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
           +KH+  F+R    Y + +G  F  + + +++ EG++SLY+G+ +AL K+ PTT ++ W Y
Sbjct: 245 SKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGY 304

Query: 301 QRCLRLL 307
           +  +  L
Sbjct: 305 ETAIHYL 311

>Scas_716.29
          Length = 316

 Score =  209 bits (531), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 167/304 (54%), Gaps = 11/304 (3%)

Query: 14  DHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLA-SEHKYHGILHTFR-T 71
           DHLRKGE V                    AP+DT+KIR QL+ + +     G+L   +  
Sbjct: 12  DHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGM 71

Query: 72  VAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTA-AASAGLPPQAHSLAVGALAGL 130
           +  E G+R+ WKGNVP + MYVLYG  QF +Y++ N     ++ +  Q  SL VGALAG+
Sbjct: 72  ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGALAGM 131

Query: 131 VSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXX 190
            SS ++YP D+LRTR +AN+     SL    + IW+ EG  GFFR               
Sbjct: 132 TSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASI 191

Query: 191 XXXXYETCTIAADTYG-----LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIP 245
               YE+  I  D Y        +L  +AS  +G+ SK   +PLDT+RRR+Q+ ++ ++ 
Sbjct: 192 LFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQ 251

Query: 246 FFTRDP---GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
               +      Y + +G  F+ + ++++R EG+ SLY+G++M+LCK+ P+TV++LW Y+ 
Sbjct: 252 HNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311

Query: 303 CLRL 306
            +RL
Sbjct: 312 VMRL 315

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score =  207 bits (526), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 158/307 (51%), Gaps = 22/307 (7%)

Query: 10  LATEDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYHGILHTF 69
           +  +DHLRK E VS  +                AP+DTVKI+  LQ+   +K   +L   
Sbjct: 1   MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIK--LQVTPHNKNANVLIN- 57

Query: 70  RTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNT---AAASAGLPPQAHSLAVGA 126
             + + EG+R  WKGNVP S MY++YG  QFG+Y ++ +         + PQ +S  VG+
Sbjct: 58  --ILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGS 115

Query: 127 LAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXX 186
           LAG+ SSL +YP D+LRTR  AN       LR +   IW  EG  GFF            
Sbjct: 116 LAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGL 175

Query: 187 XXXXXXXXYETCTIAADTYG--------LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQI 238
                   YE+  I  +              L   A P +G  SK A FPLDTVRRR+QI
Sbjct: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235

Query: 239 VDA----KHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTV 294
            ++    +H   FT+D   Y + +  RFLG+ + MV+ EG  SLY+G+TM+L KS P+T 
Sbjct: 236 RNSPNEERHDREFTKD--IYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTA 293

Query: 295 ITLWVYQ 301
           I+LW Y+
Sbjct: 294 ISLWSYE 300

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 82.4 bits (202), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 126/289 (43%), Gaps = 58/289 (20%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           +P++ VK  I+ Q ++      +H+Y GI+  F+  AR+EG+ + W+GN   +A  + Y 
Sbjct: 30  SPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRGN---TANVIRYF 86

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +   A  G   +       A +LA G +AG +S +  Y LD  RTRL A+
Sbjct: 87  PTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAAD 146

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT--- 199
             +      RQ   + D       ++G AG +R                   Y++C    
Sbjct: 147 AKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL 206

Query: 200 ---------IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRD 250
                    IA  ++ L W+    + TA        +PLDTVRRR+ +   + + +    
Sbjct: 207 LTGSLEGSFIA--SFLLGWVVTTGASTAS-------YPLDTVRRRMMMTSGQAVKY---- 253

Query: 251 PGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP-TTVITLW 298
            GA   L+          +V AEG++SL+KG    + +      VI+L+
Sbjct: 254 KGAMDCLQ---------KIVAAEGVSSLFKGCGANILRGVAGAGVISLY 293

>Scas_667.4
          Length = 308

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 115/269 (42%), Gaps = 53/269 (19%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           +P++ VK  I+ Q ++      + KY GI+  F+  A+ EG+ A W+GN   +A  + Y 
Sbjct: 32  SPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAFWRGN---TANVIRYF 88

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +   A  G   +       A +LA G  AG +S L  Y LD  RTRL A+
Sbjct: 89  PTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAAD 148

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAA 202
             +      RQ + + D       T+G AG +R                   Y++   A 
Sbjct: 149 AKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV 208

Query: 203 DT----------YGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T          + L W+    + TA        +PLDTVRRR+ +   + + +     G
Sbjct: 209 LTGSLEGSFLASFLLGWIVTTGASTAS-------YPLDTVRRRMMMTSGQAVKY----DG 257

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           A+   R          +V AEG++SL+KG
Sbjct: 258 AFDCFR---------KVVAAEGVSSLFKG 277

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY G    FR V   EGV +L+KG        V  + +  +Y 
Sbjct: 237 PLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVISMYD 296

Query: 97  SLQ 99
            LQ
Sbjct: 297 QLQ 299

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 114/269 (42%), Gaps = 53/269 (19%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           +P++ VK  I+ Q ++      + KY GIL  F+  A +EGV + W+GN   +A  + Y 
Sbjct: 42  SPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGN---TANVIRYF 98

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +   A  G   +       A +LA G  AG +S L  Y LD  RTRL A+
Sbjct: 99  PTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAAD 158

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE------ 196
             +      RQ   + D       ++G AG +R                   Y+      
Sbjct: 159 SKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLL 218

Query: 197 -TCTIAAD---TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T ++      ++ L W+    + T         +PLDTVRRR+ +   + + +     G
Sbjct: 219 LTGSLEGSFLASFLLGWVVTTGASTCS-------YPLDTVRRRMMMTSGQAVKY----DG 267

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           A+  LR          +V AEG+ SL+KG
Sbjct: 268 AFDCLR---------KIVAAEGVGSLFKG 287

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 116/288 (40%), Gaps = 40/288 (13%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           +P + VKI  Q+Q ++     GI  + R V  EEG + L++GN         Y ++QF  
Sbjct: 41  SPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVV 100

Query: 103 YA-------WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
           Y         +N       L      L  GAL G  S + TYPLDL++TRL + ++A+  
Sbjct: 101 YEACKKKLFHVNGNNGQEQL-TNTQRLFSGALCGGCSVVATYPLDLIKTRL-SIQTANLS 158

Query: 156 SLRR-QARV------IWD--------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE---- 196
           SL R +A+       IW           G  G +R                   YE    
Sbjct: 159 SLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLRE 218

Query: 197 ---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGA 253
                + A  ++            +G V++   +P D +RRR Q++         R    
Sbjct: 219 FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSV 278

Query: 254 YSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           + AL         V + RAEG++  YKGL   L K  P+T ++  VY+
Sbjct: 279 WDAL---------VTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 69/159 (43%), Gaps = 27/159 (16%)

Query: 42  TAPMDTVKIRRQLQLA-----------SEHKYHGILHTFRTVAR-EEGVRALWKGNVPAS 89
           T P+D +K R  +Q A           S  K  GI        R E G+R L++G  P S
Sbjct: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTS 199

Query: 90  AMYVLYGSLQFGTYAWL-----NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRT 144
              V Y +L F  Y  L     N++ A        + L +GA++G V+  +TYP DLLR 
Sbjct: 200 LGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 145 RL-VANRSAHFFSLRRQARVIWD-------TEGPAGFFR 175
           R  V     +    R  +  +WD        EG +G+++
Sbjct: 260 RFQVLAMGGNELGFRYTS--VWDALVTIGRAEGVSGYYK 296

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 13/98 (13%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           +A  A   AG VS+  V P + V+  LQ+  +      + + G +S++R          +
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----SYNRGIFSSIR---------QV 70

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
              EG   L++G  +   +  P + +   VY+ C + L
Sbjct: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 121/290 (41%), Gaps = 59/290 (20%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           AP++ VK  I+ Q ++      + +Y+GI+  F+  A  EGV + W+GN   +A  + Y 
Sbjct: 28  APIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVISFWRGN---TANVIRYF 84

Query: 97  SLQFGTYAWLNTAAASAGLPPQ--------AHSLAVGALAGLVSSLLTYPLDLLRTRLVA 148
             Q   +A+ +   A  G   +        A +LA G  AG +S L  Y LD  RTRL A
Sbjct: 85  PTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAA 144

Query: 149 NRSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXY------ 195
           +  +      RQ   + D       ++G AG +R                   Y      
Sbjct: 145 DSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPL 204

Query: 196 ------ETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTR 249
                 E+  IA  ++ L W     + TA        +PLDTVRRR+ +   + + +   
Sbjct: 205 LLTGNLESSFIA--SFLLGWAVTTGASTAS-------YPLDTVRRRMMMTSGQAVKY--- 252

Query: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP-TTVITLW 298
             GA+ A R          +V AEG+ SL+KG    + +      VI+L+
Sbjct: 253 -DGAFDAFR---------KIVAAEGVKSLFKGCGANILRGVAGAGVISLY 292

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY G    FR +   EGV++L+KG        V  + +  LY 
Sbjct: 234 PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVISLYD 293

Query: 97  SLQ 99
            LQ
Sbjct: 294 QLQ 296

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 117/284 (41%), Gaps = 34/284 (11%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
            +P++ VKI  Q+Q ++     G++H  + V +EEGV+ L++GN         Y ++Q+ 
Sbjct: 34  VSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYA 93

Query: 102 TYAWLNTAAASAGLPPQAH-----SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
            Y +  T     G            L  GAL G  S L+TYPLDL+RTRL + ++A+   
Sbjct: 94  VYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRL-SIQTANLAK 152

Query: 157 LRRQA---------------RVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT-I 200
           L R                 R+  +  G  G++R                   YE    +
Sbjct: 153 LHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKAL 212

Query: 201 AADTYGLPWLAAAA---SPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSAL 257
               Y    +AAA       +G +++  V+P D +RRR Q++         R      AL
Sbjct: 213 IPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADAL 272

Query: 258 RGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
                      + R EG+   YKGLT  L K  P   +  +VY+
Sbjct: 273 W---------TIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 21/99 (21%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           ++A  A    G VS+  V P++ V+  LQ+  +                  T + G  VH
Sbjct: 17  FIAFVAGGVGGAVSRTVVSPVERVKILLQVQSST-----------------TAYNGGLVH 59

Query: 269 MVR----AEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
            V+     EG+  L++G  +   +  P + +   VY+ C
Sbjct: 60  AVKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFC 98

>Scas_718.24
          Length = 337

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 114/269 (42%), Gaps = 53/269 (19%)

Query: 43  APMDTVK--IRRQLQLASEH----KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           +P++ VK  I+ Q ++  +     KY GI+  FR  A++EG+ + W+GN   +A  + Y 
Sbjct: 61  SPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWRGN---TANVIRYF 117

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +      G   +       A +LA G  AG +S L  Y LD  RTRL A+
Sbjct: 118 PTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLLFVYSLDFARTRLAAD 177

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE------ 196
             +      RQ   + D       ++G AG +R                   Y+      
Sbjct: 178 SKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVL 237

Query: 197 -TCTIAAD---TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T ++      ++ L W+    + T         +PLDTVRR++ +   + + +     G
Sbjct: 238 LTGSLEGSFLASFLLGWVVTTGASTCS-------YPLDTVRRKMMMTSGQAVKY----KG 286

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           A+   +          +V AEG+ASL+KG
Sbjct: 287 AFDCFK---------KIVAAEGVASLFKG 306

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 116/296 (39%), Gaps = 45/296 (15%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
            +P + VKI  Q+Q ++     GI+   R V REEG   L++GN         Y ++QF 
Sbjct: 40  VSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99

Query: 102 TYA-----WLNTAAASAGLPPQA-HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
            Y      + +   +      Q    L  GAL G  S L TYPLDL+RTRL + ++A+  
Sbjct: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL-SIQTANLT 158

Query: 156 SLRR-------QARVIWD--------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE---- 196
            L +       +   +WD          G  G +R                   YE    
Sbjct: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218

Query: 197 -----TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDP 251
                T    A+ Y L     +    +G V++   +P D +RRR Q++         R  
Sbjct: 219 FMPEGTDNTLANFYKL-----SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK 273

Query: 252 GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
               AL         + + + EG    YKGLT  L K  P+T ++  VY+    L+
Sbjct: 274 SVMDAL---------ITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 41/96 (42%), Gaps = 13/96 (13%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           +A  A   AG VS+  V P + V+  LQ+ ++        + G   A+R          +
Sbjct: 24  VAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTT----AYNQGIVGAVR---------QV 70

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
            R EG   L++G  +   +  P + +   VY+ C +
Sbjct: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKK 106

>Scas_721.129
          Length = 323

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 114/289 (39%), Gaps = 38/289 (13%)

Query: 42  TAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P++ VKIR QLQ       +  Y   +     + R EG+R L KG V A    +    
Sbjct: 39  TNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNG 98

Query: 98  LQFGTYAWLNTAAASAGLP-PQAH-------SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
            + G Y  +  A  S   P  ++H       ++A GA +G++ +++  PL L++TR+ + 
Sbjct: 99  SRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSY 158

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAA 202
             A     +   R +W+       TEG  G FR                   Y T     
Sbjct: 159 SDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

Query: 203 DTYGL----PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALR 258
               L    P L   AS  +GL     + P D +  R+          + +    Y    
Sbjct: 219 LKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRI----------YNQKGNLYKGP- 267

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
               +   V  VR EGI++LYKG    + +  P T+I L   ++ ++L+
Sbjct: 268 ----VDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLV 312

>Kwal_27.12481
          Length = 304

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 118/287 (41%), Gaps = 54/287 (18%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           AP++ VK  I+ Q ++      + +Y GI   F+  A  EG+ + W+GN   +A  + Y 
Sbjct: 29  APIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASFWRGN---TANVIRYF 85

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +   A  G   +       A +LA G  AG +S +  Y LD  RTRL A+
Sbjct: 86  PTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGGLSLMFVYSLDYARTRLAAD 145

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE------ 196
                    RQ   + D       ++G AG +R                   Y+      
Sbjct: 146 SKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLL 205

Query: 197 -TCTIAAD---TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T ++      ++ L W     + TA        +PLDTVRRR+ +   + + +     G
Sbjct: 206 LTGSLEGSFLASFLLGWAVTTGASTAS-------YPLDTVRRRMMMTSGQAVKY----NG 254

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP-TTVITLW 298
           A+ A R          +V AEGI SL+KG    + +      VI+++
Sbjct: 255 AFDAFR---------KIVAAEGIKSLFKGCGANILRGVAGAGVISMY 292

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY+G    FR +   EG+++L+KG        V  + +  +Y 
Sbjct: 234 PLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYD 293

Query: 97  SLQ 99
            LQ
Sbjct: 294 QLQ 296

>Kwal_14.2210
          Length = 315

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 110/285 (38%), Gaps = 38/285 (13%)

Query: 42  TAPMDTVKIRRQLQLASEHKY-HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
            +P + VKI  Q+Q +S H Y HG+    + V  EEGV  L +GN         Y ++QF
Sbjct: 35  VSPFERVKILLQVQ-SSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCIRIFPYSAVQF 93

Query: 101 GTYA-----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
             Y      W      +  L    H L  GAL G  S L TYPLDL+RTRL + ++A+  
Sbjct: 94  LVYEFCKKQWFQQNPDTVVL--NWHRLVSGALCGGCSVLATYPLDLVRTRL-SIQTANLA 150

Query: 156 SLRRQARV-------IWD--------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYET--- 197
            L +           +W+          G  G +R                   YE    
Sbjct: 151 RLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLRE 210

Query: 198 -CTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSA 256
               + D         +    +G V++   +P D +RRR Q++                A
Sbjct: 211 YIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDA 270

Query: 257 LRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           L         + + R EG    YKGLT  L K  P+T ++  VY+
Sbjct: 271 L---------ITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 75/214 (35%), Gaps = 27/214 (12%)

Query: 103 YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS--LRRQ 160
           ++W     + AG+     +   G +AG VS  +  P + ++  L    S H ++  L R 
Sbjct: 7   HSWRCALKSDAGI-----AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRA 61

Query: 161 ARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA-----ADTYGLPWLAAAAS 215
            + ++  EG  G  R                   YE C         DT  L W    + 
Sbjct: 62  VKQVYLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSG 121

Query: 216 PTAGLVSKAAVFPLDTVRRRLQIVDAK-------HIPFFTRDPGAYSALRGTRFLGLAVH 268
              G  S  A +PLD VR RL I  A              + PG +  LR T        
Sbjct: 122 ALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKT-------- 173

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
             +  GI  LY+G+        P   +   VY++
Sbjct: 174 YTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQ 207

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 13/96 (13%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           +A  A   AG VS+  V P + V+  LQ+  + H      + G + A++          +
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTH----AYNHGLFRAVK---------QV 65

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
              EG+  L +G  +   +  P + +   VY+ C +
Sbjct: 66  YLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKK 101

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 120/287 (41%), Gaps = 54/287 (18%)

Query: 43  APMDTVKIRRQLQLAS------EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           +P++ VKI  Q Q         + KY GI+  F+  A++EG+ + W+GN   +A  + Y 
Sbjct: 31  SPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGN---TANVIRYF 87

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +      G   +       A +LA G  AG +S L  Y LD  RTRL A+
Sbjct: 88  PTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAAD 147

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYET----- 197
             +      RQ   + D       ++G AG +R                   +++     
Sbjct: 148 AKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLV 207

Query: 198 CTIAAD-----TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T + D     ++ L W+    + T         +PLDTVRRR+ +   + + +     G
Sbjct: 208 LTGSLDGSFLASFLLGWVVTTGASTCS-------YPLDTVRRRMMMTSGQAVKY----NG 256

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP-TTVITLW 298
           A   L+          +V +EG+ SL+KG    + +S     VI+++
Sbjct: 257 AIDCLK---------KIVASEGVGSLFKGCGANILRSVAGAGVISMY 294

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 121/323 (37%), Gaps = 46/323 (14%)

Query: 13  EDHLRKGEA--VSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQ----LASEHKYHGIL 66
           ED ++K  A  VS                  T P++ VKIR QLQ     A++  Y    
Sbjct: 5   EDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPF 64

Query: 67  HTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ----AHSL 122
                V R EG+R L KG V A    +     + G Y  +         P Q      S+
Sbjct: 65  QAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSV 124

Query: 123 AV----GALAGLVSSLLTYPLDLLRTRLVANRSA-------HFFSLRRQARVIWDTEGPA 171
            +    GA +G++ +++  PL L++TRL +  +A       H+  +    + I+ TEG  
Sbjct: 125 GINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVK 184

Query: 172 GFFRXXXXXXXXXXXXXXXXXXXYETCT-------IAADTYGLPWLAAAASPTAGLVSKA 224
           G FR                   Y T         I  D    P L   AS  +GL    
Sbjct: 185 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDG---PSLHLTASTISGLGVAV 241

Query: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTM 284
            + P D +  R+          + +    Y        +   V  V+ EGI +LYKG   
Sbjct: 242 VMNPWDVILTRI----------YNQKGDLYKGP-----IDCLVKTVKIEGITALYKGFEA 286

Query: 285 ALCKSTPTTVITLWVYQRCLRLL 307
            + +  P T++ L   ++ ++L+
Sbjct: 287 QVFRIGPHTILCLTFLEQTMKLV 309

>Scas_669.6
          Length = 373

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 124/338 (36%), Gaps = 40/338 (11%)

Query: 5   SGSPQLATEDHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYHG 64
           SG P       L      S LH                  +DTVK R+Q    +  KY  
Sbjct: 32  SGRPNDNEPSSLNGDNGSSLLHCVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTP-KYKN 90

Query: 65  ILHTFRTVAREEGV-RALWKGNVPASAMYVLYGSLQFGTYAWLN-TAAASAGLPPQAHSL 122
           +   +RT+  EEG+ R L+ G   A        ++ FGTY W         G       L
Sbjct: 91  MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHL 150

Query: 123 AVGALAGLVSSLLTYPLDLLRTRL-----VAN----RSAHFFSLRRQARVIWDTEGPAGF 173
           + G L   VSS +  P ++L+TRL     V N       ++ SLR   R+I +TEG    
Sbjct: 151 SAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKAL 210

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETC----------TIAADTYGLP---WLAAAASPTAGL 220
           F                    YE             I      +P   +  A A   AG+
Sbjct: 211 FFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGI 270

Query: 221 VSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSA----------LRGTRFLGLAVHMV 270
           ++     P+D ++ RLQ   A   P      GA SA          L  + F  L + + 
Sbjct: 271 ITT----PMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKL-VY 325

Query: 271 RAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
           ++EG+   + G+      ++  + I L +YQ  LRLL 
Sbjct: 326 QSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLLN 363

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 121/285 (42%), Gaps = 29/285 (10%)

Query: 44  PMDTVKIRRQL--QLAS-EH-KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           P+DT+K+R Q+  ++A  EH K  G + T RT+ ++EG  AL+KG        +   +++
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 100 FGTYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTY-PLDLLRTRLVA-------- 148
           F +Y +  T      +G+    ++   G  AG+  ++L   P+++++ RL A        
Sbjct: 90  FSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEP 149

Query: 149 NRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYG-- 206
           N    + +    A  I   EG +  +R                   Y         Y   
Sbjct: 150 NAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQM 209

Query: 207 --LP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFL 263
             LP W  +     +G +   +  PLDT++ RLQ    K I    +     S ++  + +
Sbjct: 210 DVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ--KDKSISLEKQ-----SGMK--KII 260

Query: 264 GLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
            +   +++ EG  +LYKG+T  + +  P   +T  VY+     LE
Sbjct: 261 TIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLE 305

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 17/98 (17%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQI----VDAKHIPFFTRDPGAYSALRGTRFL 263
           P +   A  TAGL       PLDT++ R+QI       +H+    + PG         F+
Sbjct: 10  PAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHV----KPPG---------FI 56

Query: 264 GLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
                + + EG  +LYKGL   +    P   I    Y+
Sbjct: 57  KTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYE 94

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 42  TAPMDTVKIRRQ----LQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG- 96
            AP+DT+K R Q    + L  +     I+     + +EEG RAL+KG  P   M V  G 
Sbjct: 232 NAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITP-RVMRVAPGQ 290

Query: 97  SLQFGTYAWLNTAAASAGL 115
           ++ F  Y ++     + G+
Sbjct: 291 AVTFTVYEYVREHLENLGI 309

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 64.3 bits (155), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
            +P + VKI  Q+Q ++    HGI++    V +EEGV  L++GN         Y ++QF 
Sbjct: 29  VSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFV 88

Query: 102 TYAWLNT----AAASAGLPP--QAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
            Y W          + G         L+ GAL G +S L TYPLDL+RTRL
Sbjct: 89  VYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRL 139

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 71/189 (37%), Gaps = 31/189 (16%)

Query: 115 LPPQAHSLAV--GALAGLVSSLLTYPLDLLRT--RLVANRSAHFFSLRRQARVIWDTEGP 170
           L  Q  S+A   G +AG VS  +  P + ++   ++ ++ SA+   +      ++  EG 
Sbjct: 6   LAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGV 65

Query: 171 AGFFRXXXXXXXXXXXXXXXXXXXYETC---------TIAADTYGLPWLAAAASPTAGLV 221
           AG FR                   YE C         T+  +   L W   +A    G +
Sbjct: 66  AGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSAGALCGGM 124

Query: 222 SKAAVFPLDTVRRRLQIVDAKHIPF-------FTRDPGAYSALRGTRFLGLAVHMVRAE- 273
           S  A +PLD VR RL I  A              + PG +          L V   + E 
Sbjct: 125 SVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWE---------LLVKTFKEEG 175

Query: 274 GIASLYKGL 282
           GI  LY+G+
Sbjct: 176 GIRGLYRGI 184

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 13/96 (13%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           +A  A   AG VS+  V P + V+  LQ+  +        + G  +A+           +
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTS----AYNHGIINAVG---------QV 59

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
            + EG+A L++G  +   +  P + +   VY+ C +
Sbjct: 60  YKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKK 95

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 113/292 (38%), Gaps = 44/292 (15%)

Query: 42  TAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P D VK R QLQ      +   Y   +  F  + + EG+  L KG   A    +    
Sbjct: 38  TNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNG 97

Query: 98  LQFGTYAWLNTAAASAGLPP-QAH-------SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
            + G Y  +     +   P  ++H       ++A GA +G+V + +  PL L++TR+ + 
Sbjct: 98  SRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSY 157

Query: 150 RSA-------HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT--- 199
            +A       H+ S       I+ +EG  G FR                   Y  C    
Sbjct: 158 SNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

Query: 200 ----IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYS 255
               +  D  GL  L+   S  AG     A+ P D V  R+          + +    YS
Sbjct: 218 LKHDLMNDGTGLHLLS---STIAGFGVGVAMNPWDVVLTRV----------YNQKGNLYS 264

Query: 256 ALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                  +   +  VR EG+++LYKG    + +  P TV+ L   ++ L+L+
Sbjct: 265 GP-----IDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLV 311

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 81/204 (39%), Gaps = 26/204 (12%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTR------LVANRSAHFFSLRRQARVIWDTEGPAGFF 174
           S   G LA  ++  +T P D ++TR      L AN +  + +  +   VI+  EG AG  
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 175 RXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP----------WLAAAASPTAGLVSKA 224
           +                   YE      +    P           +  AA  T+G+V   
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAF 142

Query: 225 AVFPLDTVRRRLQ-IVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLT 283
              PL  V+ R+Q   +A HI   T    A++        GLA  + R+EGI  L++G+ 
Sbjct: 143 IGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFN--------GLAT-IFRSEGIKGLFRGVD 193

Query: 284 MALCKSTPTTVITLWVYQRCLRLL 307
            A+ ++   + + L +Y  C   L
Sbjct: 194 AAMLRTGIGSAVQLPIYNICKNFL 217

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 112/287 (39%), Gaps = 36/287 (12%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
            +P + VKI  Q+Q ++     G+      V +EE ++ L++GN         Y ++QF 
Sbjct: 41  VSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFV 100

Query: 102 TYAWLNTA---AASAGLPPQAHS---LAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHF 154
            +           + G   Q ++   L  GAL G  S + TYPLDL+RTRL V   +   
Sbjct: 101 VFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSK 160

Query: 155 FSLRRQARV-----IW--------DTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT-- 199
            S  R + +     +W        +  G  G +R                   YE     
Sbjct: 161 LSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF 220

Query: 200 IAADTYGLPWL-----AAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAY 254
           + +D  G   +       +    +G V++   +P D +RRR Q++              +
Sbjct: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVW 280

Query: 255 SALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            AL         V + + EG    YKGLT  L K  P+T ++  VY+
Sbjct: 281 DAL---------VTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 74/185 (40%), Gaps = 23/185 (12%)

Query: 14  DHLRKGEAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQLASEHKYH---------- 63
           D   KGE ++                  T P+D V+ R  +Q A+  K            
Sbjct: 113 DTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP 172

Query: 64  -GILHTF-RTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWL-----NTAAASAGLP 116
            G+     +  A E G+  L++G  P S   V Y +L F  Y  L     +    ++ + 
Sbjct: 173 PGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMR 232

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA------NRSAHFFSLRRQARVIWDTEGP 170
              + L++GA++G V+  +TYP DLLR R             H+ S+      I  TEG 
Sbjct: 233 DSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGF 292

Query: 171 AGFFR 175
            G+++
Sbjct: 293 KGYYK 297

>Kwal_55.20868
          Length = 380

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 120/288 (41%), Gaps = 45/288 (15%)

Query: 43  APMDTVKIRRQLQ-LASE--HKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
            P+D  K R Q Q L S   + Y GIL T  T+ R+EG R L+KG VP    Y     + 
Sbjct: 94  CPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWMIY 153

Query: 100 FGTYAWLNTAAASAGLPPQ--------AHSLAVGALAGLVSSLLTYPLDLLRTRL----- 146
           F  Y        S  L P+        +HS A    AG VS++LT P+ +++TRL     
Sbjct: 154 FSVY------ERSKKLYPRIFPSFDFISHS-ASALTAGTVSTILTNPVWVVKTRLMLQTH 206

Query: 147 VANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYET------CTI 200
           V   S H+ S       ++ TEG   F+                    YE       CT 
Sbjct: 207 VNKNSTHYTSTFDAFHKMYTTEGLRTFY-AGLLPSLLGLFHVAIHFPIYEKLKVWLHCTP 265

Query: 201 AADTYGLPWLAAA----ASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSA 256
           +        L  A    AS  + +V+    +P + +R R+Q+   K  P    DP A  A
Sbjct: 266 SMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQL---KAYP---TDPLA--A 317

Query: 257 LRGTR---FLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           L+ T     + L  H  ++EG+   Y G T  L ++ P + ITL  ++
Sbjct: 318 LQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 10/97 (10%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           + A +   AG ++   V PLD  + RLQ     H      +P  Y   +G   LG    +
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQ-AQGLH-----SNPSNY--YKG--ILGTLTTI 126

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRL 306
           +R EG   LYKGL   +    PT +I   VY+R  +L
Sbjct: 127 IRDEGARGLYKGLVPIIMGYFPTWMIYFSVYERSKKL 163

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 26/156 (16%)

Query: 42  TAPMDTVKIRRQLQL---ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           T P+  VK R  LQ     +   Y      F  +   EG+R  + G +P S + + + ++
Sbjct: 191 TNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLP-SLLGLFHVAI 249

Query: 99  QFGTY----AWLNTAAASAGLPPQAHSLAVGAL------AGLVSSLLTYPLDLLRTR--- 145
            F  Y     WL+   + +    + H+L +  L      + +V+S LTYP ++LRTR   
Sbjct: 250 HFPIYEKLKVWLHCTPSMSRT--EDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQL 307

Query: 146 -------LVANRSAHFFSLRRQARVIWDTEGPAGFF 174
                  L A +      L R  +  + +EG  GF+
Sbjct: 308 KAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFY 343

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 121/289 (41%), Gaps = 37/289 (12%)

Query: 45  MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVR--------ALWKGNVPASAMYVLYG 96
           +DTVK R+Q     E KY  ++  +RT+A EEGVR        A   G+ P++A++    
Sbjct: 74  LDTVKTRQQ-GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVF---- 128

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHS-LAVGALAGLVSSLLTYPLDLLRTRLVAN---RSA 152
              FGTY W+     +     + +S LA G L  L SS++  P ++L+TRL       + 
Sbjct: 129 ---FGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNR 185

Query: 153 HFFS------LRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYG 206
           HF S      L    R I  TEG +  F                    YE     A    
Sbjct: 186 HFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLE 245

Query: 207 LPWLAAAASPTAGLVSKAA--------VFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALR 258
              +    S TA +V+ A+          PLD V+ R+Q          T D  A + L 
Sbjct: 246 RKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAG--TPDASAPARLN 303

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           G+ F  L V ++R EG+   + G+      ++  + I L +YQ  LR L
Sbjct: 304 GSIFRSLLV-VLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALRTL 351

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 44  PMDTVKIRRQLQ-------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           P + +K R QLQ         S + Y G+    RT+ R EGV AL+ G     +  + + 
Sbjct: 168 PSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFS 227

Query: 97  SLQFGTY------AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +LQF  Y      A+L       G       +  GA AG ++ ++T PLD+++TR+
Sbjct: 228 ALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRI 283

>Kwal_47.18216
          Length = 333

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 122/310 (39%), Gaps = 57/310 (18%)

Query: 44  PMDTVKIRRQL-QLASEH--KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           P+DT+K+R Q+   A E   +  G + T R ++ +EG  AL+KG        +   +++F
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 101 GTYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTY-PLDLLRTRLVANRSAHFFSL 157
            +Y +  T  A    G+    ++   G  AG+  +++   P+++++ RL A +   +  L
Sbjct: 90  TSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQA-QHVRYVPL 148

Query: 158 RRQ----------------------------------ARVIWDTEGPAGFFRXXXXXXXX 183
           + Q                                  A VI   EGP   +R        
Sbjct: 149 KAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAAR 208

Query: 184 XXXXXXXXXXXYETCTIAADTYG----LP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQI 238
                      Y T       Y     LP W  +     +G +   +  PLDT++ RLQ 
Sbjct: 209 QATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQK 268

Query: 239 VDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLW 298
             +      ++D G       +R L +   ++R EG  +LYKG+T  + +  P   +T  
Sbjct: 269 DKST-----SKDSGW------SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 299 VYQRCLRLLE 308
           VY+   + LE
Sbjct: 318 VYELIRKKLE 327

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
           P +   A  TAGL       PLDT++ R+QI          R+ G     R   F+G A 
Sbjct: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSR------AREQGQ----RARGFIGTAR 59

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            +   EG  +LYKGL   +    P   I    Y+
Sbjct: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 114/283 (40%), Gaps = 29/283 (10%)

Query: 44  PMDTVKIRRQLQLASE---HKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           P+DT+K+R Q+   S     K  G + T R +  EEG+ AL+KG        +   +++F
Sbjct: 30  PLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRF 89

Query: 101 GTYAWLNTAAAS--AGLPPQAHSLAVGALAGLVSSLLTY-PLDLLRTRLVANR------- 150
            +Y +  +A A    G     ++   G  AG   ++L   P+++++ RL A         
Sbjct: 90  SSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAA 149

Query: 151 SAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXY----ETCTIAADTYG 206
           S  + +  +   +I   EG    +R                   Y    E       T  
Sbjct: 150 SPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDA 209

Query: 207 LP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
           LP W  +     +G +   +  PLDT++ RLQ           +D    +    +R + +
Sbjct: 210 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ-----------KDKSTANMSGWSRIVTI 258

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
              +++ EG  +LYKG+T  + +  P   +T  VY+     LE
Sbjct: 259 GKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLE 301

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 24/203 (11%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLR-----RQARVIWDTEGPAGF 173
           A +L  G  AGL  +L  +PLD ++ R+   R +    ++     +  R I+  EG    
Sbjct: 11  AVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLAL 70

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETCTIA-AD------TYGLPWLAAAASPTAGLVSKAAV 226
           ++                   YE    A AD      + G  +LA   + T   V    V
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAV--LVV 128

Query: 227 FPLDTVRRRLQIVDAKHI-PFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285
            P++ V+ RLQ   A+H+ P     P   +AL+    +      V+ EGI +LY+G+++ 
Sbjct: 129 NPMEVVKIRLQ---AQHLHPETAASPRYRNALQACYLI------VKEEGIGALYRGVSLT 179

Query: 286 LCKSTPTTVITLWVYQRCLRLLE 308
             +          VY +    L+
Sbjct: 180 AARQATNQGANFTVYSKLKEFLQ 202

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 16/97 (16%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR---FLG 264
           P +   A  TAGL       PLDT++ R+QI        + R     SAL G +   F+ 
Sbjct: 10  PAVNLIAGGTAGLFEALCCHPLDTIKVRMQI--------YRR-----SALEGIKPPGFIK 56

Query: 265 LAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
              ++   EG+ +LYKGL   +    P   I    Y+
Sbjct: 57  TGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYE 93

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 42  TAPMDTVKIRRQLQ--LASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
            AP+DT+K R Q     A+   +  I+   + + +EEG RAL+KG  P
Sbjct: 230 NAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITP 277

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 114/285 (40%), Gaps = 49/285 (17%)

Query: 43  APMDTVKIRRQLQL------ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           AP++ VK+  Q Q       + + +Y GIL  F+  A  EG+ + W+GN      Y    
Sbjct: 32  APIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQ 91

Query: 97  SLQFG----TYAWLNTAAASAGLPPQ-AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           +L F       + L+      G     A +L  G  AG +S L  Y LD  RTRL A+  
Sbjct: 92  ALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADAR 151

Query: 152 AHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYET-----CT 199
               + +RQ   + D       T+G  G +R                   Y++      T
Sbjct: 152 GSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLT 211

Query: 200 IAAD-----TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAY 254
            A +     ++ L W+    + TA        +PLDTVRRR+ +   + I +     GA 
Sbjct: 212 GALEGSFVASFLLGWVITMGASTAS-------YPLDTVRRRMMMTSGQTIKY----DGAL 260

Query: 255 SALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTT-VITLW 298
             LR          +V+ EG  SL+KG    + +      VI+L+
Sbjct: 261 DCLR---------KIVQKEGAYSLFKGCGANIFRGVAAAGVISLY 296

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY G L   R + ++EG  +L+KG        V A+ +  LY 
Sbjct: 238 PLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYD 297

Query: 97  SLQ 99
            LQ
Sbjct: 298 QLQ 300

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 115/269 (42%), Gaps = 53/269 (19%)

Query: 43  APMDTVK--IRRQLQLAS----EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           AP++ VK  I+ Q ++      + +Y GI+  F+  A +EGV + W+GN   +A  + Y 
Sbjct: 29  APIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASFWRGN---TANVIRYF 85

Query: 97  SLQFGTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
             Q   +A+ +   A  G   +       A +LA G LAG +S L  Y LD  RTRL A+
Sbjct: 86  PTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGLAGGLSLLFVYSLDYARTRLAAD 145

Query: 150 RSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXXXYE------ 196
             +      RQ   + D       ++G AG +R                   Y+      
Sbjct: 146 SKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLL 205

Query: 197 -TCTIAAD---TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252
            T ++      ++ L W     + TA        +PLDTVRRR+ +   + + +     G
Sbjct: 206 LTGSLENSFLASFLLGWAVTTGASTAS-------YPLDTVRRRMMMTSGQAVKY----DG 254

Query: 253 AYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           A+ A R          +V AEGI SL+KG
Sbjct: 255 AFDAFR---------KIVAAEGIKSLFKG 274

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY G    FR +   EG+++L+KG        V  + +  +Y 
Sbjct: 234 PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYD 293

Query: 97  SLQ 99
            LQ
Sbjct: 294 QLQ 296

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 113/281 (40%), Gaps = 27/281 (9%)

Query: 44  PMDTVKIRRQL-QLASEH-KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+DT+K+R Q+ + A+E  K  G L T   +   EG+ A +KG        +   +++F 
Sbjct: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136

Query: 102 TYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTY-PLDLLRTRLVAN------RSA 152
           +Y +  T  A    G+    ++   G  AG+  ++L   P+++++ RL A          
Sbjct: 137 SYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQ 196

Query: 153 HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY----GLP 208
            + +  + A +I   EG    +R                   Y         Y     LP
Sbjct: 197 KYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLP 256

Query: 209 -WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
            W  +     +G +   +  PLDT++ RLQ           +D    +     R   +  
Sbjct: 257 SWETSLIGLVSGAIGPFSNAPLDTIKTRLQ-----------KDKSTRNLSNWVRITTIGR 305

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
            +V+ EG  +LYKG+T  + +  P   +T  VY+   R LE
Sbjct: 306 QLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 80/202 (39%), Gaps = 24/202 (11%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLV----ANRSAHFFSLRRQARVIWDTEGPAGFF 174
           A +L  G  AGL  +L  +PLD ++ R+     AN         R    I+  EG   F+
Sbjct: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFY 117

Query: 175 RXXXXXXXXXXXXXXXXXXXYETC-TIAAD------TYGLPWLAAAASPTAGLVSKA-AV 226
           +                   YE   T+ AD      + G  +LA      AG+      V
Sbjct: 118 KGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVG---AGVTEAVLVV 174

Query: 227 FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
            P++ V+ RLQ   A+H+       GA    +    +  A  +V+ EGI +LY+G+++  
Sbjct: 175 NPMEVVKIRLQ---AQHL------HGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTA 225

Query: 287 CKSTPTTVITLWVYQRCLRLLE 308
            +          VY + +  L+
Sbjct: 226 ARQATNQGANFTVYSKLMERLQ 247

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 11/94 (11%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
           P +   A  TAGL       PLDT++ R+QI   +     T+ PG         FL    
Sbjct: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIY--RRANEGTKPPG---------FLRTGA 105

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           ++   EG+ + YKGL   +    P   I    Y+
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE 139

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 42  TAPMDTVKIRRQLQLASEH--KYHGILHTFRTVAREEGVRALWKGNVP 87
            AP+DT+K R Q   ++ +   +  I    R + +EEG RAL+KG  P
Sbjct: 275 NAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITP 322

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 111/289 (38%), Gaps = 38/289 (13%)

Query: 42  TAPMDTVKIRRQLQ---LASEHK-YHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P++ +KIR QLQ    AS  K Y   +     + + EG++ L KG   A    +    
Sbjct: 40  TNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNG 99

Query: 98  LQFGTYAWLNTAAASAGLPPQ----AHSLAV----GALAGLVSSLLTYPLDLLRTRLVA- 148
            + G Y  + ++      P Q      S+ V    GA +G++ +++  PL L++TRL + 
Sbjct: 100 SRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSY 159

Query: 149 ------NRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAA 202
                     H+  +      I+ TEG  G FR                   Y T     
Sbjct: 160 SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219

Query: 203 DTYGL----PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALR 258
               L    P L   AS  +GL     + P D +  R+          + +    Y    
Sbjct: 220 VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI----------YNQKGDLYKGP- 268

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
               +   V  VR EG+ +LYKG    + +  P T++ L   ++ ++L+
Sbjct: 269 ----IDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 121/331 (36%), Gaps = 45/331 (13%)

Query: 4   SSGSPQLATEDHLRKG-EAVSGLHXXXXXXXXXXXXXXXTAPMDTVKIRRQLQ----LAS 58
           SS +  +AT++H +   + VS +                T P + VK R QLQ      +
Sbjct: 2   SSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATN 61

Query: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ 118
           +  Y         + + EGV+ L +G V A    +     + G Y  + T       P  
Sbjct: 62  QRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPES 121

Query: 119 --------AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA-------HFFSLRRQARV 163
                   A ++  GA +G++ +++  PL L++TR+ +  +A       H+ S+      
Sbjct: 122 DPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLAT 181

Query: 164 IWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT-------IAADTYGLPWLAAAASP 216
           I+  EG  G FR                   Y T         I  +   L  L   +S 
Sbjct: 182 IFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLL---SST 238

Query: 217 TAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIA 276
             GL     + P D V  R+          + +    Y       F       ++ EGI 
Sbjct: 239 VTGLGVGIVMNPWDVVLTRV----------YNQKGNTYKGPIDCMF-----KTIKIEGIG 283

Query: 277 SLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           +LYKG    L +  P T++ L   ++ ++L+
Sbjct: 284 ALYKGFGAQLFRIAPHTILCLTFMEQTMKLV 314

>Kwal_26.7653
          Length = 325

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 115/292 (39%), Gaps = 44/292 (15%)

Query: 42  TAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P++ VK R QLQ      ++  Y   +   + + + EG+R L KG   A    +    
Sbjct: 42  TNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNG 101

Query: 98  LQFGTY----AWLNTAAASAGLPPQAHSLAV----GALAGLVSSLLTYPLDLLRTRLVAN 149
            + G Y    + LN     A  P +  ++AV    GA +G++ +++  PL L++TR+ + 
Sbjct: 102 SRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSY 161

Query: 150 RSA-------HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT--- 199
            +A       H+ S+      I+  EG  G +R                   Y T     
Sbjct: 162 SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221

Query: 200 ----IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYS 255
               +  +  GL  +A+  S   G      + P D +  R+          + +    Y 
Sbjct: 222 LKHDLMKEGTGLHLVASTVS---GFGVGVVMNPWDVILTRV----------YNQKGNLYK 268

Query: 256 ALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                  L   V  VR EGI +LYKG    + +  P T++ L   ++ ++++
Sbjct: 269 GP-----LDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 80/204 (39%), Gaps = 26/204 (12%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRL-----VANRSAHFFSLRRQA-RVIWDTEGPAGFF 174
           S   G +A  ++  +T P++L++TR+     ++  +   +    QA +VI+  EG  G  
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 175 RXXXXXXXXXXXXXXXXXXXYE--------TCTIAADTYGLPWLAA--AASPTAGLVSKA 224
           +                   YE        T   A D + +  +A    +  T+G++   
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146

Query: 225 AVFPLDTVRRRLQ-IVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLT 283
              PL  ++ R+Q   +A  I   T     ++ L           + RAEG   LY+G+ 
Sbjct: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS---------SIYRAEGFKGLYRGVD 197

Query: 284 MALCKSTPTTVITLWVYQRCLRLL 307
            A+ ++   + + L +Y      L
Sbjct: 198 AAILRTGAGSSVQLPIYNTAKHFL 221

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 112/291 (38%), Gaps = 53/291 (18%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPA-------SAMYVLYG 96
           P+D +K R  LQ A       +L   RT       R LW+G +P+       SA+Y+   
Sbjct: 28  PLDLLKTR--LQQAQASSLRSVLREVRTT------RELWRGTLPSALRTSIGSALYLSLL 79

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHS---LAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
           +      A  + A   + L P+  S   L  GAL+     L+T P+ +++ R  +   A 
Sbjct: 80  NYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYA- 138

Query: 154 FFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT------IAADTYGL 207
           +  L    R IW +EG  GFF+                   YE         + A   G 
Sbjct: 139 YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGA 198

Query: 208 PWLAAAASPTAGLVSKAAVF-----------PLDTVRRRLQIVDAKHIPFFTRDPGAYSA 256
                  +P + +V+  + F           P DT++ R+Q+         +   G    
Sbjct: 199 DESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQ--------SHPVGFVQT 250

Query: 257 LRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           LR         H+V  E   +L+ GL++ LC+   +  I   +Y+  L+LL
Sbjct: 251 LR---------HIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLL 292

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84
           TAP DT+K R QLQ    H   G + T R +  EE  R L+ G
Sbjct: 228 TAPFDTIKTRMQLQ---SHPV-GFVQTLRHIVCEERARTLFDG 266

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 112 SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQAR 162
           + G+P  AH L  G   GL S     PLDLL+TRL   +++   S+ R+ R
Sbjct: 5   AGGVP--AH-LVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVR 52

>Kwal_23.4731
          Length = 314

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 119/297 (40%), Gaps = 54/297 (18%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVARE---------EGVRALWKGNVPASAMY 92
           T P+D VK+R QL + + H  HG     +T+ R+         E  R L    +  S  +
Sbjct: 31  THPLDLVKLRLQLLVNTTHS-HGYKEVIKTIIRDSKADSNVFREAYRGLGVNLIGNSIAW 89

Query: 93  VLYGSLQFGTYAWLNTAAASAGL-----PPQAH-----------SLAVGALAGLVSSLLT 136
            LY    FG Y +        G+     P Q+             LA  AL+GL +++LT
Sbjct: 90  GLY----FGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALSGLGTAILT 145

Query: 137 YPLDLLRTRLVANR---SAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXX 193
            P+ +++TR+++     S  + +     R ++  EG +GF+R                  
Sbjct: 146 NPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWR-GLVPSLFGVAQGAIYFT 204

Query: 194 XYETCT--------IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIP 245
            Y++          I  D         A +  + ++S  AV+P   ++  LQ   A    
Sbjct: 205 IYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQSFAAVE-- 262

Query: 246 FFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
              RD          RF  L   + + EG+  LYKGL+  L ++ P+T IT  +Y+ 
Sbjct: 263 --KRDS--------YRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYEN 309

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 218 AGLVSKAAVFPLDTVRRRLQ-IVDAKH-------IPFFTRDPGAYSALRGTRFLGLAVHM 269
           AG ++  A  PLD V+ RLQ +V+  H       I    RD  A S +    + GL V++
Sbjct: 23  AGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRGLGVNL 82

Query: 270 VRAEGIASLYKGL 282
           +       LY GL
Sbjct: 83  IGNSIAWGLYFGL 95

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 108 TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDL--LRTRLVANRSAHFFSLRRQAR-VI 164
           ++A ++   P    +  G  AG ++++ T+PLDL  LR +L+ N + H    +   + +I
Sbjct: 3   SSAMASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN-TTHSHGYKEVIKTII 61

Query: 165 WDTEGPAGFFR 175
            D++  +  FR
Sbjct: 62  RDSKADSNVFR 72

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 65/142 (45%), Gaps = 10/142 (7%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T PM  +K  R +   S   Y  IL+    +  EEG++  W+G VP S   V  G+L F 
Sbjct: 141 TNPMWVIK-TRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVP-SLFGVTQGALYFA 198

Query: 102 TYAWLNTAAASAGLPPQ------AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
            Y  L           Q        ++ + +L+ ++S    YPL LL+T L   R+ H  
Sbjct: 199 IYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQTFRTEHNE 258

Query: 156 SLRRQA--RVIWDTEGPAGFFR 175
           + +  +  R IW T G AGF++
Sbjct: 259 NSKMNSLIRSIWHTNGIAGFYK 280

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 117/293 (39%), Gaps = 54/293 (18%)

Query: 42  TAPMDTVKIRRQL---QLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAM 91
           T P+D +K+R QL    L     Y+ +    R +    G + L K        N+  +A 
Sbjct: 30  THPLDLIKLRLQLAAIDLKPSSYYNQVQ---RIIKDGSGTQQLLKEAYRGLGINIIGNA- 85

Query: 92  YVLYGSLQFGTY--------------AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTY 137
            V +G L FG Y              A  N       +    + ++ GA +GL ++LLT 
Sbjct: 86  -VAWG-LYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGA-SGLATALLTN 142

Query: 138 PLDLLRTRLVANRSAH-FFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYE 196
           P+ +++TR+++ +S+  + S+      I+  EG   F+R                   Y+
Sbjct: 143 PMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWR-GLVPSLFGVTQGALYFAIYD 201

Query: 197 TCTIAA--DTYGLPWLAAAASPTAG------LVSKAAVFPLDTVRRRLQIVDAKHIPFFT 248
           T  +    D   +      A  T G      ++S ++V+PL  ++  LQ    +H     
Sbjct: 202 TLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQTFRTEH----N 257

Query: 249 RDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            +    S +R          +    GIA  YKGL   L ++ P+T IT  VY+
Sbjct: 258 ENSKMNSLIRS---------IWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 109 AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           A +++ L P    +  G  AG +++++T+PLDL++ RL
Sbjct: 3   ATSNSVLSPLQKEIISGLTAGTITTIVTHPLDLIKLRL 40

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 109/286 (38%), Gaps = 50/286 (17%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP--ASAMY-------VL 94
           P DTVK+R Q Q A  H Y       R+   +EG+   WKG     AS ++       VL
Sbjct: 27  PFDTVKVRLQTQPA--HLYPTTWSCIRSTYTDEGI---WKGFYQGIASPLFGAALENAVL 81

Query: 95  YGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHF 154
           + S    T    N       L P   ++  GA AG  +S +  P++L++ +L  +  ++ 
Sbjct: 82  FVSFNQCT----NFLDEFTQLKPLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNS 137

Query: 155 FSLRRQARVIWDT-------EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA------ 201
            S   +   +W T       +G  G ++                   YE   +       
Sbjct: 138 LSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHP 197

Query: 202 ADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR 261
           A+     W    +  +AG++  A+VFP DTV+   Q          T      +AL+   
Sbjct: 198 AEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQ----------TEHVSIVNALK--- 244

Query: 262 FLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                  ++R  GI   Y+GL + L ++ P      + Y+   ++ 
Sbjct: 245 ------KVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

>Scas_691.4
          Length = 334

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 109/298 (36%), Gaps = 47/298 (15%)

Query: 44  PMDTVKIRRQLQLASE-HKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P+DT+K+R Q+   +E  + HG + T R +   EG  AL+KG        +   +++F +
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 103 YAWLNTAAASAGLP--PQAHSLAVGALAGLVSSLLTY-PLDLLRTRLVANRSAHFFSLRR 159
           Y +   A            ++   G  AG+  ++L   P+++++ RL A    H   L  
Sbjct: 93  YEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQ---HLNDLIP 149

Query: 160 Q------------------------ARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXY 195
           Q                        A  I   EG    +R                   Y
Sbjct: 150 QPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVY 209

Query: 196 ETCTIAADTY----GLP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRD 250
                    Y     LP W  +     +G +   +  PLDT++ RLQ           +D
Sbjct: 210 SYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ-----------KD 258

Query: 251 PGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
               S     +   +   +++ EG  +LYKG+T  + +  P   +T  VY+   + LE
Sbjct: 259 KSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLE 316

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 39/99 (39%), Gaps = 12/99 (12%)

Query: 203 DTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRF 262
           D    P +   A  TAGL       PLDT++ R+QI          R  G    +R   F
Sbjct: 8   DKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAK--------RTEG----MRPHGF 55

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           +    ++   EG  +LYKGL   +    P   I    Y+
Sbjct: 56  ITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYE 94

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 77/205 (37%), Gaps = 36/205 (17%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRL-VANRSA----HFFSLRRQARVIWDTEGPAGFFR 175
           +L  G  AGL  +L  +PLD ++ R+ +A R+     H F      R I+  EG    ++
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFIT--TGRNIYSHEGFLALYK 73

Query: 176 XXXXXXXXXXXXXXXXXXXY----------ETCTIAADTYGLPWLAAAASPTAGLVSKA- 224
                              Y          ET TI   T G  +LA      AG+     
Sbjct: 74  GLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTI---TTGNTFLAGVG---AGITEAVL 127

Query: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSAL---------RGTRFLGLAVHMVRAEGI 275
            V P++ V+ RLQ   A+H+      P   SA          +    +  A  +V+ EG 
Sbjct: 128 VVNPMEVVKIRLQ---AQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGA 184

Query: 276 ASLYKGLTMALCKSTPTTVITLWVY 300
            +LY+G+++   +          VY
Sbjct: 185 GALYRGVSLTAARQATNQGANFTVY 209

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 42  TAPMDTVKIRRQLQ--LASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
            AP+DT+K R Q    ++S   +  I      + +EEG RAL+KG  P
Sbjct: 245 NAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITP 292

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 110/281 (39%), Gaps = 38/281 (13%)

Query: 42  TAPMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
             P+D  K R Q Q A   E  Y GI+ T   + R+EGV  L+KG  P    Y     L 
Sbjct: 102 VCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLY 161

Query: 100 FGTYAWLNTAAASAGLPPQAHSLAVGAL-AGLVSSLLTYPLDLLRTRL-----VANRSAH 153
           F  Y        S  LP    S A  AL AG +S+ LT P+ +++TRL     V+  S +
Sbjct: 162 FSVYEKCKQRYPSY-LPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTN 220

Query: 154 FFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTI-------AADTYG 206
           + S     R ++ +EG   F+                    YE   I       AAD   
Sbjct: 221 YRSTLDAFRKMYRSEGLKVFY-SGLVPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQR 279

Query: 207 LPWLA------AAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGT 260
           L            AS  + +V+    +P + +R R+Q+          R  G   +L   
Sbjct: 280 LDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQV----------RHSGVPPSL--- 326

Query: 261 RFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
             L L   +  +EG    Y G    L ++ P +VITL  ++
Sbjct: 327 --LNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 73/170 (42%), Gaps = 20/170 (11%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAGFFRXXXXX 180
           GALAG VS ++  PLD+ +TRL A  +     ++  +      I   EG AG ++     
Sbjct: 91  GALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPI 150

Query: 181 XXXXXXXXXXXXXXYETCTIAADTYGLP--WLAAAASP-TAGLVSKAAVFPLDTVRRRLQ 237
                         YE C     +Y LP  +++ AAS  TAG +S A   P+  V+ RL 
Sbjct: 151 VLGYFPTWMLYFSVYEKCKQRYPSY-LPGGFVSHAASALTAGAISTALTNPIWVVKTRLM 209

Query: 238 IVDAKHIPFFTRDPGAY-SALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
           I         +RD   Y S L   R       M R+EG+   Y GL  +L
Sbjct: 210 IQSD-----VSRDSTNYRSTLDAFR------KMYRSEGLKVFYSGLVPSL 248

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 13/95 (13%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR-FLGLAVH 268
           + A +   AG VS   V PLD  + RLQ              GA S  R  R  +G    
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQA------------QGAGSGERYYRGIVGTLSA 133

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
           ++R EG+A LYKGL   +    PT ++   VY++C
Sbjct: 134 ILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKC 168

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 115/289 (39%), Gaps = 41/289 (14%)

Query: 43  APMDTVKIRRQ---LQLASEHKYH-GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
            P+D  K R Q   LQ   E+ Y+ GI+ T  T+ R+EG R L+KG VP    Y     +
Sbjct: 96  CPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMI 155

Query: 99  QFGTYAWLNTAAASAGLPPQAHSLA---VGALAGLVSSLLTYPLDLLRTRLVANRS---- 151
            F  Y +  +     G+ PQ   +A       AG  S+ LT P+ +++TRL+   +    
Sbjct: 156 YFSVYEF--SKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEH 213

Query: 152 -AHFFSLRRQARVIWDTEG---------PA--GFFRXXXXXXXXXXXXXXXXXXXYETCT 199
             H+       R ++  EG         P+  G F                     E  T
Sbjct: 214 PTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNT 273

Query: 200 IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
              ++  L  L  A+S  + +++ A  +P + +R R+Q+     IP         S  R 
Sbjct: 274 ---NSINLQRLIMASS-VSKMIASAVTYPHEILRTRMQL--KSDIP--------DSIQR- 318

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
            R   L       EG+   Y G T  L ++ P + ITL  ++     LE
Sbjct: 319 -RLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLE 366

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 10/114 (8%)

Query: 42  TAPMDTVKIRRQLQLA-SEH--KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           T P+  VK R  LQ    EH   Y G    FR +  +EG +AL+ G VP S + + + ++
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVP-SLLGLFHVAI 252

Query: 99  QFGTYAWLNTAAASAGLPPQAHSLAV------GALAGLVSSLLTYPLDLLRTRL 146
            F  Y  L             +S+ +       +++ +++S +TYP ++LRTR+
Sbjct: 253 HFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRM 306

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           + A +   AG +S  AV PLD  + RLQ    +     TR    Y   RG   +G    +
Sbjct: 79  ITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQ-----TRFENPY--YRG--IMGTLSTI 129

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           VR EG   LYKGL   +    PT +I   VY+
Sbjct: 130 VRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYE 161

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVAN------RSAHFFSLRRQARVIWDTEGPAGFFR 175
           GA AG +S +   PLD+ +TRL A        + ++  +      I   EGP G ++
Sbjct: 84  GAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYK 140

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 118/312 (37%), Gaps = 60/312 (19%)

Query: 42  TAPMDTVKIRRQLQL-----------ASEHKYHGILHTFRTVA------REEGVRALWKG 84
           T P D VK R Q  +            +   Y G++H   TV        +EG R+L+KG
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 85  NVPASAMYVLYGSLQFGTYAWLNTAAA----SAGLPPQAHSLAVGALAGLVSSLLTYPLD 140
             P     +   S+ F TY      A+         P  H LA GA AG  +S  T P+ 
Sbjct: 127 LGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLA-GATAGWATSTATNPIW 185

Query: 141 LLRTRLVANRSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXX 193
           L++TRL  +++A   S  R+ +  WD        EG  G ++                  
Sbjct: 186 LVKTRLQLDKAADGRS--RRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVL 243

Query: 194 XYETCTI----AADTYG-------------LPWLAAAASP-TAGLVSKAAVFPLDTVRRR 235
             +   I    + + +G               W   + S   A L +    +P + VR R
Sbjct: 244 YEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTR 303

Query: 236 LQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVI 295
           L+           + P     L+ T        +++ EG AS+Y GLT  L ++ P ++I
Sbjct: 304 LR-----------QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSII 352

Query: 296 TLWVYQRCLRLL 307
               ++  ++LL
Sbjct: 353 MFGTWELVIKLL 364

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFT----RDPGAYSALRGTR-F 262
           PW+   A    G+       P D V+ RLQ  D  H  + T    R    Y  L   R  
Sbjct: 49  PWVHFVAGGIGGMAGAIITCPFDVVKTRLQ-SDVFHGAYKTQATARTNVVYQGLMHFRET 107

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
           +G+  ++   EG  SL+KGL   L    P   I  + Y
Sbjct: 108 VGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTY 145

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 113/289 (39%), Gaps = 39/289 (13%)

Query: 43  APMDTVKIRRQLQ----LASEHKYH-GILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
            P+D  K R Q Q      +E+ Y+ G + T  T+ R+EGVR L+KG VP    Y     
Sbjct: 87  CPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWM 146

Query: 98  LQFGTYAWL--NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-----VANR 150
           + F  Y +   N    S+     +HS +    AG VS+++T P+ +++TRL     + + 
Sbjct: 147 IYFSVYEFCKDNLRTNSSNWSFVSHSFS-AITAGAVSTVVTNPIWVVKTRLMLQTHIGSN 205

Query: 151 SAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY----- 205
           + H+       + I + EG    +                    YE   ++   Y     
Sbjct: 206 TTHYQGTYDAFKKIINQEGVKALY-AGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDES 264

Query: 206 ------GLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
                  L  L  A+S  + +V+    +P + +R RLQ+     +P   R          
Sbjct: 265 SNESKINLKRLILASS-VSKMVASVLSYPHEILRTRLQL--KSDLPSHQR---------- 311

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
            R + L       EGI   Y G    L ++ P + ITL  ++     L 
Sbjct: 312 -RLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLN 359

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 72/146 (49%), Gaps = 14/146 (9%)

Query: 42  TAPMDTVKIRRQLQL---ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           T P+  VK R  LQ    ++   Y G    F+ +  +EGV+AL+ G VP S + +L+ ++
Sbjct: 186 TNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVP-SLLGLLHVAI 244

Query: 99  QFGTYAWLNTAAASAGLPPQAHSLAVG--------ALAGLVSSLLTYPLDLLRTR--LVA 148
            F  Y  L  +         ++   +         +++ +V+S+L+YP ++LRTR  L +
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS 304

Query: 149 NRSAHFFSLRRQARVIWDTEGPAGFF 174
           +  +H   L    ++ +  EG  GF+
Sbjct: 305 DLPSHQRRLIPLIKITYIQEGIFGFY 330

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
           + A +   AGL+S   V PLD  + RLQ   A+ +   T +   Y   RG+  +G    +
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQ---AQGLQTRTTENLYY---RGS--IGTMTTI 121

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
           VR EG+  LYKGL   +    PT +I   VY+ C
Sbjct: 122 VRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFC 155

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 69/174 (39%), Gaps = 24/174 (13%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVAN----RSAHFF----SLRRQARVIWDTEGPAGFFRX 176
           GALAGL+S ++  PLD+ +TRL A     R+        S+     ++ D EG  G ++ 
Sbjct: 75  GALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRD-EGVRGLYKG 133

Query: 177 XXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS---PTAGLVSKAAVFPLDTVR 233
                             YE C     T    W   + S    TAG VS     P+  V+
Sbjct: 134 LVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVK 193

Query: 234 RRLQIVDAKHI-PFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
            RL +    HI    T   G Y A +          ++  EG+ +LY GL  +L
Sbjct: 194 TRLML--QTHIGSNTTHYQGTYDAFK---------KIINQEGVKALYAGLVPSL 236

>Scas_709.9
          Length = 365

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 42  TAPMDTVKIRRQLQL---ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           T P+  VK R  LQ     S   Y G +  F+ +  +EGVR L+ G VP S   +L+ ++
Sbjct: 180 TNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVP-SMFGLLHVAI 238

Query: 99  QFGTYAWLNT----AAASAGLPPQAHSLAVGAL------AGLVSSLLTYPLDLLRTRLVA 148
            F  Y  L         + G   Q HSL +  L      + +++S+LTYP ++LRTR+  
Sbjct: 239 HFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQL 298

Query: 149 NRSAHFFSLRRQARVIWDT---EGPAGFF 174
                  S  +   +I  T   EG  GF+
Sbjct: 299 KSDKLLISKHKLLDLIKRTYRYEGLLGFY 327

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 104/282 (36%), Gaps = 38/282 (13%)

Query: 43  APMDTVKIRRQ---LQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
            P+D  K R Q   +Q      Y G+L T  T+  +EGVR L+KG +P    Y     + 
Sbjct: 83  CPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIY 142

Query: 100 FGTYAWLNTAAASAGLPPQ---AHSLAVGALAGLVSSLLTYPLDLLRTRLV-----ANRS 151
           F  Y +         LP     +HS +    AG  S++LT P+ +++TRL+         
Sbjct: 143 FSVYEFAKDLYPRV-LPNSDFISHSCS-AITAGAASTVLTNPIWVVKTRLMLQTPLGESR 200

Query: 152 AHFFSLRRQARVIWDTEG--------PAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAAD 203
            H+       + I   EG            F                     +T T   +
Sbjct: 201 THYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHN 260

Query: 204 ----TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
               +  L  L  A+S +  L S    +P + +R R+Q+   K +            +  
Sbjct: 261 SQEHSLHLTRLIIASSASKMLAS-ILTYPHEILRTRMQLKSDKLL------------ISK 307

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            + L L     R EG+   Y G    L ++ P + ITL  ++
Sbjct: 308 HKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 14/96 (14%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHI--PFFTRDPGAYSALRGTRFLGL 265
           P + A +   AG +S   V PLD  + RLQ    + I  P++          RG   LG 
Sbjct: 64  PKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYY----------RGV--LGT 111

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
              +V  EG+  LYKGL   +    PT +I   VY+
Sbjct: 112 MSTIVVDEGVRGLYKGLIPIILGYFPTWMIYFSVYE 147

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVAN 149
           GALAG +S ++  PLD+ +TRL A 
Sbjct: 71  GALAGFLSGIIVCPLDVTKTRLQAQ 95

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q     +Y   +  FR V REEGVRALW+G  P     VL G + F 
Sbjct: 229 TMPVDTVKTR--MQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFT 286

Query: 102 TYAWL 106
            Y  L
Sbjct: 287 AYEKL 291

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           +G+V+  A  P+DTV+ R+Q +DA     +    G + A+            VR EG+ +
Sbjct: 221 SGIVTVYATMPVDTVKTRMQALDAAR---YGSTVGCFRAV------------VREEGVRA 265

Query: 278 LYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           L++G T  L +   +  I    Y++ L LL
Sbjct: 266 LWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 97  SLQFGTYAWLNTAAAS-AGLPPQ-----AHSLAVGALAGLVSSLLTYPLDLLRTRLVANR 150
           +++FG Y  L  A    AG P         +  VGAL+G+V+   T P+D ++TR+ A  
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALD 243

Query: 151 SAHFFSLRRQARVIWDTEG 169
           +A + S     R +   EG
Sbjct: 244 AARYGSTVGCFRAVVREEG 262

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 119/300 (39%), Gaps = 59/300 (19%)

Query: 42  TAPMDTVKIRRQLQLASEHK---YHGIL---------HT-FRTVAREEGVRALWKGNVPA 88
           T P+D VK+R QL LA+  K   Y+ ++         H+ FR   R  GV  L  GN  A
Sbjct: 26  THPLDLVKVRLQL-LATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGLGVNLL--GNSVA 82

Query: 89  SAMYV-LYGSLQFGTYAWLNTAAASAGLPPQAHS-------LAVGALAGLVSSLLTYPLD 140
             +Y  LY + +   + W NT                    L   A++G+ +S+LT P+ 
Sbjct: 83  WGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIW 142

Query: 141 LLRTRLVANRSAHFFSLRRQA---RVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYET 197
           +++TR+++       S R      + ++  EG AGF+R                   Y T
Sbjct: 143 VIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWR-----GLVPSLFGVSQGAIYFT 197

Query: 198 CTIAADTYGLPWLAA---------------AASPTAGLVSKAAVFPLDTVRRRLQIVDAK 242
                DT    + AA                 +  + +VS  AV+PL  ++  LQ  +  
Sbjct: 198 ---VYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVS 254

Query: 243 HIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
            +     +P         R   L   +   +G+  LYKGL   L ++ P+T IT  VY+ 
Sbjct: 255 TVI----NPKT-----SHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYEN 305

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 18/95 (18%)

Query: 217 TAGLVSKAAVFPLDTVRRRLQIVDAKHIPF--------FTRDPGAYSALRGTRFLGLAVH 268
           TAG ++  +  PLD V+ RLQ++     P           +D   +S  R T + GL V+
Sbjct: 17  TAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRET-YRGLGVN 75

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
           ++       LY GL  A            WV+Q C
Sbjct: 76  LLGNSVAWGLYFGLYRASKD---------WVFQWC 101

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 76/208 (36%), Gaps = 24/208 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVLYG 96
           P+D +K R Q   A       +L     ++  EG  ALWKG         PA A+Y    
Sbjct: 53  PIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVY---- 108

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHSLAV---GALAGLVSSLLTYPLDLLRTRLVANRSAH 153
              FGTY +       +      H       GA A   S  L  P D ++ R+  N SA 
Sbjct: 109 ---FGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSAS 165

Query: 154 FFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGLPWL 210
            +   +Q   I+ +EG A F+                    YE+ T     ++ Y  P +
Sbjct: 166 VWQTTKQ---IYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYN-PLI 221

Query: 211 AAAASPTAGLVSKAAVFPLDTVRRRLQI 238
                  +G    A   PLD ++  LQI
Sbjct: 222 HCLCGSISGSTCAAITTPLDCIKTVLQI 249

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 80/202 (39%), Gaps = 25/202 (12%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VAN-RSAHFFSLRRQARVIWDTEGPAGFF 174
           P  H L  GA AG++   + +P+D L+TR+  AN +S    ++  Q   I  +EG    +
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALW 91

Query: 175 RXXXXXXXXXXXXXXXXXXXYETC----TIAADTYG-LPWLAAAASPTAGLVSKAAVFPL 229
           +                   YE C      ++DT    P+  A +   A   S A + P 
Sbjct: 92  KGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPF 151

Query: 230 DTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKS 289
           DT+++R+Q+  +  +   T+                   + ++EG+A+ Y      L  +
Sbjct: 152 DTIKQRIQLNTSASVWQTTK------------------QIYQSEGLAAFYYSYPTTLVMN 193

Query: 290 TPTTVITLWVYQRCLRLLEPTR 311
            P       +Y+   + L P+ 
Sbjct: 194 IPFAAFNFVIYESSTKFLNPSN 215

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 117/321 (36%), Gaps = 77/321 (23%)

Query: 42  TAPMDTVKIRRQLQLASEHKY----HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
            AP+D +KI  Q       ++     G++   + +   +G R  ++G+         Y +
Sbjct: 37  VAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAA 96

Query: 98  LQFGTYAWLNTAAASAGLPPQAHS-----LAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           ++F  Y  + +      +P   H      L  G+LAGL S  +TYPLDL+R RL      
Sbjct: 97  IKFIAYEQIRSVV----IPTWRHESHWRRLLSGSLAGLCSVFVTYPLDLVRVRLAYVTER 152

Query: 153 HFFSLRRQARVIWDTEGP----------------AGFFRXXXXXXXXXXXXXXXXXXXYE 196
           H   +R+    I++ E P                + F+R                   ++
Sbjct: 153 HDAKVRKIMACIYN-ERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHD 211

Query: 197 TCTIAADTYGLP------------------------WLAAAASPTAGLVSKAAVFPLDTV 232
            C    D +  P                        W    A   AG+ S+ A +P + +
Sbjct: 212 LCQ---DIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEII 268

Query: 233 RRRLQIVDAKHIPFFTRDPGAYSALRGTR--FLGLA--VHMVRAE-GIASLYKGLTMALC 287
           RRRLQ+           DP        TR  F+G+     ++  E G    + GL++   
Sbjct: 269 RRRLQVSAIT-------DP--------TRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYI 313

Query: 288 KSTPTTVITLWVYQRCLRLLE 308
           K TP    + ++Y+R    L+
Sbjct: 314 KVTPMVACSFFIYERTKWYLQ 334

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 47/128 (36%), Gaps = 9/128 (7%)

Query: 125 GALAGLVSSLLTYPLDLLRTRL------VANRSAHFFSLRRQARVIWDTEGPAGFFRXXX 178
           G +AG  +  L  PLD ++          A  +     L R ++ I   +GP GFF+   
Sbjct: 26  GGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHS 85

Query: 179 XXXXXXXXXXXXXXXXYE---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRR 235
                           YE   +  I    +   W    +   AGL S    +PLD VR R
Sbjct: 86  ATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLSGSLAGLCSVFVTYPLDLVRVR 145

Query: 236 LQIVDAKH 243
           L  V  +H
Sbjct: 146 LAYVTERH 153

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAR----EEGVRALWKGNVPASAMYVLYGSL 98
           AP+D +KI  Q       KY G L      A+     +GVR  ++G+         Y ++
Sbjct: 52  APLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAV 111

Query: 99  QFGTYAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +F  Y  + NT   S         L  G+LAGL S  +TYPLDL+R RL
Sbjct: 112 KFVAYEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRL 160

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W    +   AG+ S+ A +P + +RRRLQ+        +     + S +          H
Sbjct: 265 WAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEI---------AH 315

Query: 269 MVRAE-GIASLYKGLTMALCKSTPTTVITLWVYQR 302
           ++  E G+   + GL++   K TP    + +VY+R
Sbjct: 316 IIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYER 350

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 45/122 (36%), Gaps = 11/122 (9%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHF-------FSLRRQARVIWDTEGPAGFFRXX 177
           G ++G  +  L  PLD ++  L    + H+         L   A+ IW  +G  GFF+  
Sbjct: 40  GGISGSCAKTLIAPLDRIKI-LFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGH 98

Query: 178 XXXXXXXXXXXXXXXXXYE---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRR 234
                            YE      I +  +   W    +   AGL S    +PLD VR 
Sbjct: 99  SATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRV 158

Query: 235 RL 236
           RL
Sbjct: 159 RL 160

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 61/180 (33%), Gaps = 49/180 (27%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRAL----------------WKGN 85
           T P+D V++R  L   +EHK   +    + + +E     L                ++G 
Sbjct: 150 TYPLDLVRVR--LAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGY 207

Query: 86  VPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQA------------------------HS 121
           VP     + Y  + F  +  L+    S    P +                          
Sbjct: 208 VPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAE 267

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRLVAN-------RSAHFFSLRRQARVIWDTEGPAGFF 174
           L  G LAG+ S    YP +++R RL  +           F S+   A +I+   G  GFF
Sbjct: 268 LISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFF 327

>Scas_589.10
          Length = 316

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 105/292 (35%), Gaps = 59/292 (20%)

Query: 44  PMDTVKIRRQLQLAS------------EHKYHGILHTFRTVAREEGVRALWKGNVPASAM 91
           P+D VK R QLQ+              + ++  IL     + +EEG + L+KG  P   M
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 92  YVLYGSLQFGTYAWLNTAAASAGLPPQAHS---LAVGALAGLVSSLLTYPLDLLRTRLVA 148
            V   +++F +               +  S   L  G  AG+  SL+  P +L++ RL  
Sbjct: 93  EVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRL-Q 151

Query: 149 NRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP 208
           +  + + S  R  R I + +G  G +                    +      A  +GL 
Sbjct: 152 DAQSDYRSPIRCTRTIIENQGLFGIY-------------AGFESTIWRNTIWNASYFGLI 198

Query: 209 WLAAAASP-------------------TAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTR 249
           +      P                    AG +S     P D V+ R+Q   +K     T 
Sbjct: 199 FQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ--GSKK----TS 252

Query: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
               Y     + FL     + R EGI  +YKG+   +C+  P   + L V+ 
Sbjct: 253 SGMCYGWAWQSVFL-----IYRTEGIKGIYKGILPIICRYGPGGGLLLVVFN 299

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 200 IAADTYGLPWLAAAAS-PTAGLVSKAAVFPLDTVRRRLQI-VDAKHIPFFTRDPGAYSAL 257
           I  D   LP++    S   AG+     ++PLD V+ R Q+ ++ K +   T         
Sbjct: 4   IDKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALA--TSSVAVPKQP 61

Query: 258 RGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP 291
             +  L     +++ EG  +LYKG++  L    P
Sbjct: 62  EHSSILSCLSKILKEEGFKNLYKGMSPPLLMEVP 95

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTR--LVANRSA 152
           P  +    GA+AG+  +++ YPLD+++TR  L  N+ A
Sbjct: 12  PFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKA 49

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 110/277 (39%), Gaps = 36/277 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVLYG 96
           P+D +K R Q    ++    G++     ++  EG  ALWKG         PA A+Y    
Sbjct: 43  PIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAVY---- 98

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSL----LTYPLDLLRTRLVANRSA 152
              FGTY +      S     Q H     AL+G ++++    L  P D ++ RL  + + 
Sbjct: 99  ---FGTYEFCKARLISPE-DMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNL 154

Query: 153 HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGLPW 209
             +++ +Q   I+  EG A F+                    YE+ +      ++Y  P 
Sbjct: 155 RVWNVTKQ---IYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYN-PL 210

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPF-FTRDPGAYSALRGTRFLGLAVH 268
           +       +G    A   PLD ++  LQ+  ++ +     +D   +   R +R + L VH
Sbjct: 211 IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFG--RASRAI-LEVH 267

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
                G    ++GL   +  + P T I+ W    C +
Sbjct: 268 -----GWKGFWRGLKPRIVANIPATAIS-WTAYECAK 298

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 71/201 (35%), Gaps = 27/201 (13%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA---NRSAHFFSLRRQARVIWDTEGPAGF 173
           P    L  GA AG++   L +P+D L+TR+ A   N++A    +  Q   I   EG    
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAAS-TGMISQISKISTMEGSMAL 80

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGL--PWLAAAASPTAGLVSKAAVFP 228
           ++                   YE C    I+ +      P   A +   A + + A + P
Sbjct: 81  WKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNP 140

Query: 229 LDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCK 288
            DTV++RLQ+                      R   +   + + EG A+ Y      L  
Sbjct: 141 FDTVKQRLQLD------------------TNLRVWNVTKQIYQNEGFAAFYYSYPTTLAM 182

Query: 289 STPTTVITLWVYQRCLRLLEP 309
           + P       +Y+   +   P
Sbjct: 183 NIPFAAFNFMIYESASKFFNP 203

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 104/264 (39%), Gaps = 27/264 (10%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
           S  K++G L  F  +A  EG+ +LW+G      M +    + F  Y ++   +  A   P
Sbjct: 98  SSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYP 157

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRLV----ANRSAHFF----SLRRQARVIWDTEG 169
             + L  GA+A + ++    PL+L++T+L     +++S   +     L  + R      G
Sbjct: 158 TLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVG 217

Query: 170 PA-GFFRXXXXXXXXXXXXXXXXXXXYETCT----------IAADTYGLPWLAAAASPT- 217
           P+   F+                   YE C            + D   + ++ + AS   
Sbjct: 218 PSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCI 277

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           +G+++     P D  + R QI    +      DP   +  R          + R EG+A+
Sbjct: 278 SGMIAAICTHPFDVGKTRWQISMMNN-----SDPKGGN--RSRNMFKFLETIWRTEGLAA 330

Query: 278 LYKGLTMALCKSTPTTVITLWVYQ 301
           LY GL   + K  P+  I +  Y+
Sbjct: 331 LYTGLAARVIKIRPSCAIMISSYE 354

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 92/264 (34%), Gaps = 44/264 (16%)

Query: 65  ILHTFRTVAREEGVRALWKGNV-------PASAMYV---------LYGSLQFGTYAWLNT 108
           +L     ++  EG  ALW+G         PA A+Y          L  +  F T+  L T
Sbjct: 78  LLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKT 137

Query: 109 AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTE 168
           A +             G  A + +  L  P D ++ RL     +   S+ R A  I+  E
Sbjct: 138 AVS-------------GVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNE 184

Query: 169 GPAGFFRXXXXXXXXXXXXXXXXXXXYETCTI---AADTYGLPWLAAAASPTAGLVSKAA 225
           GP  FF                    YE+ T      + Y  PW+       AG    A 
Sbjct: 185 GPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYN-PWIHCLCGGIAGATCAAV 243

Query: 226 VFPLDTVRRRLQI--VDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLT 283
             PLD ++  LQI   D  H+  F              F   A  + ++ G    ++GL 
Sbjct: 244 TTPLDCIKTVLQIRGSDTVHVESFK---------TANTFKKAAQAIWQSYGWKGFWRGLQ 294

Query: 284 MALCKSTPTTVITLWVYQRCLRLL 307
             +  + P T I+   Y+    LL
Sbjct: 295 PRVISNIPATAISWTSYEFAKHLL 318

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 78/219 (35%), Gaps = 39/219 (17%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA-------------------NRSAHFFSL 157
           P ++ L  GA AG++   + +P+D L+TR+ A                   +  A   +L
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 158 RRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGL--PWLAA 212
            +Q   I  TEG    +R                   YE C    I A  +    P   A
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTA 138

Query: 213 AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRA 272
            +   A + + A + P DT+++RLQ+                S    +    +A ++ + 
Sbjct: 139 VSGVAATVAADALMNPFDTIKQRLQL---------------QSKSSDSSMWRMAFNIYKN 183

Query: 273 EGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTR 311
           EG  + +      L  + P   +   +Y+   +   PT 
Sbjct: 184 EGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTN 222

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 18/144 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT+K R  LQL S+     +      + + EG  A +       AM + + +L F  Y
Sbjct: 154 PFDTIKQR--LQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIY 211

Query: 104 A----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRT--RLVANRSAHFFS- 156
                + N   A     P  H L  G +AG   + +T PLD ++T  ++  + + H  S 
Sbjct: 212 ESSTKFFNPTNA---YNPWIHCLC-GGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESF 267

Query: 157 -----LRRQARVIWDTEGPAGFFR 175
                 ++ A+ IW + G  GF+R
Sbjct: 268 KTANTFKKAAQAIWQSYGWKGFWR 291

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 106/265 (40%), Gaps = 33/265 (12%)

Query: 64  GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNT--AAASAGLPPQAHS 121
           G + T R +  +EG  AL+KG        +   +++F +Y +  T  A    G+   +++
Sbjct: 81  GFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNT 140

Query: 122 LAVGALAGLVSSLLTY-PLDLLRTRLVANR--------SAHFFSLRRQARVIWDTEGPAG 172
              G  AG+  ++L   P+++++ RL A             + +  +    I   EG + 
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISA 200

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYETC-TIAADTYGLPWLAAAASPTAGLVSKA----AVF 227
            +R                   Y        + +G   L +  +   GL+S A    +  
Sbjct: 201 LYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNA 260

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG----TRFLGLAVHMVRAEGIASLYKGLT 283
           PLDT++ RLQ           +D    ++ +G     R   +   +++ EG  +LYKG+T
Sbjct: 261 PLDTIKTRLQ-----------KDKS--TSFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 284 MALCKSTPTTVITLWVYQRCLRLLE 308
             + +  P   +T  VY+   R LE
Sbjct: 308 PRVMRVAPGQAVTFTVYEFVRRHLE 332

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 55/121 (45%), Gaps = 11/121 (9%)

Query: 44  PMDTVKIRRQLQ-LASEH-----KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           PM+ VKIR Q Q L   H     KY   +    T+ +EEG+ AL++G    +A       
Sbjct: 158 PMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQG 217

Query: 98  LQFGTYA----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
             F  Y+    +L     +  LP    S  +G ++G +      PLD ++TRL  ++S  
Sbjct: 218 ANFTVYSKLREFLQEYHGTETLPSWETS-CIGLISGAIGPFSNAPLDTIKTRLQKDKSTS 276

Query: 154 F 154
           F
Sbjct: 277 F 277

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 42  TAPMDTVKIRRQLQLASEHK----YHGILHTFRTVAREEGVRALWKGNVP 87
            AP+DT+K R Q   ++  K    +  I H    + +EEG RAL+KG  P
Sbjct: 259 NAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITP 308

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 40/111 (36%), Gaps = 17/111 (15%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAK-----------------HIPFFTRD 250
           P +   A  TAGL       PLDT++ R+QI   +                         
Sbjct: 11  PVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGG 70

Query: 251 PGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
             A +A++   F+    ++   EG  +LYKGL   +    P   I    Y+
Sbjct: 71  GDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE 121

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 108/287 (37%), Gaps = 55/287 (19%)

Query: 44  PMDTVKIRRQLQLASE---------HKYHGILHTFRTVAREEGVRALWKGNVPASAMYVL 94
           P+D VK R QL++ +           +Y+G++   + + ++EG   L++G      M   
Sbjct: 32  PLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAP 91

Query: 95  YGSLQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
             + +F     Y  +     +     Q  S+A GA AG+  + +  P +L++ R+   +S
Sbjct: 92  KRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKS 151

Query: 152 AHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLA 211
           ++   +    + I   EG  G ++                   +         +G+ +  
Sbjct: 152 SYLGPMDCLKKTI-KNEGIMGLYK-------------GIESTMWRNALWNGGYFGVIYQV 197

Query: 212 AAASPTA-----------------GLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAY 254
             + P A                 G V      P D V+ R+Q VDA             
Sbjct: 198 RNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA-----------VS 246

Query: 255 SALRGTRF-LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
           SA++   + L   + + R EG  +LYKG    +C+  P   + L V+
Sbjct: 247 SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

>Scas_717.20
          Length = 356

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAR----EEGVRALWKGNVPASAMYVLYGSL 98
           AP+D +KI  Q       KY G L   +  A+     +G+R  ++G+         Y ++
Sbjct: 51  APLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAV 110

Query: 99  QFGTYAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +F  Y  + NT   S         L  G+LAGL S   TYPLDL+R RL
Sbjct: 111 KFVAYEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRL 159

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 47/125 (37%), Gaps = 11/125 (8%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHF-------FSLRRQARVIWDTEGPAGFFRXX 177
           G ++G  +  L  PLD ++  L    + H+         L+  A+ IW  +G  GFF+  
Sbjct: 39  GGISGSCAKTLIAPLDRIKI-LFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGH 97

Query: 178 XXXXXXXXXXXXXXXXXYE---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRR 234
                            YE      I +  Y   W    +   AGL S    +PLD +R 
Sbjct: 98  SVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRV 157

Query: 235 RLQIV 239
           RL  V
Sbjct: 158 RLAYV 162

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 14/97 (14%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLG---L 265
           W    +   AG+ S+ A +P + +RRRLQ+              + S +   RF     +
Sbjct: 264 WAELLSGGLAGMASQTAAYPFEIIRRRLQVSTL-----------SVSQMYDHRFQSISEI 312

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
           A  + +  G    + GL++   K TP    + +VY+R
Sbjct: 313 AKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYER 349

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 66/180 (36%), Gaps = 49/180 (27%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRAL----------------WKGN 85
           T P+D +++R  L   +EHK   +L   +T+ +E     L                ++G 
Sbjct: 149 TYPLDLIRVR--LAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGY 206

Query: 86  VPASAMYVLYGSLQFGTYAWLNTAAASAGLPP------------QAH------------S 121
            P     + Y  + F  +  L+       L P            + H             
Sbjct: 207 TPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAE 266

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRL------VANRSAH-FFSLRRQARVIWDTEGPAGFF 174
           L  G LAG+ S    YP +++R RL      V+    H F S+   A++I+   G  GFF
Sbjct: 267 LLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFF 326

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 99/260 (38%), Gaps = 21/260 (8%)

Query: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH 120
           +  G L   R +A+ EG+  LW+G      M V    + F  Y  L   +  A   P A+
Sbjct: 79  RLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLASRLPVAN 138

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVA-------NRSAHFF-SLRRQARVIWDTEGPAG 172
            L  GA A ++++    PL+LLRTRL +        R+ +    L R+ R      G   
Sbjct: 139 PLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRA 198

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYETCTI------AADTYGLPWL----AAAASPTAGLVS 222
            F+                   YE C        AA      W     + A     G V+
Sbjct: 199 LFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVA 258

Query: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVR-AEGIASLYKG 281
                P D  + R+QI  A   P      G  +    +R +   ++ +R +EGI +LY G
Sbjct: 259 ALLTHPFDVGKTRMQIAIAS--PQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTG 316

Query: 282 LTMALCKSTPTTVITLWVYQ 301
           L   + K  P+  I +  Y+
Sbjct: 317 LLPRVMKIAPSCAIMISTYE 336

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 12/58 (20%)

Query: 42  TAPMDTVKIRRQLQLASEHKY------------HGILHTFRTVAREEGVRALWKGNVP 87
           T P D  K R Q+ +AS  +              G+      + + EG+RAL+ G +P
Sbjct: 262 THPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLP 319

>Kwal_26.7972
          Length = 358

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 7/116 (6%)

Query: 43  APMDTVKIRRQLQLASEHKYHG----ILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           AP+D +KI  Q       KY G    ++     +   +G+R  ++G+         Y ++
Sbjct: 46  APLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAI 105

Query: 99  QFGTYAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL--VANRS 151
           +F  Y  + +    S      A  LA G++AGL S  +TYPLDL+R RL  V +RS
Sbjct: 106 KFIAYEQIRHFMIPSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRS 161

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRL----VANRSAHFF-SLRRQARVIWDTEGPAGFF 174
           L  G LAG+ S   +YP +++R RL    V+  S H F ++    R+I+   G  GFF
Sbjct: 262 LVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFF 319

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQ--IVDAKHIPFFTRDPGAYSAL---RGTR-- 261
           W    A   AG+ S+ A +P + +RRRLQ  +V    I  F   P     +   RG R  
Sbjct: 259 WAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGF 318

Query: 262 FLGLAVHMVR 271
           F+GL++  ++
Sbjct: 319 FVGLSIGYIK 328

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 9/94 (9%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           AG  +K  + PLD    R++I+     P + +  G+   L     +    H+   +GI  
Sbjct: 37  AGSCAKTLIAPLD----RIKILFQTSNPHYLKYSGSTMGL-----IRAGAHINAHDGIRG 87

Query: 278 LYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTR 311
            Y+G +  L +  P   I    Y++    + P++
Sbjct: 88  FYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSK 121

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R Q   AS  KY   L+ F T+ +EEG++  WKG  P     +L G + F 
Sbjct: 230 TMPIDTVKTRMQSLTAS--KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFT 287

Query: 102 TY 103
            Y
Sbjct: 288 IY 289

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 64/139 (46%), Gaps = 8/139 (5%)

Query: 45  MDTVKIRRQLQLASEHKYHG--ILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           + TV I  +  +  +++ +G  +   + ++ ++EG R L+ G +P S       +++ G 
Sbjct: 131 IKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVRLGC 190

Query: 103 YAWLNTAAASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
           Y  +          P+   L       VGA +G+V+   T P+D ++TR+ +  ++ + S
Sbjct: 191 YNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSS 250

Query: 157 LRRQARVIWDTEGPAGFFR 175
                  I+  EG   F++
Sbjct: 251 TLNCFTTIYKEEGLKTFWK 269

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 18/104 (17%)

Query: 204 TYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFL 263
           T GL ++  A S   G+V+  A  P+DTV+ R+Q + A            YS+      L
Sbjct: 211 TSGLTFIVGAFS---GVVTVYATMPIDTVKTRMQSLTASK----------YSST-----L 252

Query: 264 GLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                + + EG+ + +KG T  L +   +  I   +Y+  L  L
Sbjct: 253 NCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLYL 296

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL 146
            S   GALAG V + +TYP +  +TRL
Sbjct: 12  KSFVAGALAGAVEASITYPFEFAKTRL 38

>Kwal_26.7967
          Length = 297

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q     KY   ++ F TV REEG++  WKG  P     +L G + F 
Sbjct: 229 TMPIDTVKTR--MQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFT 286

Query: 102 TY 103
            Y
Sbjct: 287 IY 288

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 61  KYH----GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTA----AAS 112
           KYH    G+L  + ++  ++G   L++G +P S       +++ G Y  + T       S
Sbjct: 144 KYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNS 203

Query: 113 AGLPP--QAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGP 170
           A   P     +  VGA +G+V+   T P+D ++TR+ +  S+ + S       ++  EG 
Sbjct: 204 AKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKYSSTINCFATVFREEGL 263

Query: 171 AGFFR 175
             F++
Sbjct: 264 KTFWK 268

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 83/206 (40%), Gaps = 39/206 (18%)

Query: 122 LAVGALAGLVSSLLTY-PLDLLRTRLVANR---SAHFFS-----LRRQARVIWDTEGPAG 172
           +  G  AGL+ S++   P + ++T L+ ++   S  + +     LR  + +++D +G +G
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYD-KGFSG 167

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY-----------GLPWLAAAASPTAGLV 221
            +R                   Y         Y           G+ ++  A S   G+V
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFS---GIV 224

Query: 222 SKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           +     P+DTV+ R+Q +D+            YS+      +     + R EG+ + +KG
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSSK----------YSST-----INCFATVFREEGLKTFWKG 269

Query: 282 LTMALCKSTPTTVITLWVYQRCLRLL 307
            T  L +   +  I   +Y++ L +L
Sbjct: 270 ATPRLGRLILSGGIVFTIYEKVLVVL 295

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL 146
           HS   G+LAG V + +TYP +  +TRL
Sbjct: 11  HSFLAGSLAGAVEASITYPFEFAKTRL 37

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 75/150 (50%), Gaps = 20/150 (13%)

Query: 42  TAPMDTVKIRRQLQLA----SEHKYHGILHTFRTVAREEGVRALWKGNVPA-------SA 90
           T P+  VK R  LQ      S H Y G + TFR + ++EG +AL+ G VPA       + 
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTH-YKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAI 214

Query: 91  MYVLYGSLQ--FGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA 148
            + LY +L+  FG     + +        Q   LA   L+ +V+S +TYP ++LRTR+  
Sbjct: 215 QFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILA-SMLSKMVASTVTYPHEILRTRMQL 273

Query: 149 NRSAHFFSLRRQ----ARVIWDTEGPAGFF 174
            +S    +++R      ++ +  EG AGF+
Sbjct: 274 -KSDLPNTVQRHLLPLIKITYRQEGFAGFY 302

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 106/288 (36%), Gaps = 39/288 (13%)

Query: 44  PMDTVKIRRQLQ------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           P D  K R Q Q        S+H Y G   TF T+ ++EG   L+KG  P    Y+    
Sbjct: 58  PFDVAKTRLQAQGLQNMTHQSQH-YKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLM 116

Query: 98  LQFGTYAWLNTAAASAGLPPQAHSLAVGA---LAGLVSSLLTYPLDLLRTRL-----VAN 149
           + F  Y +      S  + P +  L+  +    AG +S++ T P+ +++TRL     +  
Sbjct: 117 IYFSVYDFCR--KYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGK 174

Query: 150 RSAHFFSLRRQARVIWDTEG---------PAGFFRXXXXXXXXXXXXXXXXXXXYETCTI 200
            S H+       R I   EG         PA                        E+  +
Sbjct: 175 YSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPLYENLKIRFGYSESTDV 234

Query: 201 AADTYGLPWLA-AAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
           + D     +     AS  + +V+    +P + +R R+Q+     +P   +          
Sbjct: 235 STDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL--KSDLPNTVQR--------- 283

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
              L L     R EG A  Y G    L ++ P  V+TL  ++   + L
Sbjct: 284 -HLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 76/173 (43%), Gaps = 22/173 (12%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVA-------NRSAHFFSLRRQARVIWDTEGPAGFFRXX 177
           GAL+G +S++L  P D+ +TRL A       ++S H+         I+  EG AG ++  
Sbjct: 45  GALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGL 104

Query: 178 XXXXXXXXXXXXXXXXXYETC-TIAADTY-GLPWLAAAASP-TAGLVSKAAVFPLDTVRR 234
                            Y+ C   + D +   P+L+ A+S  TAG +S  A  P+  V+ 
Sbjct: 105 QPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKT 164

Query: 235 RLQIVDAKHIPFFTRDPGAYSA-LRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
           RL +             G YS   +GT  +     +++ EG  +LY GL  AL
Sbjct: 165 RLMLQTG---------IGKYSTHYKGT--IDTFRKIIQQEGAKALYAGLVPAL 206

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 41/96 (42%), Gaps = 8/96 (8%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
           P +AA +   +G +S   V P D  + RLQ   A+ +   T     Y       F G   
Sbjct: 38  PRVAAISGALSGALSAMLVCPFDVAKTRLQ---AQGLQNMTHQSQHYKG-----FFGTFA 89

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
            + + EG A LYKGL   +    PT +I   VY  C
Sbjct: 90  TIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFC 125

>Scas_632.9
          Length = 292

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 104/277 (37%), Gaps = 35/277 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV-RALWKGNVPASAMYVLYGSLQFGT 102
           P DTVK+R Q Q    H +       +     EGV R  ++G         L  +  F +
Sbjct: 37  PFDTVKVRLQTQ--GSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVS 94

Query: 103 YAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSLRRQ 160
           Y    N       + P ++ L  GA AG  +S +  P++L++ +L V+N         + 
Sbjct: 95  YNQCSNVLEKFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKH 154

Query: 161 ARVI------WDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA-----ADTYGLPW 209
            ++I         +G  G ++                   YE           DT    W
Sbjct: 155 TKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTW 214

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
               +  +AGL   A++FP DTV+  +Q    +HI          +A++          +
Sbjct: 215 ELLVSGASAGLAFNASIFPADTVKSMMQ---TEHITLI-------NAVK---------KV 255

Query: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRL 306
           +   GI   Y+GL + L ++ P      ++Y+   ++
Sbjct: 256 LTTYGITGFYRGLGITLIRAVPANATVFYMYETLSKM 292

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/167 (17%), Positives = 64/167 (38%), Gaps = 24/167 (14%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGP-AGFFRXXXXXXXX 183
           G++AG    ++ YP D ++ RL    S  F +     +  +  EG   GFF+        
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFG 83

Query: 184 XXXXXXXXXXXYETCTIAADTYGLPWLAAAASPT---------AGLVSKAAVFPLDTVRR 234
                      Y  C+   + +         SP          AG  +   + P++ ++ 
Sbjct: 84  AALENATLFVSYNQCSNVLEKF------TNVSPLSNILLSGAFAGSCASFVLTPVELIKC 137

Query: 235 RLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           +LQ+ + +              ++ T+ +   ++++R +GI  L++G
Sbjct: 138 KLQVSNLQ--------TAVEGQIKHTKIIPTLMYVLREKGILGLWQG 176

>Kwal_33.14050
          Length = 314

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 80/207 (38%), Gaps = 30/207 (14%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL--------VANRSAHFFS-LRRQARVIWDT 167
           P  H LA GA AG++   + +P+D ++TR+         AN +A   S + +Q   I  T
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 168 EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGL--PWLAAAASPTAGLVS 222
           EG    ++                   YE C    I    +    P   AA+   A + +
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVAA 134

Query: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
              + P DT+++R+Q+        F++D          R   +A  + R EG+A+ +   
Sbjct: 135 DLLMNPFDTIKQRMQLRT------FSKD----------RMWSVASRIYRNEGLAAFFYSY 178

Query: 283 TMALCKSTPTTVITLWVYQRCLRLLEP 309
              +  + P       +Y+   +   P
Sbjct: 179 PTTIAMNIPFAAFNFAIYESATKFFNP 205

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 59/146 (40%), Gaps = 23/146 (15%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT+K R QL+  S+ +   +      + R EG+ A +       AM + + +  F  Y
Sbjct: 140 PFDTIKQRMQLRTFSKDRMWSVA---SRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIY 196

Query: 104 A----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN---------- 149
                + N         P  H L  G ++G   + +T PLD ++T L             
Sbjct: 197 ESATKFFN---PENTYNPLIHCL-CGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLF 252

Query: 150 RSAHFFSLRRQARVIWDTEGPAGFFR 175
           R A  FS  R A  I    G +GF+R
Sbjct: 253 RQADTFS--RAASAISKVYGWSGFWR 276

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 61  KYH----GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP 116
           KYH    G++  + ++ R++G   L++G +P S       +++ G Y  + T        
Sbjct: 147 KYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDS 206

Query: 117 PQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGP 170
           P+   L+      VGA +G+V+   T PLD ++TR+ +  S  + S       I+  EG 
Sbjct: 207 PKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGL 266

Query: 171 AGFFR 175
             F++
Sbjct: 267 KTFWK 271

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q     KY   ++ F T+ +EEG++  WKG  P     VL G + F 
Sbjct: 232 TMPLDTVKTR--MQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFT 289

Query: 102 TY 103
            Y
Sbjct: 290 IY 291

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 18/102 (17%)

Query: 206 GLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
           GL +L  A S   G+V+  +  PLDTV+ R+Q +D+            YS+      +  
Sbjct: 215 GLTFLVGAFS---GIVTVYSTMPLDTVKTRMQSLDSTK----------YSST-----MNC 256

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
              + + EG+ + +KG T  L +   +  I   +Y++ L +L
Sbjct: 257 FATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVML 298

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 106 LNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +++ A  + + P  HS   G+LAG   + +TYP +  +TRL
Sbjct: 1   MSSKATKSDVDP-LHSFLAGSLAGAAEACITYPFEFAKTRL 40

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 19/150 (12%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVL-YGSLQF 100
           P+DT+K R Q   L +  K   IL  T + + ++ G+R  ++G V    M +  Y +L  
Sbjct: 339 PIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRG-VHIGVMGIFPYAALDL 397

Query: 101 GTYA-----WLNTAAASAGLPPQA------HSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           GT++     ++   A   GLP           L +GA +G V + L YP++LLRTRL A 
Sbjct: 398 GTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQ 457

Query: 150 RS-AHFFSLRRQARVIWDT---EGPAGFFR 175
            + AH  +    + V+  T   EG  G F+
Sbjct: 458 GTYAHPHTYNGFSDVLKKTIQREGYQGLFK 487

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 97/264 (36%), Gaps = 40/264 (15%)

Query: 71  TVAREEGVRALWKGN-------VPASAMYVLYGSLQFGT--YAWLNTAAASAGLPPQAHS 121
           T+ R+ G+RA + GN        P SA  + +GS +      A L     ++ L   +  
Sbjct: 266 TLYRQGGLRAFYVGNGLNVVKVFPESA--IKFGSFEMAKRIMARLENVKDTSELSRLSTY 323

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRLVA---NRSAHFFSLRRQ-ARVIWDTEGPAGFFRXX 177
           +A G L G+ +    YP+D L+ R+     N +    S+  Q A+ ++   G   F+R  
Sbjct: 324 IA-GGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 178 XXXXXXXXXXXXXXXXXYET-----CTIAADTYGLPWLAAAASPT--------AGLVSKA 224
                            +           A   GLP      S          +G V   
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTM 284
            V+P++ +R RLQ             P  Y+      F  +    ++ EG   L+KGL  
Sbjct: 443 LVYPINLLRTRLQAQGT------YAHPHTYNG-----FSDVLKKTIQREGYQGLFKGLVP 491

Query: 285 ALCKSTPTTVITLWVYQRCLRLLE 308
            L K  P   I+   Y+   RL++
Sbjct: 492 NLAKVCPAVSISYLCYENLKRLMK 515

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 44  PMDTVKIRRQLQ--LASEHKYHGILHTFRTVAREEGVRALWKGNVP--------ASAMYV 93
           P++ ++ R Q Q   A  H Y+G     +   + EG + L+KG VP         S  Y+
Sbjct: 446 PINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYL 505

Query: 94  LYGSLQ 99
            Y +L+
Sbjct: 506 CYENLK 511

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 17/149 (11%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+DT+K R Q   L ++ K + +L  T + + RE G+R  ++G          Y +L  G
Sbjct: 367 PIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLG 426

Query: 102 TYA-----WLNTAAASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANR 150
           T++     ++   A +  LP    +L+      +GA +G V + + YP++LLRTRL A  
Sbjct: 427 TFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQG 486

Query: 151 S-AHFFSLRRQARVIWDT---EGPAGFFR 175
           + AH +       V+  T   EG  G F+
Sbjct: 487 TYAHPYVYNGFKDVLLKTLEREGYQGLFK 515

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 97/268 (36%), Gaps = 46/268 (17%)

Query: 70  RTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY-------AWLNTAAASAGLPPQAHSL 122
           +++ R+ G++A + GN           S++FG++         L     +  L   +  +
Sbjct: 293 KSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYI 352

Query: 123 AVGALAGLVSSLLTYPLDLLR---------TRLVANRSAHFFSLRRQARVIWDTEGPAGF 173
           A G LAG+ +    YP+D L+         T+L  N       L + A+ ++   G   F
Sbjct: 353 A-GGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNL-----LFQTAKDMFREGGLRLF 406

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETCT---IA--ADTYGLPWLAAAASPT--------AGL 220
           +R                   +       IA  A T  LP      S          +G 
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGT 466

Query: 221 VSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYK 280
           V  + V+P++ +R RLQ       P+       Y+      F  + +  +  EG   L+K
Sbjct: 467 VGASVVYPINLLRTRLQAQGTYAHPY------VYNG-----FKDVLLKTLEREGYQGLFK 515

Query: 281 GLTMALCKSTPTTVITLWVYQRCLRLLE 308
           GL   L K  P   I+   Y+   + + 
Sbjct: 516 GLVPTLAKVCPAVSISYLCYENLKKFMN 543

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/290 (19%), Positives = 117/290 (40%), Gaps = 53/290 (18%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPA-------SAMYV-LY 95
           P D +K R Q     + K   +  T +++   E    LW+G +P+       SAMY+ + 
Sbjct: 27  PFDLLKTRLQ-----QDKTSTLWKTLKSI---ETPSQLWRGALPSCIRTSVGSAMYLTML 78

Query: 96  GSLQFGTYAWLNTAAASAGLPPQAH---SLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
            S++       NT +  +   PQ +   ++  GA+   ++ L+T P+ +++ R  +    
Sbjct: 79  NSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTL-Y 137

Query: 153 HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAA---------- 202
            + SLR     I+ TEG  GFFR                   Y+   +            
Sbjct: 138 QYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVK 197

Query: 203 -------DTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYS 255
                   TY    +  +++ +A +++ +   P DTV+ R+Q+           +P  + 
Sbjct: 198 LNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQL-----------EPAKFH 246

Query: 256 ALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
           +   T +     H+   E + +L+ G+++ L +   +  I   +Y+  ++
Sbjct: 247 SFTSTFW-----HIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEIVK 291

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84
           TAP DTVK R QL+ A   K+H    TF  +A +E VR L+ G
Sbjct: 228 TAPFDTVKTRMQLEPA---KFHSFTSTFWHIATKESVRNLFAG 267

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/193 (19%), Positives = 72/193 (37%), Gaps = 24/193 (12%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV---IWDTEGPAGFFRXXXXXX 181
           G   GLVS+++  P DLL+TRL  ++++  +   +       +W    P+          
Sbjct: 14  GFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSIETPSQLWRGALPSCIRTSVGSAM 73

Query: 182 XXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKA----AVFPLDTVRRRLQ 237
                            T +  +  LP L    +  +G V++A       P+  ++ R +
Sbjct: 74  YLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYE 133

Query: 238 IVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITL 297
               +           Y++LR         H+ R EG+   ++G      +  P   + +
Sbjct: 134 STLYQ-----------YTSLRYA-----TSHIFRTEGLRGFFRGFGATALRDAPYAGLYM 177

Query: 298 WVYQRCLRLLEPT 310
             Y R +++L PT
Sbjct: 178 LFYDR-MKVLVPT 189

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 64/148 (43%), Gaps = 26/148 (17%)

Query: 45  MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVR--------ALWKGNVPASAMYVLYG 96
           +DTVK R+Q    + HKY  +L  +RT+  EEG R        A   G+ P++A++    
Sbjct: 74  LDTVKTRQQ-GAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIF---- 128

Query: 97  SLQFGTYAWLN-TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA------- 148
              F TY +   T      L      L  G L    SS +  P ++L+TRL         
Sbjct: 129 ---FSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNP 185

Query: 149 --NRSAHFFSLRRQARVIWDTEGPAGFF 174
             N   ++ SLR     I+ TEG A  F
Sbjct: 186 HFNSGYNYKSLRNAIATIYRTEGVAALF 213

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 14/118 (11%)

Query: 43  APMDTVKIRRQLQ-------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLY 95
            P + +K R QLQ         S + Y  + +   T+ R EGV AL+ G     A  + +
Sbjct: 167 VPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPF 226

Query: 96  GSLQFGTYAWLNT-AAASAGLPPQAHSLAV------GALAGLVSSLLTYPLDLLRTRL 146
            +LQF  Y      A    G     H L++      GA AG ++ +LT PLD+++TR+
Sbjct: 227 SALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRV 284

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 71/193 (36%), Gaps = 15/193 (7%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQA-RVIWDTEG-PAGFF 174
           P  H    G + G++     + LD ++TR     + H +    QA R ++  EG   G +
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLY 111

Query: 175 RXXXXXXXXXXXXXXXXXXXYE-TCTIAADTYGLPWLAAAASPTAGLV----SKAAVFPL 229
                               YE T     + Y L      +  TAG +    S     P 
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLN--DTFSHLTAGFLGDFFSSFVYVPS 169

Query: 230 DTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKS 289
           + ++ RLQ+    + P F      Y +LR          + R EG+A+L+ G    L + 
Sbjct: 170 EVLKTRLQLQGCYNNPHFNSGYN-YKSLRNA-----IATIYRTEGVAALFFGYKATLARD 223

Query: 290 TPTTVITLWVYQR 302
            P + +    Y++
Sbjct: 224 LPFSALQFAFYEK 236

>Kwal_55.21335
          Length = 317

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 109/278 (39%), Gaps = 50/278 (17%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEG-VRALWKGNVPASAMYVLYGSLQFGT 102
           P+DT+K+R Q Q A  H +       +   ++EG V+  ++G         L  ++ F T
Sbjct: 65  PLDTIKVRLQTQPA--HVFPTSWSCIKYTYQKEGFVKGFYQGVASPLVGAALENAVLFVT 122

Query: 103 YA-WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSLRRQ 160
           +    N       + P + ++  GA AG  +S +  P++L++  L V+N      +  R 
Sbjct: 123 FNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEG---ATTRH 179

Query: 161 ARVIWDT-------EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA-----ADTYGLP 208
           ++ IW T       +G  G ++                   YE+          DT    
Sbjct: 180 SK-IWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHT 238

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVR-----RRLQIVDAKHIPFFTRDPGAYSALRGTRFL 263
           W   A+  +AG+   A++FP DT++     + L IVDA                      
Sbjct: 239 WELLASGASAGVAFNASIFPADTIKSTAQTQHLGIVDATK-------------------- 278

Query: 264 GLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
                ++   G A LY+GL + L ++ P   I  + Y+
Sbjct: 279 ----RILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 110/291 (37%), Gaps = 54/291 (18%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P D +K R  LQ   +    G L   R+       + LW+G +P+S    +  +L   T 
Sbjct: 27  PFDLLKTR--LQQNKDTTLWGTLKEIRSP------KQLWRGALPSSLRTSIGSALYLSTL 78

Query: 104 AWLNTAAA----------SAGLPP--QAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
               TA A          S+ LP      +LA GA    V   +T P+ +++ R  +   
Sbjct: 79  NVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVRYESTMY 138

Query: 152 AHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYE-----------TCTI 200
           ++  SL    R I+ TEG  GFF                    YE           + TI
Sbjct: 139 SYK-SLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTI 197

Query: 201 AADTYGL--PWLAAAASPTAGLVSKA----AVFPLDTVRRRLQIVDAKHIPFFTRDPGAY 254
           + D  G+   + +   +  +  +S +       P DT++ R+Q+           DP  +
Sbjct: 198 SYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQL-----------DPTKF 246

Query: 255 SALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
           S      F    V +V  E   +L+ GLT+ L +   +  I   +Y+  ++
Sbjct: 247 SG-----FYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEELIK 292

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 116 PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQAR 162
           P  +  L  G + GL S+++  P DLL+TRL  N+    +   ++ R
Sbjct: 5   PKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIR 51

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 104/272 (38%), Gaps = 28/272 (10%)

Query: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ 118
             K++G L  F  +A+ EGV  LW+G      M +    + F  Y ++   +   GL P 
Sbjct: 107 NQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLYPT 166

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRL-------VANRSAHFF-SLRRQARVIWDTEGP 170
            + L  GA A  +++    PL+L++T+L       + N S   +  L  + +      G 
Sbjct: 167 INPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGV 226

Query: 171 AG-FFRXXXXXXXXXXXXXXXXXXXYETCTIAA--------DTYGLPWLAAAASPTAGLV 221
           A   F+                   YE              D     W     S   G +
Sbjct: 227 AQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFI 286

Query: 222 SK--AAV----FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGI 275
           S   AA+    F +   R+++ +V  K +       G+ + + G  FL    ++ + EGI
Sbjct: 287 SGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFG--FLN---YIRKTEGI 341

Query: 276 ASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
            +LY GL   + K  P+  I +  Y+   RL 
Sbjct: 342 GALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 10/125 (8%)

Query: 61  KYH----GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP 116
           KYH    G+L  +  + R++G+  L++G +P S       +++ G Y  +          
Sbjct: 144 KYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNA 203

Query: 117 PQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGP 170
           P+   L+      VGA +G+V+   T P+D ++TR+ +  S  + S       I+  EG 
Sbjct: 204 PKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGL 263

Query: 171 AGFFR 175
             F++
Sbjct: 264 KAFWK 268

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q     +Y   ++ F T+ +EEG++A WKG  P      L G + F 
Sbjct: 229 TMPIDTVKTR--MQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFT 286

Query: 102 TY 103
            Y
Sbjct: 287 VY 288

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 79/206 (38%), Gaps = 41/206 (19%)

Query: 125 GALAGLVSSLL-----TYPLDLLRTRLVANRSA-------HFFSLRRQARVIWDTEGPAG 172
           G +AGL + LL       P + ++T L+ ++ +       +   + R    +   +G +G
Sbjct: 108 GVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSG 167

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY-----------GLPWLAAAASPTAGLV 221
            +R                   Y    +    Y           GL ++  A S   G+V
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFS---GIV 224

Query: 222 SKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           +     P+DTV+ R+Q +D+K           YS+      +     + + EG+ + +KG
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSKR----------YSST-----INCFTTIFKEEGLKAFWKG 269

Query: 282 LTMALCKSTPTTVITLWVYQRCLRLL 307
            T  L +   +  I   VY++ L +L
Sbjct: 270 ATPRLGRLFLSGGIVFTVYEKVLTVL 295

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           + S   G LAG V + +TYP +  +TRL
Sbjct: 10  SKSFIAGCLAGAVEASVTYPFEFAKTRL 37

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 106/284 (37%), Gaps = 39/284 (13%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R Q    S+ K  G++   + + R EG  A +KG +       +  S+QFG  
Sbjct: 46  PFDTTKVRLQ---TSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN 101

Query: 104 AWLNT--AAASAG-LPPQAHS-------LAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
             +    AA +A  + PQ H           G   G+V+S L  P++ +R RL    S  
Sbjct: 102 ESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQ- 160

Query: 154 FFSLRRQARVIWDT----EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP- 208
                RQ +  +D            R                   YE   +     G P 
Sbjct: 161 --GNERQFKGPFDCIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPR 218

Query: 209 -----WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFL 263
                W   +    +G +    V+P+D V+  LQ  D+   P +       S ++ TR L
Sbjct: 219 NQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQ-TDSIENPKYKN-----SIIKATRAL 272

Query: 264 GLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                  +  GI + +KG    + ++ P    T   ++  +R+L
Sbjct: 273 ------YKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 43  APMDTVKIRRQLQLA--SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           AP++ V+IR Q Q +  +E ++ G     + +A+    +AL +G +P            F
Sbjct: 145 APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGLLPTMIRAGHGLGTYF 201

Query: 101 GTYAWLNTAAASAGLP----PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN---RSAH 153
             Y  L       G P    P     + GAL+G +  L  YP+D++++ L  +      +
Sbjct: 202 AAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKY 261

Query: 154 FFSLRRQARVIWDTEGPAGFFR 175
             S+ +  R ++   G   FF+
Sbjct: 262 KNSIIKATRALYKQHGIPAFFK 283

>Scas_489.4
          Length = 297

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 51  RRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAA 110
           ++ L+   ++   G+L  + ++ R++G+  L++G +P S       +++ G Y  + T  
Sbjct: 139 KQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMV 198

Query: 111 ASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVI 164
                 P+   L+      VGA +G+V+   T P+D ++TR+ +  +  + S       I
Sbjct: 199 QDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATKYTSTVNCFAKI 258

Query: 165 WDTEGPAGFFR 175
           +  EG   F++
Sbjct: 259 FKEEGLKTFWK 269

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q     KY   ++ F  + +EEG++  WKG  P     +L G + F 
Sbjct: 230 TMPIDTVKTR--MQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFT 287

Query: 102 TY 103
            Y
Sbjct: 288 IY 289

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL 146
           HS   GALAG + + +TYP +  +TRL
Sbjct: 12  HSFIAGALAGAIEASITYPFEFAKTRL 38

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 18/102 (17%)

Query: 206 GLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
           GL ++  A S   G+V+     P+DTV+ R+Q +DA                  T  +  
Sbjct: 213 GLTFIVGAFS---GVVTVYTTMPIDTVKTRMQSLDATKY---------------TSTVNC 254

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
              + + EG+ + +KG T  L +   +  I   +Y+  L  L
Sbjct: 255 FAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVFL 296

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 63/149 (42%), Gaps = 22/149 (14%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+  VK R QL  A    Y   L   ++V + EGV  L+KG + AS +  + G LQ+ 
Sbjct: 187 TNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKG-LSASYLGSVEGILQWI 245

Query: 102 TYAWL-----------------NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRT 144
            Y  +                 +  + S  +           LA  V+S++TYP +++RT
Sbjct: 246 LYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRT 305

Query: 145 RL----VANRSAHFFSLRRQARVIWDTEG 169
           RL      N    +  L +  RVI   EG
Sbjct: 306 RLRQAPTENGKLKYTGLVQSFRVIIKEEG 334

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 116/317 (36%), Gaps = 68/317 (21%)

Query: 42  TAPMDTVKIRRQ------------LQLASEHKYH----GILHTFRT------VAREEGVR 79
           T P D VK R Q            +Q       H     +LH   T      V R+EG R
Sbjct: 68  TCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFR 127

Query: 80  ALWKGNVPASAMYVLYGSLQFGTYAW--------LNTAAASAGLPPQAHSLAVGALAGLV 131
           +L+KG  P     +   S+ F TY          LN    +    P  H LA  A AG  
Sbjct: 128 SLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEA----PWIHLLA-AATAGWA 182

Query: 132 SSLLTYPLDLLRTRLVANRSA---HFFSLRRQARVIWDTEGPAGFFR------------- 175
           +S +T P+ L++TRL  +++    +  SL     V+   EG  G ++             
Sbjct: 183 TSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVV-KNEGVLGLYKGLSASYLGSVEGI 241

Query: 176 -----XXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLD 230
                                   +E     +D        + ++  A  V+    +P +
Sbjct: 242 LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHE 301

Query: 231 TVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKST 290
            VR RL+           + P     L+ T  +     +++ EG+ S+Y GLT  L ++ 
Sbjct: 302 VVRTRLR-----------QAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTV 350

Query: 291 PTTVITLWVYQRCLRLL 307
           P ++I    ++  ++LL
Sbjct: 351 PNSIIMFGTWELVIKLL 367

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 16/102 (15%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
           PW+   A+ TAG  +     P+  V+ RLQ+           D       + +  L    
Sbjct: 169 PWIHLLAAATAGWATSTVTNPIWLVKTRLQL-----------DKAGTKTYKNS--LDCIK 215

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWV-YQRCLRLLE 308
            +V+ EG+  LYKGL+ +   S     I  W+ Y++  R+++
Sbjct: 216 SVVKNEGVLGLYKGLSASYLGSVEG--ILQWILYEQMKRIIK 255

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 9/102 (8%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQ--IVDAKHIPFFTRDPGAY-------SALR 258
           PW+   A    G+       P D V+ RLQ  +   ++     ++ G+        S L 
Sbjct: 50  PWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLH 109

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
                G+  ++ R EG  SL+KGL   L    P   I    Y
Sbjct: 110 FKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTY 151

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 56/136 (41%), Gaps = 5/136 (3%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAR----EEGVRALWKGNVPASAMYVLYGSL 98
           AP+D +KI  Q       KY G L      A+     +G+R  ++G+         Y ++
Sbjct: 37  APLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAV 96

Query: 99  QFGTYAWLNTA-AASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSL 157
           +F  Y  + +    S         LA G+LAGL S  +TYPLDL R RL          L
Sbjct: 97  KFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKL 156

Query: 158 RRQARVIWDTEGPAGF 173
           R   + I+      G 
Sbjct: 157 RDIVKTIYHEPASEGL 172

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 8/94 (8%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W    A   +G++S+ A +PL+ +RRRLQ+         T  P      +      +A  
Sbjct: 250 WAELVAGGLSGILSQTAAYPLEIIRRRLQVS--------TLSPRKMYDHKFQSISSIARI 301

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
           + + +G    + GL++   K TP    + +VY+R
Sbjct: 302 IYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYER 335

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 72/180 (40%), Gaps = 49/180 (27%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVARE---EGVRA-------------LWKGN 85
           T P+D  ++R  L   +EHK   +    +T+  E   EG+ +              ++G 
Sbjct: 135 TYPLDLTRVR--LAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGY 192

Query: 86  VPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQA------------------------HS 121
           VP     + Y  + F  +  ++    S+ + P A                          
Sbjct: 193 VPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAE 252

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRL----VANRSAH---FFSLRRQARVIWDTEGPAGFF 174
           L  G L+G++S    YPL+++R RL    ++ R  +   F S+   AR+I+  +G  GFF
Sbjct: 253 LVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFF 312

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 47/125 (37%), Gaps = 11/125 (8%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHF-------FSLRRQARVIWDTEGPAGFFRXX 177
           G ++G  +  L  PLD ++  L    + H+         L   A+ IW  +G  GFF+  
Sbjct: 25  GGVSGSCAKTLIAPLDRIKI-LFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGH 83

Query: 178 XXXXXXXXXXXXXXXXXYE---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRR 234
                            YE   +  I +  Y   W   A+   AGL S    +PLD  R 
Sbjct: 84  SVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLTRV 143

Query: 235 RLQIV 239
           RL  V
Sbjct: 144 RLAYV 148

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 50/113 (44%), Gaps = 11/113 (9%)

Query: 201 AADTYGLPWL--AAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALR 258
           A D   L ++  +  A   +G  +K  + PLD    R++I+     P +++  G+   L 
Sbjct: 9   AVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLD----RIKILFQTSNPHYSKYAGSLVGLY 64

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTR 311
                  A H+   +GI   ++G ++ L +  P   +    Y++   +L P+R
Sbjct: 65  EA-----AKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSR 112

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 76/150 (50%), Gaps = 19/150 (12%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVL-YGSLQF 100
           P+DT+K R Q   L +  K + +L  T R + R+ G++  ++G V    M +  Y +L  
Sbjct: 335 PIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRG-VTVGVMGIFPYAALDL 393

Query: 101 GTYA-----WLNTAAASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVAN 149
           GT++     ++   A   G+P    +++      +GA +G V + + YP++LLRTRL A 
Sbjct: 394 GTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQ 453

Query: 150 RS-AHFFSLRRQARVIWDT---EGPAGFFR 175
            + AH  +      V+W T   EG  G F+
Sbjct: 454 GTYAHPHTYTGFRDVLWKTVQREGYQGLFK 483

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 99/266 (37%), Gaps = 44/266 (16%)

Query: 71  TVAREEGVRALWKGN-------VPASAMYVLYGSLQFGT--YAWLNTAAASAGLPPQAHS 121
           T+ R+ G+RA + GN        P SAM   +GS +      A L     ++ L   +  
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMK--FGSFELAKQLMAHLEGVHHTSELSKFSTY 319

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRL------VANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           +A G + G+V+    YP+D L+ R+       A +      L   AR ++   G   F+R
Sbjct: 320 IA-GGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL--LISTARQMYRDGGLKLFYR 376

Query: 176 XXXXXXXXXXXXXXXXXXXYETCT---IA--ADTYGLP--------WLAAAASPTAGLVS 222
                              +       IA  A   G+P        ++       +G V 
Sbjct: 377 GVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVG 436

Query: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
              V+P++ +R RLQ             P  Y+  R   +       V+ EG   L+KGL
Sbjct: 437 ATVVYPINLLRTRLQAQGT------YAHPHTYTGFRDVLW-----KTVQREGYQGLFKGL 485

Query: 283 TMALCKSTPTTVITLWVYQRCLRLLE 308
              L K  P   I+   Y+   RL++
Sbjct: 486 VPNLAKVCPAVSISYLCYENFKRLMK 511

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 100/292 (34%), Gaps = 47/292 (16%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R Q            L   R + + EGV A +KG +       +  S+QFG  
Sbjct: 54  PFDTTKVRLQTATTRTTT----LEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVN 109

Query: 104 AWL-------------NTAAASAGLP-----PQAHSLAVGALAGLVSSLLTYPLDLLRTR 145
             +             N ++    L      P +     G   G+V+S L  P++ +R R
Sbjct: 110 EAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIR 169

Query: 146 LVANRSAHFFSLRRQARVIWDT----EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA 201
           L    S       R+ +  WD     +   G  R                   YE     
Sbjct: 170 LQTQTSN---GGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAR 226

Query: 202 ADTYGL------PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYS 255
               GL      PW        +G +    V+PLD V+  +Q  D +   +  ++  +Y 
Sbjct: 227 EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKY--KNSISY- 283

Query: 256 ALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
                    +A  +   EGI + +KG    + +S P    T   ++  +R L
Sbjct: 284 ---------VAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326

>Scas_718.5
          Length = 324

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 105/282 (37%), Gaps = 35/282 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGN-VPASAMYVLYGSLQFGT 102
           P DT K+R Q    +  K  G L   R + + EGV A +KG+ +P   +     S+QFG 
Sbjct: 59  PFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACV-SVQFGV 113

Query: 103 YAWL-------NTAAASA---GLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRS 151
              +       NT+  +    G          G   G+V+S L  P++ +R RL     +
Sbjct: 114 NEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGN 173

Query: 152 AHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP--- 208
            +    +     I          R                   YE         G     
Sbjct: 174 GNEREFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSE 233

Query: 209 ---WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
              W   +    +G+V   A++PLD V+  +Q  D        R+P   ++++      +
Sbjct: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQ-TDT------LRNPRFKNSMKN-----V 281

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
             H+ R +GI++ +KG    + ++ P    T   ++  +RLL
Sbjct: 282 INHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 68/145 (46%), Gaps = 18/145 (12%)

Query: 43  APMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG---S 97
           +P++ V+IR Q Q  +  E ++ G L   R + +E   ++L +G  P   M +  G    
Sbjct: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRP---MMLRAGHGLG 211

Query: 98  LQFGTYAWLNTAAASAGLPPQAHS----LAVGALAGLVSSLLTYPLDLLRTRLVAN--RS 151
             F TY  L       G      +     + G+L+G+V  L  YPLD++++ +  +  R+
Sbjct: 212 CYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRN 271

Query: 152 AHF-FSLRRQARVIWDTEGPAGFFR 175
             F  S++     ++  +G + FF+
Sbjct: 272 PRFKNSMKNVINHLYREQGISAFFK 296

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 103/273 (37%), Gaps = 40/273 (14%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV-RALWKGNVPASAMYVLYGSLQFGT 102
           P DTVK+R Q Q A  H +       +     EG+ R  ++G     A   L  ++ F +
Sbjct: 26  PFDTVKVRLQTQPA--HMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAVLFVS 83

Query: 103 YAWLNTAA----ASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSL 157
           +   N A       + L P + ++  GA AG  +S +  P++L++ +L V+N S    S 
Sbjct: 84  F---NQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSH 140

Query: 158 RRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAAD--------TYGLPW 209
            +    I       GF                     + T  +  +             W
Sbjct: 141 TKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTW 200

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269
              A+  +AGL   A++FP DT++  +Q     HI                  L  A   
Sbjct: 201 ELLASGASAGLAFNASIFPADTIKSTMQ---TDHID-----------------LSSATRK 240

Query: 270 VRA-EGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           + A +GIA  Y+GL + L ++ P      + Y+
Sbjct: 241 IYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEG 169
           A  +  G++AG V  ++ YP D ++ RL    +  F +     +  +D EG
Sbjct: 7   AKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEG 57

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAR---EEGVRA-LWKGNVPASAMYVLYGSLQ 99
           P + VK R Q+     H  +    T +++ R   +EG+R  L++G        + +  +Q
Sbjct: 114 PAEVVKQRTQV-----HSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQ 168

Query: 100 FGTYAWLNTAAASAGLPPQAH---SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
           F  Y +L    A A    Q         G++AG +++  T PLD L+TRL+ N++    S
Sbjct: 169 FPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTA--S 226

Query: 157 LRRQARVIWDTEGPAGFF 174
           L      I+  EGPA FF
Sbjct: 227 LGSVIIRIYREEGPAVFF 244

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           SL  GA AG  + L+ +P+D ++TRL A 
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAK 35

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+DTVK R  +Q  +  +Y   ++ F T+ +EEG++  WKG  P     +L G + F 
Sbjct: 310 TMPIDTVKTR--MQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFT 367

Query: 102 TYAWLNTAAA 111
            Y  + T  A
Sbjct: 368 IYEKVLTVLA 377

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ 118
           ++   G++  +  +  ++G   L++G +P S       +++ G Y  + T        P+
Sbjct: 227 QNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPK 286

Query: 119 AHSLA------VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAG 172
              L+      VGA +G+V+   T P+D ++TR+ +  +  + S       I+  EG   
Sbjct: 287 DKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKT 346

Query: 173 FFR 175
           F++
Sbjct: 347 FWK 349

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 18/102 (17%)

Query: 206 GLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
           GL ++  A S   G+V+     P+DTV+ R+Q ++A          G YS+      +  
Sbjct: 293 GLTFIVGAFS---GIVTVYTTMPIDTVKTRMQSLNA----------GQYSST-----INC 334

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
              + + EG+ + +KG T  L +   +  I   +Y++ L +L
Sbjct: 335 FATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVL 376

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL 146
           HS   G++AG + + +TYP +  +TRL
Sbjct: 92  HSFLAGSIAGAIEASITYPFEFAKTRL 118

>Scas_578.3*
          Length = 524

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 72/149 (48%), Gaps = 17/149 (11%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+DT+K R Q   L    K + +L  T + + +E G+R  ++G +  +     Y +L  G
Sbjct: 346 PIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLG 405

Query: 102 TYA-----WLNTAAASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVANR 150
           T++     ++   +    +P +   L+      +GA +G V +   YP++LLRTRL A  
Sbjct: 406 TFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQG 465

Query: 151 S-AHFFSLRRQARVIWDT---EGPAGFFR 175
           + AH ++      V   T   EG  GF++
Sbjct: 466 TYAHPYTYTGFRDVFMQTLKREGVPGFYK 494

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 97/262 (37%), Gaps = 36/262 (13%)

Query: 65  ILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLA- 123
           I+   R++ R+ G+RA + GN  +        S++FGT+       A+       + L+ 
Sbjct: 267 IIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSK 326

Query: 124 -----VGALAGLVSSLLTYPLDLLRTR-----LVANRSAHFFSLRRQARVIWDTEGPAGF 173
                 G +AG+++ +  YP+D L+ R     L  N   +   L   A+ ++   G   F
Sbjct: 327 LQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNAL-LISTAKEMYKEGGIRVF 385

Query: 174 FRXXXXXXXXXXXXXXXXXXXY------------ETCTIAADTYGLPW-LAAAASPTAGL 220
           +R                   +            +   I      L + L       +G 
Sbjct: 386 YRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGT 445

Query: 221 VSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYK 280
           V   AV+P++ +R RLQ       P+       Y+  R      + +  ++ EG+   YK
Sbjct: 446 VGATAVYPINLLRTRLQAQGTYAHPY------TYTGFR-----DVFMQTLKREGVPGFYK 494

Query: 281 GLTMALCKSTPTTVITLWVYQR 302
           GL   L K  P   I    Y++
Sbjct: 495 GLVPTLVKVCPAVSIGYLCYEK 516

>Kwal_27.12081
          Length = 369

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 119/312 (38%), Gaps = 61/312 (19%)

Query: 42  TAPMDTVKIRRQLQL------------ASEHKYHGILH---TFRTVA---REEGVRALWK 83
           T P D VK R Q  +            +S     GI H   TF  ++   + EG R+L+K
Sbjct: 70  TCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFK 129

Query: 84  GNVPASAMYVLYGSLQFGTYA---WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLD 140
           G  P     +   S+ F TY     + + A + G       L   A AG  +S  T P+ 
Sbjct: 130 GLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNPIW 189

Query: 141 LLRTRLVANRSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXXXXX 193
           L++TRL  +++ H     RQ +  WD        EG  G ++                  
Sbjct: 190 LIKTRLQLDKAGH----TRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLL 245

Query: 194 XYETCTI----AADTYG-------------LPWLAAAASP-TAGLVSKAAVFPLDTVRRR 235
             +   +    + + +G               W   + S   A  ++    +P + VR R
Sbjct: 246 YEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTR 305

Query: 236 LQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVI 295
           L+           + P     L+ T  +     +++ EG+AS+Y GLT  L ++ P ++I
Sbjct: 306 LR-----------QAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSII 354

Query: 296 TLWVYQRCLRLL 307
               ++  ++LL
Sbjct: 355 MFGTWELVIKLL 366

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 80/201 (39%), Gaps = 40/201 (19%)

Query: 109 AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA------------NRSAHFFS 156
           ++ SA + P  H    G   G+  +++T P D+++TRL +            N+S++  S
Sbjct: 44  SSVSAEVKPWVH-FVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVS 102

Query: 157 -----LRRQARVI---WDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT-IAADTYG- 206
                 R    +I   +  EG    F+                   Y T   I +  +  
Sbjct: 103 SGIRHFRETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNN 162

Query: 207 ---LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRD-PGAYSALRGTRF 262
               PW+   ++ TAG  +  A  P+  ++ RLQ+  A H    TR    ++  L+    
Sbjct: 163 GEEAPWIHLISAATAGWATSTATNPIWLIKTRLQLDKAGH----TRQYKNSWDCLK---- 214

Query: 263 LGLAVHMVRAEGIASLYKGLT 283
                H+++ EG   LYKGL+
Sbjct: 215 -----HIIQKEGFFGLYKGLS 230

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 5/98 (5%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQ-IVDAKHIPFFTRDPGAYSALRGTRF---- 262
           PW+   A    G+       P D V+ RLQ  V        + +  +     G R     
Sbjct: 52  PWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRET 111

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
            G+  ++ + EG  SL+KGL   L    P   I  + Y
Sbjct: 112 FGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTY 149

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 23/155 (14%)

Query: 42  TAPMDTVKIRRQLQLA-SEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYV 93
           T P+  VK R QL  A +  KY       + V ++EG+  L+KG       +V     +V
Sbjct: 188 TNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQWV 247

Query: 94  LYGSLQ----------FGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLR 143
           LY  ++          FG  + +   + S  +           LA  V+S++TYP +++R
Sbjct: 248 LYEQMKHIIKQRSMEKFGNISEVE-KSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVR 306

Query: 144 TRL----VANRSAHFFSLRRQARVIWDTEGPAGFF 174
           TRL    + N    +  L +  RVI   EG A  +
Sbjct: 307 TRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMY 341

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 118/315 (37%), Gaps = 64/315 (20%)

Query: 42  TAPMDTVKIRRQLQL-ASEHKYH--------------GILH---TF---RTVAREEGVRA 80
           T P D VK R Q  +  + +K H              G+ H   TF     V R EG R+
Sbjct: 70  TCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRS 129

Query: 81  LWKGNVPASAMYVLYGSLQFGTYA---WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTY 137
           L+KG  P     +   S+ F TY     + +   + G       L   A AG  +S  T 
Sbjct: 130 LFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTATN 189

Query: 138 PLDLLRTRLVANRSAHFFSLRRQARVIWD-------TEGPAGFFRXXXXXXXXXXXXXXX 190
           P+ L++TRL  +++       ++ +  WD        EG  G ++               
Sbjct: 190 PIWLVKTRLQLDKAG----TTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQ 245

Query: 191 XXXXYETCTI----AADTYG-------------LPWLAAAASP-TAGLVSKAAVFPLDTV 232
                +   I    + + +G               W   + S   A  V+    +P + V
Sbjct: 246 WVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVV 305

Query: 233 RRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPT 292
           R RL+           + P     L+ T  +     +++ EG+AS+Y GLT  L ++ P 
Sbjct: 306 RTRLR-----------QAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPN 354

Query: 293 TVITLWVYQRCLRLL 307
           ++I    ++  +RLL
Sbjct: 355 SIIMFGTWELVIRLL 369

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 36/101 (35%), Gaps = 8/101 (7%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQ--------IVDAKHIPFFTRDPGAYSALRG 259
           PW+   A    G+       P D V+ RLQ           AK I     +  A      
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHF 111

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
               G+  ++ R EG  SL+KGL   L    P   I  + Y
Sbjct: 112 KETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTY 152

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 106/286 (37%), Gaps = 44/286 (15%)

Query: 44  PMDTVKIRRQL-----QLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAM 91
           P+D +K R Q        A+      +L     ++  EG  ALWKG         PA A+
Sbjct: 37  PIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAV 96

Query: 92  YVLYGSLQFGTYAWLNTAAASAGLPP---QAHSLAVGALAGLVSSL----LTYPLDLLRT 144
           Y       F TY        S  + P   Q H     AL+G ++++    L  P D ++ 
Sbjct: 97  Y-------FATYEMCK----SRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQ 145

Query: 145 RLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTI---A 201
           RL  + S    S+ + A  ++  EG A FF                    YE+ T     
Sbjct: 146 RLQLHPSD---SMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNP 202

Query: 202 ADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR 261
           ++ Y  PW+       +G    A   PLD V+  LQI  A  +         +      R
Sbjct: 203 SNNYN-PWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSV-----QSQLFKEADTFR 256

Query: 262 FLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
               A+H  +  G +  ++GL   +  + P T I+   Y+    LL
Sbjct: 257 KAASAIH--KTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 77/207 (37%), Gaps = 30/207 (14%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRR-------QARVIWDTEG 169
           P  + LA GA AG++   + +P+D ++TR+ A  +    +  R       Q   I  TEG
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEG 75

Query: 170 PAGFFRXXXXXXXXXXXXXXXXXXXYETCT---IAADTYGL--PWLAAAASPTAGLVSKA 224
               ++                   YE C    I  +      P   A +   A + + A
Sbjct: 76  SLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADA 135

Query: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTM 284
            + P DT+++RLQ+  +  +                     AV M + EGIA+ +     
Sbjct: 136 LMNPFDTIKQRLQLHPSDSM------------------TKCAVRMYQREGIAAFFYSYPT 177

Query: 285 ALCKSTPTTVITLWVYQRCLRLLEPTR 311
            +  + P   +   +Y+   ++  P+ 
Sbjct: 178 TIAMNIPFAALNFVIYESSTKIFNPSN 204

>Scas_558.2
          Length = 289

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 17/141 (12%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEG----VRALWKGNVPASAMYVLYGSL 98
            P + +K R Q+     H  +    TFRT+ + E     +R L++G        + +  +
Sbjct: 118 VPAEVIKQRTQV-----HSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCI 172

Query: 99  QFGTYAWLNTAAA-----SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
           QF  Y ++    A        L P   ++  G++AG +++  T PLD L+TRL+ N+ + 
Sbjct: 173 QFPLYEFMKKEWALYDNEVGHLKPWKGAIC-GSIAGGIAAATTTPLDFLKTRLMLNKDS- 230

Query: 154 FFSLRRQARVIWDTEGPAGFF 174
              ++   R I+  EG   FF
Sbjct: 231 -IPIKSLIRNIYKEEGFKIFF 250

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           SL  GA AG  + L+ +P+D L+TRL A 
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAK 37

>Scas_721.27
          Length = 374

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 102/265 (38%), Gaps = 43/265 (16%)

Query: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYA---WLNTAAASAGLPPQAHSLAVGAL 127
            V + EG R+L+KG  P     +   S+ F TY     + + A + G       L   A 
Sbjct: 124 NVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAAT 183

Query: 128 AGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWD-------TEGPAGFFRXXX-- 178
           AG  +S  T P+ +++TR+  +++       R+ +  WD       +EG  G +R     
Sbjct: 184 AGWATSTATNPIWMIKTRVQLDKAG----TTRKYKNSWDCLKTVLKSEGIYGLYRGLSAS 239

Query: 179 --------------XXXXXXXXXXXXXXXXYETCTIAADTYGLP-WLAAAASP-TAGLVS 222
                                         +E     + T  +  W   + S   A  ++
Sbjct: 240 YLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIA 299

Query: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
               +P + VR RL     + +P     P     ++  R +      ++ EG+AS+Y GL
Sbjct: 300 SIVTYPHEVVRTRL-----RQMPMENGKPKYTGLVQSFRVI------IKEEGLASMYSGL 348

Query: 283 TMALCKSTPTTVITLWVYQRCLRLL 307
           T  L ++ P ++I    ++  +RLL
Sbjct: 349 TPHLMRTVPNSIIMFGTWELVIRLL 373

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 23/155 (14%)

Query: 42  TAPMDTVKIRRQLQLA-SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P+  +K R QL  A +  KY       +TV + EG+  L++G + AS +  + G LQ+
Sbjct: 192 TNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRG-LSASYLGSIEGILQW 250

Query: 101 GTYAWLN-----------------TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLR 143
             Y  +                  T + +  +           +A  ++S++TYP +++R
Sbjct: 251 LLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVR 310

Query: 144 TRL----VANRSAHFFSLRRQARVIWDTEGPAGFF 174
           TRL    + N    +  L +  RVI   EG A  +
Sbjct: 311 TRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMY 345

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 42  TAPMDTVKIR-RQLQLAS-EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           T P + V+ R RQ+ + + + KY G++ +FR + +EEG+ +++ G  P     V    + 
Sbjct: 303 TYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIM 362

Query: 100 FGTY 103
           FGT+
Sbjct: 363 FGTW 366

>Scas_379.2
          Length = 301

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/200 (19%), Positives = 71/200 (35%), Gaps = 23/200 (11%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRX 176
           P +H L  GA AG++   + +P+D L+TR+ +  +    ++  Q   I   EG    ++ 
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKG 81

Query: 177 XXXXXXXXXXXXXXXXXXYE-TCTIAADTYGL----PWLAAAASPTAGLVSKAAVFPLDT 231
                             YE T     D   +    P   A +   A + + A + P DT
Sbjct: 82  VQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDT 141

Query: 232 VRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP 291
           +++R+Q+                     T    +   + + EG ++ Y      L  + P
Sbjct: 142 LKQRMQLN------------------TNTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIP 183

Query: 292 TTVITLWVYQRCLRLLEPTR 311
                  +Y+   +   PT 
Sbjct: 184 FAAFNFMIYESATKFFNPTN 203

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 23/145 (15%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT+K R QL   +      + +  + + + EG  A +       AM + + +  F  Y
Sbjct: 138 PFDTLKQRMQLNTNTT-----VWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIY 192

Query: 104 A----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSL-- 157
                + N    +    P  H L+ G L+G   + +T PLD ++T L   R +   SL  
Sbjct: 193 ESATKFFN---PTNDYNPLVHCLS-GGLSGATCAAITTPLDCIKTVLQV-RGSESVSLQV 247

Query: 158 -------RRQARVIWDTEGPAGFFR 175
                  ++  + I+   G  GF+R
Sbjct: 248 MKEANTFQKATKAIYQVHGAKGFWR 272

>Scas_582.7
          Length = 329

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 74/202 (36%), Gaps = 25/202 (12%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAG 172
           P +H L  GA AG++     +P+D L+TR+ +  +        S+ +Q   I   EG   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYE--TCTIAADTY---GLPWLAAAASPTAGLVSKAAVF 227
            ++                   YE     +  D+      P   A +  TA + S   + 
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFMN 154

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC 287
           P DT+++R+QI D                L+  +   +A  +   EG+++ Y      + 
Sbjct: 155 PFDTIKQRMQISD----------------LKKEKVYNVAKKIYNLEGLSAFYYSYPTTIA 198

Query: 288 KSTPTTVITLWVYQRCLRLLEP 309
            + P       +Y+   +   P
Sbjct: 199 MNIPFAAFNFMIYESASKFFNP 220

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 104/292 (35%), Gaps = 49/292 (16%)

Query: 44  PMDTVKIRRQ--LQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVL 94
           P+D +K R Q      +E     I+     ++  EG  ALWKG         PA A+Y  
Sbjct: 56  PIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVY-- 113

Query: 95  YGSLQFGTYAWLNTAAASAGLPPQAH-------SLAV-GALAGLVSSLLTYPLDLLRTRL 146
                F TY +       A L P +         +AV GA A + S     P D ++ R+
Sbjct: 114 -----FATYEF-----TKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRM 163

Query: 147 VANRSAHFFSLRRQ-----ARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA 201
                     L+++     A+ I++ EG + F+                    YE+ +  
Sbjct: 164 ------QISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKF 217

Query: 202 ADT--YGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
            +   +  P +       +G ++ A   PLD ++  +QI  +  +             + 
Sbjct: 218 FNPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMK-------KA 270

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTR 311
             F      ++   G    ++GL   +  + P T I+   Y+     L  TR
Sbjct: 271 NTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFLFSTR 322

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 9/139 (6%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+  +K R   +  S+     +L   R + + +GV+ LWKG VPA  + V  G+L F 
Sbjct: 128 TNPLWVIKTRMMSKANSDLTSMKVL---RDLIKNDGVQGLWKGLVPA-LVGVSQGALHFT 183

Query: 102 TYAWLNTAAA----SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR-SAHFFS 156
            Y  L          +       ++AV +++ ++S+   YP  LL++ L + + S + F 
Sbjct: 184 CYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQASENDFK 243

Query: 157 LRRQARVIWDTEGPAGFFR 175
           L   +++I+   G  GF++
Sbjct: 244 LLPLSKMIYSRSGLLGFYK 262

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 113/275 (41%), Gaps = 34/275 (12%)

Query: 44  PMDTVKIRRQLQLASEHK------YHGILHTFRTVARE--EGVRALWKGNVPASAMYVLY 95
           P+D  K+R QL + S  K      +  I+ +  ++ RE   G+     GN  A  +Y  +
Sbjct: 28  PLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRGLTVNLVGNTIAWGLY--F 85

Query: 96  GSLQFGTYAWLNTA---AASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
            S +      +N          L    + L+  A +G+++++LT PL +++TR+++  ++
Sbjct: 86  ASYRVAKDYLINYNHRIRNDKDLSSWMY-LSASASSGMLTTVLTNPLWVIKTRMMSKANS 144

Query: 153 HFFSLRRQARVIWDTEGPAGFFR----XXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP 208
              S++    +I   +G  G ++                       ++      D+  + 
Sbjct: 145 DLTSMKVLRDLI-KNDGVQGLWKGLVPALVGVSQGALHFTCYDTLKHKLVLKNRDSDEIT 203

Query: 209 WLAA-AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
            L   A +  + ++S +AV+P   ++  LQ   A    F              + L L+ 
Sbjct: 204 NLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQASENDF--------------KLLPLSK 249

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
            +    G+   YKGL+  L +S P+T IT  +Y+ 
Sbjct: 250 MIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYEN 284

>Scas_662.12
          Length = 308

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 73/155 (47%), Gaps = 29/155 (18%)

Query: 42  TAPMDTVKIRRQLQLASEHK--YHGILHTFRTVAREEGVRALWKGNVPA-------SAMY 92
           T P+  +K  R +  +  HK  Y  I H F+++  +EG +A+W G +P+       +  +
Sbjct: 135 TNPLWVIK-TRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLLGVSQGAIYF 193

Query: 93  VLYGSLQFGTYAWLNTAA---ASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           ++Y +L+      LN +    A+A L      + + +L+ ++S +  YP  LL++ L   
Sbjct: 194 MIYDNLKLHFNVNLNKSKKDNANANLKI----VLISSLSKMLSVMSVYPFQLLKSNLQTF 249

Query: 150 RSA---------HFFSLRRQARVIWDTEGPAGFFR 175
           RS          HF +L R+   I+   G  G ++
Sbjct: 250 RSVTNNIPQNDYHFITLIRK---IYRDNGIKGLYK 281

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 77/195 (39%), Gaps = 26/195 (13%)

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRLVANRSAH---FFSLRRQARVIWDTEGPAGFFRXXX 178
           L  G ++G+ ++LLT PL +++TR+++    H   + S+R   + +   EGP   +    
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIW-MGL 179

Query: 179 XXXXXXXXXXXXXXXXYETCTI---------AADTYGLPWLAAAASPTAGLVSKAAVFPL 229
                           Y+   +           D           S  + ++S  +V+P 
Sbjct: 180 LPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPF 239

Query: 230 DTVRRRLQIVDA--KHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC 287
             ++  LQ   +   +IP                F+ L   + R  GI  LYKGL+  L 
Sbjct: 240 QLLKSNLQTFRSVTNNIP-----------QNDYHFITLIRKIYRDNGIKGLYKGLSANLL 288

Query: 288 KSTPTTVITLWVYQR 302
           ++ P+T IT  +Y+ 
Sbjct: 289 RAIPSTCITFCIYEN 303

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 72/166 (43%), Gaps = 35/166 (21%)

Query: 44  PMDTVKIRRQLQ-------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           P + +K R QLQ         S + Y  + +  +TV +EEG R+L+ G     A  + + 
Sbjct: 168 PSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFS 227

Query: 97  SLQFGTYAWLNTAA-------ASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL--- 146
           +LQF  Y      A          G     + +  GA AG ++ ++T P+D+++TR+   
Sbjct: 228 ALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQ 287

Query: 147 ----VANRS-----AHFFSLRRQA---------RVIWDTEGPAGFF 174
                +N+S      H  + R  A         R ++ +EG  GFF
Sbjct: 288 QPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFF 333

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 3/104 (2%)

Query: 45  MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV-RALWKGNVPASAMYVLYGSLQFGTY 103
           +DTVK R+Q    +  KY  ++  +RT+  EEGV R L+ G + A        ++ FGTY
Sbjct: 74  LDTVKTRQQ-GAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTY 132

Query: 104 AWLN-TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
            +   T      +      L+ G L   +SS +  P ++L+TRL
Sbjct: 133 EYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRL 176

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 73/206 (35%), Gaps = 21/206 (10%)

Query: 111 ASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLV-ANRSAHFFSLRRQARVIWDTEG 169
           +   L P  H +  G + G +     + LD ++TR   A     + ++    R IW  EG
Sbjct: 46  SDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEG 105

Query: 170 PA-GFFRXXXXXXXXXXXXXXXXXXXYETC--TIAADTYGLPWLAA------AASPTAGL 220
              G +                    YE    T+  D     W         +A      
Sbjct: 106 VRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIED-----WQINDTITHLSAGFLGDF 160

Query: 221 VSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYK 280
           +S     P + ++ RLQ+    + PFF +    YS LR          +++ EG  SL+ 
Sbjct: 161 ISSFVYVPSEVLKTRLQLQGRFNNPFF-QSGYNYSNLRNA-----IKTVIKEEGFRSLFF 214

Query: 281 GLTMALCKSTPTTVITLWVYQRCLRL 306
           G    L +  P + +    Y++  +L
Sbjct: 215 GYKATLARDLPFSALQFAFYEKFRQL 240

>Kwal_23.4354
          Length = 343

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 97/268 (36%), Gaps = 30/268 (11%)

Query: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH 120
           +Y+     F  +A+ EGV++LW+G      M      + F  Y  L   +      P  +
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRLQDKYPTLN 142

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRL--------VANRSAHFFSLRRQARVIWDTEGPAG 172
            L  GALA ++++    PL+L RTRL         +  +     L +++R      G   
Sbjct: 143 PLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKA 202

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYE--TCTIAADTY-------GLPWLAAAAS----PTAG 219
            FR                   YE     ++ D+           W     S       G
Sbjct: 203 LFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGG 262

Query: 220 LVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLY 279
            V+     P D  + R+QI          + P         ++L     M ++EG+A+LY
Sbjct: 263 AVAAVLTHPFDVGKTRMQITYLNST--LEKKPSK----NMFKYLN---QMRKSEGLAALY 313

Query: 280 KGLTMALCKSTPTTVITLWVYQRCLRLL 307
            GL   + K  P+  I +  Y+ C RL 
Sbjct: 314 TGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>Kwal_23.3042
          Length = 542

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 15/120 (12%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVL-YGSLQF 100
           P+DT+K R Q   L +E K   +L  T + + +E G+R  ++G +    M +  Y ++  
Sbjct: 364 PIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRG-ITVGIMGIFPYAAMDL 422

Query: 101 GTYAWLNT-----AAASAGLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVAN 149
           GT++ L        A   GLP    +++      +GA +G V +   YP++LLRTRL A 
Sbjct: 423 GTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQ 482

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 103/260 (39%), Gaps = 38/260 (14%)

Query: 71  TVAREEGVRALWKGNVPASAMYVLYGS-LQFGTY-------AWLNTAAASAGLPPQAHSL 122
           T+ R+ G+RA + GN   +AM V   S ++FG++       A L     +AGL   +  L
Sbjct: 291 TLYRQGGIRAFYVGN-GLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYL 349

Query: 123 AVGALAGLVSSLLTYPLDLLRTRL----VANRSAHFFSLRRQARVIWDTEGPAGFFRXXX 178
           A G L G+++ L  YP+D L+ R+    +   S     L   A+ ++   G   F+R   
Sbjct: 350 A-GGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGIT 408

Query: 179 XXXXXXXXXXXXXXXXYETCT---IA--ADTYGLPWLAAAASPT--------AGLVSKAA 225
                           +       IA  A   GLP      S          +G V   A
Sbjct: 409 VGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATA 468

Query: 226 VFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285
           V+P++ +R RLQ         F   P  Y+  R      + +  V+ EG   L+KGL   
Sbjct: 469 VYPVNLLRTRLQAQGT-----FAH-PHRYNGFR-----DVLLKTVQREGYQGLFKGLVPN 517

Query: 286 LCKSTPTTVITLWVYQRCLR 305
           L K  P   I+   Y+   R
Sbjct: 518 LAKVCPAVSISYLCYENLKR 537

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 44  PMDTVKIRRQLQ--LASEHKYHGILHTFRTVAREEGVRALWKGNVP--------ASAMYV 93
           P++ ++ R Q Q   A  H+Y+G         + EG + L+KG VP         S  Y+
Sbjct: 471 PVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSISYL 530

Query: 94  LYGSLQFG 101
            Y +L+ G
Sbjct: 531 CYENLKRG 538

>Kwal_33.15597
          Length = 305

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 10/113 (8%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +F+ +   EG  AL  G  P    Y L GS +FG Y
Sbjct: 33  PIDVVKTRIQLEPTVYNK--GMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 104 A-----WLNTAAASAGLPPQAHSLAVG--ALAGLVSSLLTYPLDLLRTRLVAN 149
                 +++T      +  + +S+ +G  A+A   + +   PL+  R RLV+ 
Sbjct: 91  EVFKKLFIDTLGYDQAVNYK-NSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
           +++ EG++S Y G T  L K  P  +    V++R
Sbjct: 156 ILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFER 189

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E KY+GI H  RT+ +EE  R+ +KG        VL  S QF
Sbjct: 745 TTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKG----GGARVLRSSPQF 800

Query: 101 G 101
           G
Sbjct: 801 G 801

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 31/125 (24%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRT---VAREEGVRALWKG-------NVPASAM 91
           T P++ VKIR  LQ+ S++    I     T   + ++ G+R L+ G       +VP SA+
Sbjct: 642 TNPLEIVKIR--LQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAI 699

Query: 92  YVLYGSLQFGTYAWLNTAAASAGLPPQAHS----------LAVGALAGLVSSLLTYPLDL 141
           Y       F TYA L          P   +          L  GA+AG+ ++ LT P D+
Sbjct: 700 Y-------FPTYAHLKKDLFD--FDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDV 750

Query: 142 LRTRL 146
           ++TRL
Sbjct: 751 IKTRL 755

 Score = 35.0 bits (79), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 24/32 (75%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           ++ ++G++AG + + + YP+D ++TR+ A RS
Sbjct: 532 YNFSLGSIAGCIGATVVYPIDFIKTRMQAQRS 563

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 12/93 (12%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W    A   AG+ +     P D ++ RLQI   K     T+  G + A+R          
Sbjct: 728 WELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE---TKYNGIFHAIRT--------- 775

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           +++ E   S +KG    + +S+P    TL  Y+
Sbjct: 776 ILKEESFRSFFKGGGARVLRSSPQFGFTLAAYE 808

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +F+ +   EG  AL  G  P    Y L GS +FG Y
Sbjct: 33  PIDVVKTRIQLEPTVYNK--GMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 104 AWLNTAAASAGLPPQA----HSLAVG--ALAGLVSSLLTYPLDLLRTRLVAN 149
                         QA    +S+ +G  A+A   + +   PL+  R RLV+ 
Sbjct: 91  EVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ 142

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 52/118 (44%), Gaps = 13/118 (11%)

Query: 44  PMDTVKIRRQLQLASEHKY-HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P++  +IR    L S+  + +G++  F  + +EEG  + + G  P     + Y   +F  
Sbjct: 131 PLEATRIR----LVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLV 186

Query: 103 Y-----AWLNTAAASAGLPPQAH---SLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           +      +   A     L   +    +L  G  AGL +++++ P D L +++   + A
Sbjct: 187 FERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKA 244

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 5/109 (4%)

Query: 43  APMDTVKIRRQLQLASEHKY----HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSL 98
           AP+D +KI  Q       KY     G+L+    +   + +R +++G+         Y ++
Sbjct: 72  APLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIFPYAAV 131

Query: 99  QFGTYAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +F  Y  + N    S         L  G+LAGL S   TYPLDL+R RL
Sbjct: 132 KFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRL 180

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 16/97 (16%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLG---L 265
           W    A   AG+ S+ A +P + +RRRLQ+             GA +     +F     +
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQV-------------GAVTNPLEHKFTSMSEM 337

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
           A  +    G    + GL++   K TP    + +VY+R
Sbjct: 338 AKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYER 374

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRL----VANRSAH-FFSLRRQARVIWDTEGPAGFF 174
            L  G LAG+ S    YP +++R RL    V N   H F S+   A++I+   G  GFF
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFF 351

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 43/129 (33%), Gaps = 11/129 (8%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAH-------FFSLRRQARVIWDTEGPAGFFRXX 177
           G +AG  +  L  PLD ++  L    + H       F  L      IW  +   G F+  
Sbjct: 60  GGVAGSCAKTLIAPLDRIKI-LFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGH 118

Query: 178 XXXXXXXXXXXXXXXXXYE---TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRR 234
                            YE      I +  Y   +    +   AGL S    +PLD +R 
Sbjct: 119 SATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRV 178

Query: 235 RLQIVDAKH 243
           RL  V   H
Sbjct: 179 RLAYVTEHH 187

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 105/284 (36%), Gaps = 28/284 (9%)

Query: 44  PMDTVKIRRQL---QLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           P+DT+K+R Q+    + S  K  G + T   + R EG  A +KG            +++F
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 101 GTYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLL-RTRLVANR------S 151
            +Y +  T  A    G     ++   G  AG+  +++      + + RL A        +
Sbjct: 90  SSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGA 149

Query: 152 AHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYG----L 207
             + +  +    I   EG +  +R                   Y         Y     L
Sbjct: 150 PKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEML 209

Query: 208 P-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLA 266
           P W  +     +G +   +  PLDT++ RLQ           +D    +     R   + 
Sbjct: 210 PSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-----------KDKSTKNMSGLKRITIIG 258

Query: 267 VHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPT 310
             +++ EG  +LYKG+T  + +  P   +T   Y+   + LE T
Sbjct: 259 KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELEKT 302

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
           P +   A   AGL+      PLDT++ R+QI        +    G  S ++   F+    
Sbjct: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI--------YKNAVG--SGVKAPGFIKTGG 59

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            + R EG  + YKGL   +   TP   I    Y+
Sbjct: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 42  TAPMDTVKIRRQLQLASEH--KYHGILHTFRTVAREEGVRALWKGNVP 87
            AP+DT+K R Q   ++++      I    + + +EEG RAL+KG  P
Sbjct: 229 NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 79/203 (38%), Gaps = 25/203 (12%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLR-----RQARVIWDTEGPAGF 173
           A +L  G  AGL+  L  +PLD ++ R+   ++A    ++     +    I+  EG   F
Sbjct: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETC-TIAAD------TYGLPWLAAAASPTAGLVSKAAV 226
           ++                   YE   T+ AD      + G  ++A      AG+     V
Sbjct: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVG---AGITEAVVV 127

Query: 227 FPLDTVRR-RLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285
                V + RLQ   A+H+      P   +A++          +V+ EG ++LY+G+++ 
Sbjct: 128 VNPMEVVKIRLQ---AQHLNPVEGAPKYKNAVQA------CYTIVKEEGFSALYRGVSLT 178

Query: 286 LCKSTPTTVITLWVYQRCLRLLE 308
             +          VY +    L+
Sbjct: 179 AARQATNQGANFTVYSKLKEFLQ 201

>Scas_697.47
          Length = 328

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 19/145 (13%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVL 94
           TAP + +K+   LQ A  +     +   + + ++ GV++L+KG++       P SA+Y  
Sbjct: 158 TAPTERIKV--VLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALY-- 213

Query: 95  YGSLQFGTYAWLN----TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR 150
           + S +  +  +LN    TA +  G    A+    G +AG+   L+ +P+D ++T+L ++ 
Sbjct: 214 FASYEI-SKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSS 272

Query: 151 SAHFFSLRRQARVIWDTEGP-AGFF 174
            +   S+    R I+   G   GFF
Sbjct: 273 GSQ--SMVAATREIYVKRGGIKGFF 295

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 94/275 (34%), Gaps = 38/275 (13%)

Query: 44  PMDTVKIRRQLQLASE--HKYHGILHTFRTVAREE----GVRALWKGNVP-----ASAMY 92
           P D +K+R Q   AS   H    IL   R +         V+  +KG +P          
Sbjct: 56  PFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFA 115

Query: 93  VLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           V +     G      + ++SA L       A G ++ + ++L+T P + ++  L    + 
Sbjct: 116 VSFWGYDVGKKIVTRSDSSSAQLT-MGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGAN 174

Query: 153 HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETC--------TIAADT 204
              S    A+ I    G    F+                   YE            A   
Sbjct: 175 SKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESK 234

Query: 205 YGLPWLAAA--ASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRF 262
            G   +A    A   AG+     VFP+DT++ +LQ              G+ S +  TR 
Sbjct: 235 TGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ-----------SSSGSQSMVAATRE 283

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITL 297
           +      V+  GI   + GL  AL +S P    T 
Sbjct: 284 I-----YVKRGGIKGFFPGLGPALLRSFPANAATF 313

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
           T F+G A ++V+  G+ SL+KG    L +  P + +    Y+   + L 
Sbjct: 177 TSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLN 225

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 8/111 (7%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +F+ +   EG  AL  G  P    Y L GS +FG Y
Sbjct: 33  PIDVVKTRIQLEPTVYNK--GMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 104 AWLNTAAASAGLPPQA----HSLAVG--ALAGLVSSLLTYPLDLLRTRLVA 148
                 A        A    +++ +G  A+A   + +   PL+  R RLV+
Sbjct: 91  ELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVS 141

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 109/293 (37%), Gaps = 49/293 (16%)

Query: 44  PMDTVKIRRQLQLASEHKYH-GILHTFRTVAREE-------------GVRALWKGNVPAS 89
           P+D +K+R QL   S  K H G     + + R               G+     GN  A 
Sbjct: 29  PLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINLFGNAIAW 88

Query: 90  AMYV-LYGSLQFGTYAWL----NTAAASAGLPPQAHSL---AVGALAGLVSSLLTYPLDL 141
            +Y  LYG  +   Y  +     T     G   + +SL   + GA +GL++++LT P+ +
Sbjct: 89  GVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNPIWV 148

Query: 142 LRTRLVANR---SAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETC 198
           ++TR+++        + S+    + +  T+G  G ++                   Y+T 
Sbjct: 149 IKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVSQGALYFAV-YDTL 207

Query: 199 T---------IAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTR 249
                        D +         +    +VS   V+P   ++  LQ   A    F   
Sbjct: 208 KQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKF--- 264

Query: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
                      R   L   ++  +G   LYKGL+  L ++ P+T IT  VY+ 
Sbjct: 265 -----------RLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYEN 306

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 63/147 (42%), Gaps = 18/147 (12%)

Query: 42  TAPMDTVKIR-----RQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           T P+  +K R     +  Q A    Y+G+    RT    +G + LWKG VPA    V  G
Sbjct: 143 TNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRT----DGFQGLWKGLVPA-LFGVSQG 197

Query: 97  SLQFGTYAWLNTAAA----SAGLP---PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           +L F  Y  L           GL        ++ + +L  +VS  L YP  LL++ L + 
Sbjct: 198 ALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSF 257

Query: 150 R-SAHFFSLRRQARVIWDTEGPAGFFR 175
           R +   F L    ++I   +G  G ++
Sbjct: 258 RANEQKFRLFPLIKLIIANDGFVGLYK 284

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           P    +  G  AG V++L+ +PLDLL+ RL
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRL 37

>Scas_602.8
          Length = 885

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQL-ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q++    E +Y GILH  RT+ +EE  R+ +KG     A  V+  S QF
Sbjct: 713 TTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKG----GAARVMRSSPQF 768

Query: 101 G 101
           G
Sbjct: 769 G 769

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 58/126 (46%), Gaps = 33/126 (26%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGI----LHTFRTVAREEGVRALWKG-------NVPASA 90
           T P++ VKIR  LQ+ SE+    I    L  F+ + +E  +  L+KG       +VP SA
Sbjct: 610 TNPLEIVKIR--LQVKSEYTNAMIPKSQLTAFQII-KELKLIGLYKGVGACLLRDVPFSA 666

Query: 91  MYVLYGSLQFGTYAWLNTAAASAGLPPQAHS----------LAVGALAGLVSSLLTYPLD 140
           +Y       F TYA L          P              L  GALAG+ ++ LT P D
Sbjct: 667 IY-------FPTYAHLKKNVFQ--FDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFD 717

Query: 141 LLRTRL 146
           +++TRL
Sbjct: 718 VIKTRL 723

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 23/31 (74%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           + ++G++AG + + L YP+D ++TR+ A RS
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRS 531

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 101/282 (35%), Gaps = 47/282 (16%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+D +K R Q Q  S  KY   +     +  +EG+R L+ G         P  A+     
Sbjct: 518 PIDFIKTRMQAQ-RSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAI----- 571

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTR----------L 146
            L    +   +       L   A  L+ GA AG    + T PL++++ R          +
Sbjct: 572 KLTVNDFMRKSLVDKKGNLQLGAEVLS-GATAGACQVVFTNPLEIVKIRLQVKSEYTNAM 630

Query: 147 VANRSAHFFSLRRQARVIWDTEGP-AGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY 205
           +       F + ++ ++I   +G  A   R                   ++      D  
Sbjct: 631 IPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKR 690

Query: 206 G--LPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFL 263
                W    A   AG+ +     P D ++ RLQI           +PG    +  TR+ 
Sbjct: 691 DRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQI-----------EPG----VGETRYT 735

Query: 264 GLAVHMVR----AEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           G+ +H VR     E   S +KG    + +S+P    TL  Y+
Sbjct: 736 GI-LHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYE 776

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 69/149 (46%), Gaps = 19/149 (12%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHG-ILHTFRT---VAREEGVRALWKG-------NVPASA 90
           T P++ VKIR  LQ+ SE  Y G +L +  T   V ++ G++ L+KG       +VP SA
Sbjct: 630 TNPLEVVKIR--LQVRSE--YAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSA 685

Query: 91  MYV-LYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           +Y   Y  L+   + +                L  G LAG+ ++ LT P D+++TRL  +
Sbjct: 686 IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID 745

Query: 150 ---RSAHFFSLRRQARVIWDTEGPAGFFR 175
                  +  +   AR I   E    FF+
Sbjct: 746 PRKGETRYEGIFHAARTILKEESFKSFFK 774

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E +Y GI H  RT+ +EE  ++ +KG     +  VL  S QF
Sbjct: 732 TTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKG----GSARVLRSSPQF 787

Query: 101 G 101
           G
Sbjct: 788 G 788

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 71/193 (36%), Gaps = 33/193 (17%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRS-----------AHFFSLRRQARVIWDTE 168
           ++  +G++AG + + + YP+DL++TR+ A RS           A  FS R   R I+   
Sbjct: 520 YNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFS-REGIRGIYSGL 578

Query: 169 GPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS-PTAGLVSKAAVF 227
           GP                        Y    +      L W     S   AG        
Sbjct: 579 GPQ-------LIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEILSGACAGACQVVFTN 631

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC 287
           PL+ V+ RLQ+          R   A   L+       A+ +++  GI  LYKG+   L 
Sbjct: 632 PLEVVKIRLQV----------RSEYAGDVLKSQ---VTALGVIKQLGIKGLYKGIAACLM 678

Query: 288 KSTPTTVITLWVY 300
           +  P + I    Y
Sbjct: 679 RDVPFSAIYFPTY 691

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 95/279 (34%), Gaps = 42/279 (15%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+D VK R Q Q  S  +Y   +  F  +   EG+R ++ G         P  A+     
Sbjct: 538 PIDLVKTRMQAQ-RSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAI----- 591

Query: 97  SLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
            L    Y         A L      L+ GA AG    + T PL++++ RL          
Sbjct: 592 KLTVNDYMRGRLMDKHANLKWYFEILS-GACAGACQVVFTNPLEVVKIRLQVRSEYAGDV 650

Query: 157 LRRQARV--IWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP------ 208
           L+ Q     +    G  G ++                   Y    +  D +         
Sbjct: 651 LKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTY--AHLKKDVFKYDPKDKKQ 708

Query: 209 ------WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRF 262
                 W    A   AG+ +     P D ++ RLQI   K     TR  G + A R    
Sbjct: 709 RNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGE---TRYEGIFHAART--- 762

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
                 +++ E   S +KG +  + +S+P    TL  Y+
Sbjct: 763 ------ILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

>Scas_645.9
          Length = 391

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
           S  +++G L  F  + + EG+  LW+G      M +    + F  Y +L   +  A   P
Sbjct: 125 SSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSSP 184

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
             + L  GA+A ++++    PL+LL+T+L
Sbjct: 185 TFNPLMCGAIARILAASTVAPLELLKTKL 213

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 81  LWKGNVPASAMYVLYGSLQF-GTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPL 139
           LW+ +VP SA+Y  +GS +F  T+ W++T+ + + L    +S   G+++G +++L+T+P 
Sbjct: 257 LWR-DVPFSAIY--WGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPF 313

Query: 140 DLLRTR 145
           D+ +TR
Sbjct: 314 DVGKTR 319

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 79/189 (41%), Gaps = 12/189 (6%)

Query: 115 LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVA-NRSAHFFSLRRQARVIWDTEGPAGF 173
           LP  A+ LA G+ +G+ +++LT P+ +++TR++A +R+  + S       ++ TEG   F
Sbjct: 111 LPAHAYMLAAGS-SGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAF 169

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVR 233
           +R                           DT    +L ++       +S + +  +  + 
Sbjct: 170 WRGVVPSLLGVSQGAIYFALY--------DTLKFHYLHSSTDKAERRLSVSEIIGITCIS 221

Query: 234 RRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTT 293
           + + +               + A  G   L   V+    EGI   Y+GL+  L ++ P T
Sbjct: 222 KMISVTSVYPFQLLKSKLQDFGAPSGITQLVQTVY--SREGIRGFYRGLSANLLRAVPAT 279

Query: 294 VITLWVYQR 302
            IT +VY+ 
Sbjct: 280 CITFFVYEN 288

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 56/120 (46%), Gaps = 13/120 (10%)

Query: 62  YHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHS 121
           + G+   ++T    EGV A W+G VP S + V  G++ F  Y  L      +        
Sbjct: 154 FDGVYKLYQT----EGVLAFWRGVVP-SLLGVSQGAIYFALYDTLKFHYLHSSTDKAERR 208

Query: 122 LAVGALAGL--VSSLLT----YPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           L+V  + G+  +S +++    YP  LL+++L    +     + +  + ++  EG  GF+R
Sbjct: 209 LSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAPS--GITQLVQTVYSREGIRGFYR 266

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 59/142 (41%), Gaps = 13/142 (9%)

Query: 44  PMDTVKIRRQ----LQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           P D V IR Q    L       Y         +   EGV  L+ G  P     +L  S Q
Sbjct: 120 PADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQ 179

Query: 100 FGTYAWL-NTAAASAGLPPQAHS--LAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
             TY    N    + GL     S   A   LAGLV++ +  P D+++TR++   +AH  S
Sbjct: 180 VVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVM---NAHKHS 236

Query: 157 LRRQARVIWD---TEGPAGFFR 175
                R++ D    EGP+  FR
Sbjct: 237 HDSAVRILLDAVKQEGPSFMFR 258

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 103/275 (37%), Gaps = 34/275 (12%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D  K+R Q   A +     ++     + R EGV  L+ G   A      Y + +FG
Sbjct: 26  THPLDLAKVRLQTAPAPKPT---LVRMASQILRNEGVPGLYSGLTAAILRQCTYTTARFG 82

Query: 102 TYAWLNTA-AASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQ 160
            Y ++         L    + L     +G V  L+  P D++  R+  N S+    LRR 
Sbjct: 83  VYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRM-QNDSSLPAELRRN 141

Query: 161 AR-------VIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETC-TIAADTYGLPWLAA 212
            +        I   EG A  F                    Y+          GL     
Sbjct: 142 YKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYLVQNVGLDKDNK 201

Query: 213 ----AASPTAGLVSKAAVFPLDTVRRRLQIVDA-KHIPFFTRDPGAYSALRGTRFLGLAV 267
               A+S  AGLV+     P D ++ R  +++A KH    + D    SA+R      + +
Sbjct: 202 STHFASSLLAGLVATTVCSPADVIKTR--VMNAHKH----SHD----SAVR------ILL 245

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
             V+ EG + +++G   +  +  P T++     ++
Sbjct: 246 DAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQ 280

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 34/84 (40%), Gaps = 16/84 (19%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
            G+V+  A  PLD  + RLQ   A   P   R               +A  ++R EG+  
Sbjct: 18  GGIVACVATHPLDLAKVRLQTAPAPK-PTLVR---------------MASQILRNEGVPG 61

Query: 278 LYKGLTMALCKSTPTTVITLWVYQ 301
           LY GLT A+ +    T     VY 
Sbjct: 62  LYSGLTAAILRQCTYTTARFGVYD 85

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFF 174
           G   G+V+ + T+PLDL + RL     A   +L R A  I   EG  G +
Sbjct: 15  GGFGGIVACVATHPLDLAKVRL-QTAPAPKPTLVRMASQILRNEGVPGLY 63

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 44  PMDTVKIRRQLQLASEHKYH-GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P+D VK R QL+     KY  G++ +FR +  EEG  AL  G  P    Y + G+ +FG 
Sbjct: 35  PIDVVKTRIQLE---PLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGG 91

Query: 103 YAWLNTAAASA-GLPPQAH-----SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           Y     A   A G            +   A+A   + +   PL+  R RLV+ 
Sbjct: 92  YEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQ 144

>Kwal_23.5757
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK RRQ+  AS +K +  L  +R + R EG   ++ G    +  Y L G+ ++G Y
Sbjct: 39  PLDLVKCRRQVD-ASLYKSN--LDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95

Query: 104 AWLNTAAASAGLPPQAHS------LAVGALAGLVSSLLTYPLDLLRTR 145
            +     +    P  AHS      LA  A A  ++ +   P + ++ R
Sbjct: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR 143

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 14/95 (14%)

Query: 213 AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRA 272
           AAS +A  ++   + P + ++ R Q   A   PF      AYS             MV A
Sbjct: 121 AASASAEFIADIFLCPWEAIKVRQQ--TAVPPPFARNVFDAYS------------KMVGA 166

Query: 273 EGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           EG ASLYKG+T    +  P T+     ++R + ++
Sbjct: 167 EGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI 201

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 10/130 (7%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
            P + +K+R+Q  +        +   +  +   EG  +L+KG  P     + Y   +F +
Sbjct: 135 CPWEAIKVRQQTAVPPPFA-RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTS 193

Query: 103 --------YAWLNTAAAS-AGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
                   YA L T     + L   + S A G LAG++ +++++P D++ +++   R + 
Sbjct: 194 FERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG 253

Query: 154 FFSLRRQARV 163
             +L+  +R+
Sbjct: 254 ESTLQATSRI 263

>Kwal_33.15446
          Length = 305

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 6/138 (4%)

Query: 43  APMDTVKIRRQLQL-ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           AP++  K + Q+Q  A   +Y G L   + V   +G+R ++KG V ++ ++  +    +G
Sbjct: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLV-STLIFRTHFVYWWG 193

Query: 102 TYAWLNT-AAASAGLPPQAHSLAVGALAGLVSSLLT-YPLDLLRTRLVANR--SAHFFSL 157
           +Y  L     A+  L   A +   G  +       T YP D+++  ++ N        S 
Sbjct: 194 SYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSW 253

Query: 158 RRQARVIWDTEGPAGFFR 175
           R  A  IW T G  GFF+
Sbjct: 254 RNAASDIWRTRGIRGFFK 271

>Scas_328.1
          Length = 227

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 9/101 (8%)

Query: 52  RQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY-----AWL 106
           + ++  +  K++GIL  ++     +GV  L++G +P+    ++Y  L FG Y       L
Sbjct: 69  KSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLL 128

Query: 107 NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLV 147
             +  +A LP    S  +G    + +S  +YPLD +R R++
Sbjct: 129 TGSFENAFLP----SFLLGWAVTISASTTSYPLDTVRRRMM 165

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYG 96
           P+DTV+ R  +      KY G +  F+ +  +EGV +L+KG        V A+ +  LY 
Sbjct: 156 PLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGVISLYD 215

Query: 97  SLQ 99
            LQ
Sbjct: 216 QLQ 218

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 13/55 (23%)

Query: 227 FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           +PLDTVRRR+ +   + + +     GA    +          +V  EG+ SL+KG
Sbjct: 155 YPLDTVRRRMMMTSGQAVKY----KGAIDCFQ---------QIVSQEGVYSLFKG 196

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 8/112 (7%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +FR +  EEG  AL  G  P    Y + G+ +FG Y
Sbjct: 33  PIDVVKTRIQLEPTVYNK--GMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 104 A-----WLNTAA-ASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
                 +++T    +A     +  +   A A  ++ +   PL+  R RLV+ 
Sbjct: 91  EVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ 142

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRL 306
           +++ EG+ S Y G T  L K  P  +    V++R   L
Sbjct: 156 ILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEL 193

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 56/117 (47%), Gaps = 23/117 (19%)

Query: 44  PMDTVKIRRQLQLASEHKY-HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P++  +IR    L S+  + +G++  F  + +EEGV + + G  P     +L+  + +  
Sbjct: 131 PLEATRIR----LVSQPTFANGLVGGFSRILKEEGVGSFYSGFTP-----ILFKQIPYNI 181

Query: 103 YAWLNTAAAS----AGLPPQ---------AHSLAVGALAGLVSSLLTYPLDLLRTRL 146
             +L    AS    +  PP+         A +L  G  AGL +++++ P D L +++
Sbjct: 182 AKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKV 238

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFL----GL 265
           + A +   AG ++   V PLD  + RLQ    +     TR  G+ +   G ++     G 
Sbjct: 105 ITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGT 164

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303
              +VR E I  LYKG+   +    PT +I   VY+RC
Sbjct: 165 LTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERC 202

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 29/160 (18%)

Query: 42  TAPMDTVKIRRQLQLASEHK----YHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P+  VK R  LQ     K    Y   L  F  + + EG+++ + G +P S   +L+ +
Sbjct: 233 TNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIP-SLFGLLHVA 291

Query: 98  LQFGTYAWL--------------NTAAASAGLPPQ---AHSLAVGAL------AGLVSSL 134
           + F  Y  L               T   +    PQ   + +  +G L      + +++S 
Sbjct: 292 IHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKMIAST 351

Query: 135 LTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFF 174
           LTYP ++LRTRL   +S    S++   R  +  EG  GF+
Sbjct: 352 LTYPHEILRTRLQL-KSDMKPSIKSIIRTTYAKEGIRGFY 390

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 7/120 (5%)

Query: 62  YHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHS 121
           Y GI  T  T+ R+E +R L+KG VP    Y     + F  Y     +        +  S
Sbjct: 158 YSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLS 217

Query: 122 LAVGAL-AGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV------IWDTEGPAGFF 174
            ++ AL AG +S+ LT P+ +++TRL+     +   +            I+  EG   F+
Sbjct: 218 HSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFY 277

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 69/185 (37%), Gaps = 33/185 (17%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVAN-------------RSAHFFSLRRQARVIWDT---- 167
           GALAG ++ ++  PLD+ +TRL A                A  F  +  +  IW T    
Sbjct: 110 GALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSG-IWGTLTTI 168

Query: 168 ---EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY--GLPWLAAAASP-TAGLV 221
              E   G ++                   YE C ++   Y     +L+ + S  TAG +
Sbjct: 169 VRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALTAGAI 228

Query: 222 SKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           S     P+  V+ RL +   K+I   T       A          + + + EGI S Y G
Sbjct: 229 STTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAF---------IKIYKVEGIKSFYSG 279

Query: 282 LTMAL 286
           L  +L
Sbjct: 280 LIPSL 284

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 78/206 (37%), Gaps = 27/206 (13%)

Query: 115 LPPQA---HSLAVGALAGLVSSLLTYPLDLLRTRLVANRS-AHFFSLRRQARVIWDTEGP 170
           LPP A   H L  GA AG++   + +P+D ++TR+ ++ S A    L +Q   I   EG 
Sbjct: 10  LPPCAPLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGS 69

Query: 171 AGFFRXXXXXXXXXXXXXXXXXXXYE-TCTIAADTYGL----PWLAAAASPTAGLVSKAA 225
              ++                   YE + +   D   +    P   A +   A  V+ A 
Sbjct: 70  LALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADAL 129

Query: 226 VFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285
           + P D +++R+Q+   + +   T++                  +   EG A+ Y      
Sbjct: 130 MNPFDVIKQRMQLNTRESVWHVTKN------------------IYHKEGFAAFYYSYPTT 171

Query: 286 LCKSTPTTVITLWVYQRCLRLLEPTR 311
           L  + P       +Y+   + + P+ 
Sbjct: 172 LVMNIPFAAFNFAIYESATKFMNPSN 197

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 25/146 (17%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P D +K R QL     +    + H  + +  +EG  A +        M + + +  F  Y
Sbjct: 132 PFDVIKQRMQL-----NTRESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIY 186

Query: 104 A----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-------VAN--- 149
                ++N    S    P  H ++ G L+G   + +T PLD ++T L       V+N   
Sbjct: 187 ESATKFMN---PSNEYNPFIHCIS-GGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIM 242

Query: 150 RSAHFFSLRRQARVIWDTEGPAGFFR 175
           + A+ F  +R A  I+   G  GF R
Sbjct: 243 KQANTF--QRAASAIYKIHGWKGFLR 266

>Scas_673.17
          Length = 314

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +F+ +  +EG  AL  G  P    Y + G+ +FG Y
Sbjct: 40  PVDVVKTRIQLEPTVYNK--GMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 104 -AWLNTAAASAGLPPQAH---SLAVG--ALAGLVSSLLTYPLDLLRTRLVAN 149
             +   +  + G     H   S+ +G  A+A  ++ +   PL+  R RLV+ 
Sbjct: 98  EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ 149

>Kwal_47.17321
          Length = 881

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P++ VKIR Q++            T   V +  G+R L+KG V      V + ++ F 
Sbjct: 612 TNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFP 671

Query: 102 TYAWL-----NTAAASAGLPPQAHS---LAVGALAGLVSSLLTYPLDLLRTRLVAN---R 150
           TYA L     N          + H+   L  G LAG+ ++ LT P D+++TRL  +    
Sbjct: 672 TYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKG 731

Query: 151 SAHFFSLRRQARVIWDTEGPAGFFR 175
              +  +   AR I   E    FF+
Sbjct: 732 ETRYTGILHAARTILKEERFKSFFK 756

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E +Y GILH  RT+ +EE  ++ +KG        VL  S QF
Sbjct: 714 TTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKG----GGARVLRSSPQF 769

Query: 101 G 101
           G
Sbjct: 770 G 770

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 72/186 (38%), Gaps = 19/186 (10%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV-IWDTEGPAGFFR--- 175
           ++  +G++AG + +   YP+DL++TR+ A R+   +       V I+  EG  G +    
Sbjct: 502 YNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLG 561

Query: 176 -XXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRR 234
                                +      +   LP L   +   AG        PL+ V+ 
Sbjct: 562 PQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLP-LEIISGAAAGACQVIFTNPLEIVKI 620

Query: 235 RLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTV 294
           RLQ+          R   A  +L  ++   L V  V++ G+  LYKGL   L +  P + 
Sbjct: 621 RLQV----------RSEYA-DSLPKSQLTALGV--VKSLGLRGLYKGLVACLMRDVPFSA 667

Query: 295 ITLWVY 300
           I    Y
Sbjct: 668 IYFPTY 673

 Score = 32.3 bits (72), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 39/96 (40%), Gaps = 16/96 (16%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           AG +   AV+P+D V+ R+Q                +S  + +  +   V +   EGI  
Sbjct: 510 AGCIGATAVYPIDLVKTRMQA------------QRNFSQYKNS--IDCFVKIFSREGIRG 555

Query: 278 LYKGLTMALCKSTPTTVITLWV--YQRCLRLLEPTR 311
           +Y GL   L    P   I L V  Y R L + E  R
Sbjct: 556 IYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENNR 591

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 99/277 (35%), Gaps = 38/277 (13%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R Q Q  +  +Y   +  F  +   EG+R ++ G  P         +++    
Sbjct: 520 PIDLVKTRMQAQ-RNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVN 578

Query: 104 AWLNTAAASAG----LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRR 159
            ++            LP +  S   GA AG    + T PL++++ RL   RS +  SL +
Sbjct: 579 DYVRKLLMDENNRLTLPLEIIS---GAAAGACQVIFTNPLEIVKIRLQV-RSEYADSLPK 634

Query: 160 Q---ARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP-------- 208
               A  +  + G  G ++                   Y    +  D +           
Sbjct: 635 SQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTY--AHLKRDIFNYDPQDKNKRA 692

Query: 209 ----WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLG 264
               W    A   AG+ +     P D ++ RLQI           DP      R T  L 
Sbjct: 693 RLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQI-----------DPRK-GETRYTGILH 740

Query: 265 LAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
            A  +++ E   S +KG    + +S+P    TL  Y+
Sbjct: 741 AARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE 777

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 7/116 (6%)

Query: 44  PMDTVKIRRQLQL---ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           P+D VK R QLQ+   A  H Y G++   + +   EGV  L+KG      M     + +F
Sbjct: 31  PLDVVKTRMQLQVQGGAGPH-YTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKF 89

Query: 101 GT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
                +  L   A       Q  S+  GA AG V + +  P +L++ RL    S++
Sbjct: 90  ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY 145

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 201 AADTYGLPWLAAA-ASPTAGLVSKAAVFPLDTVRRRLQI-VDAKHIPFFTRDPGAYSALR 258
           ++DT  LP+L    A   AG+     ++PLD V+ R+Q+ V     P +T   G    L+
Sbjct: 3   SSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---GVVDCLK 59

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTP 291
                     +V  EG+  LYKG++  +    P
Sbjct: 60  ---------KIVAGEGVGRLYKGISSPILMEAP 83

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 42  TAPMDTVKIRRQ---LQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
           + P D VK R Q   +      KY+  L +  T+ REEG RAL+KG VP
Sbjct: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVP 269

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
             P + VKIR  LQ AS   Y G +   R +   EGV A++ G       + L+    FG
Sbjct: 128 VVPFELVKIR--LQDASS-SYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG 184

Query: 102 TYAWLNTAAASAGLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146
                     +A    Q   + L   ++   +  +L+ P D++++R+
Sbjct: 185 IIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRI 231

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 65/179 (36%), Gaps = 25/179 (13%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL----VANRSAHFFSLRRQARVIWDTEGPAG 172
           P  +    GA+AG+   L+ YPLD+++TR+          H+  +    + I   EG   
Sbjct: 10  PFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGR 69

Query: 173 FFRXXXX-XXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAA----ASPTAGLVSKAAVF 227
            ++                     E   +    +G+  L+      A  +AG V    V 
Sbjct: 70  LYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVV 129

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
           P + V+ RLQ   + +        G    +R          +V  EG+ ++Y GL   L
Sbjct: 130 PFELVKIRLQDASSSY-------KGPVDVVR---------KIVAREGVLAMYNGLESTL 172

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 8/112 (7%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R QL+    +K  G++ +F+ +   EG  AL  G  P    Y + G+ +FG Y
Sbjct: 37  PIDVVKTRIQLEPTVYNK--GMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 104 AWL------NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
                    N    +A     +  +   A+A  ++ +   PL+  R RLV+ 
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQ 146

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQR 302
           +++ EGI S Y G T  L K  P  +    V++R
Sbjct: 160 ILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFER 193

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 53/118 (44%), Gaps = 13/118 (11%)

Query: 44  PMDTVKIRRQLQLASEHKY-HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P++  +IR    L S+ ++ +G++  F  + +EEG+ + + G  P     + Y   +F  
Sbjct: 135 PLEATRIR----LVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLV 190

Query: 103 YAWLNTAAASAGLPPQAHS--------LAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           +   +        P +  S        L  G  AGL +++++ P D L +++   + A
Sbjct: 191 FERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKA 248

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 17/111 (15%)

Query: 45  MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVR-ALWK-------GNVPASAMYVLYG 96
           +DTVK R+Q    S  KY  ++  +RT+  EEG+R  L+        G+ P++A++    
Sbjct: 76  LDTVKTRQQ-GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIF---- 130

Query: 97  SLQFGTYAWLNTAAASA-GLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
              F TY +         G+      L  G L   +SS +  P ++L+TRL
Sbjct: 131 ---FATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRL 178

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 63/158 (39%), Gaps = 26/158 (16%)

Query: 43  APMDTVKIRRQLQ-------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLY 95
            P + +K R QLQ         S + Y  +     T+ R EG   L+ G     +  + +
Sbjct: 169 VPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPF 228

Query: 96  GSLQFGTYAWLNTAAASAGLPPQAHSLAVG------ALAGLVSSLLTYPLDLLRTRLVA- 148
             LQF  Y      A +         L++       A AG ++ ++T PLD+++TR+   
Sbjct: 229 SGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQ 288

Query: 149 ------NRSAHF------FSLRRQARVIWDTEGPAGFF 174
                 N S +        S+ +    ++ TEG AG F
Sbjct: 289 LPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLF 326

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E  Y GI+H  RT+ REE  ++ +KG     A  VL  S QF
Sbjct: 758 TTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKG----GAARVLRSSPQF 813

Query: 101 G 101
           G
Sbjct: 814 G 814

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 29/124 (23%)

Query: 42  TAPMDTVKIRRQL--QLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMY 92
           T P++ VKIR Q+  +  +E+  +  L   + + R  G+  L+KG       +VP SA+Y
Sbjct: 655 TNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL-GLPGLYKGAAACLLRDVPFSAIY 713

Query: 93  VLYGSLQFGTYAWLNTAAASAGLPPQAHS----------LAVGALAGLVSSLLTYPLDLL 142
                  F TYA L     +    P   +          L+ GALAG+ ++ LT P D++
Sbjct: 714 -------FPTYAHLKRDLFN--FDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVI 764

Query: 143 RTRL 146
           +TRL
Sbjct: 765 KTRL 768

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 74/198 (37%), Gaps = 19/198 (9%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV-IWDTEGPAGFFRXX- 177
           ++ ++G++AG + + + YP+D ++TR+ A RS   +       + I   EG  G +    
Sbjct: 545 YNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLG 604

Query: 178 -XXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS-PTAGLVSKAAVFPLDTVRRR 235
                             Y    +      L  L+   S  +AG        PL+ V+ R
Sbjct: 605 PQLIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIR 664

Query: 236 LQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVI 295
           LQ+             G Y A         A+ +++  G+  LYKG    L +  P + I
Sbjct: 665 LQV------------KGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAI 712

Query: 296 TLWVY---QRCLRLLEPT 310
               Y   +R L   +P 
Sbjct: 713 YFPTYAHLKRDLFNFDPN 730

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 38/97 (39%), Gaps = 20/97 (20%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W   +A   AG+ +     P D ++ RLQI           DP      +G       +H
Sbjct: 741 WELLSAGALAGMPAAYLTTPFDVIKTRLQI-----------DPK-----KGETIYKGIIH 784

Query: 269 ----MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
               ++R E   S +KG    + +S+P    TL  Y+
Sbjct: 785 AARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYE 821

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 44  PMDTVKIRRQLQLA--SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+D VK   QLQ++  S  +Y G+    + +A +EG   L+KG      M     + +F 
Sbjct: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88

Query: 102 T---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLR 158
               +  +      A    Q  S+  GA AG+  S +  P +L++ RL  + S+ F S  
Sbjct: 89  CNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRL-QDVSSKFTSPI 147

Query: 159 RQARVIWDTEG 169
              + I + EG
Sbjct: 148 AVVKNIVEKEG 158

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 66/175 (37%), Gaps = 25/175 (14%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRT----RLVANRSAHFFSLRRQARVIWDTEGPAG 172
           P  +    GA+AG+   L+ YPLD+++T    ++       +  +    + I   EGP+ 
Sbjct: 8   PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSR 67

Query: 173 FFRXXXXXXXXXXXXXXXXXXXY-ETCTIAADTYGLPWLAAAAS----PTAGLVSKAAVF 227
            ++                     E   I  D +G   L    S     +AG+     V 
Sbjct: 68  LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVV 127

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
           P + V+ RLQ V +K                 T  + +  ++V  EGI ++Y GL
Sbjct: 128 PFELVKIRLQDVSSKF----------------TSPIAVVKNIVEKEGILAMYNGL 166

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
             P + VKIR Q       K+   +   + +  +EG+ A++ G       + ++ +  FG
Sbjct: 126 VVPFELVKIRLQ---DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182

Query: 102 TYAWLNTAAASAGLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146
               +      A    +   + L  G + G +SSLL+ P D++++R+
Sbjct: 183 IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRV 229

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 42  TAPMDTVKIRRQ---LQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
           + P D VK R Q   +      KY+       T+ +EEG +AL+KG VP
Sbjct: 219 STPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267

>Kwal_23.2913
          Length = 320

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 26/144 (18%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVL 94
           TAP + VK+   LQ +    + G     RT+ RE GVR+L++G +       P SA+Y  
Sbjct: 159 TAPTERVKV--VLQTSESGSFLGAA---RTLIREGGVRSLFQGTLATLARDGPGSALY-- 211

Query: 95  YGSLQFGTYA----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR 150
                F +Y     +L+    +  L   +  +A G +AG+   +  +P+D ++T+L ++ 
Sbjct: 212 -----FASYEVSKRFLSRNQDTDALSVVSICVA-GGVAGMSMWIGVFPIDTIKTKLQSSS 265

Query: 151 SAHFFSLRRQARVIWDTEGPAGFF 174
            +   S+ + AR I+   G  GFF
Sbjct: 266 RSQ--SMVQAAREIYTRAGLRGFF 287

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 85/226 (37%), Gaps = 37/226 (16%)

Query: 104 AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV 163
           A +  A+ S  L     SLA G + G+ + L  +P DLL+ R  +N+++   +L   +RV
Sbjct: 14  AKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASG--TLDAISRV 71

Query: 164 IWDTE---GP------AGFFRXXXXXXXXXXXXXXXXXXXYE------------TCTIAA 202
           + + +   GP       GF+R                   Y+               IA 
Sbjct: 72  LHEAKSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAG 131

Query: 203 DTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRF 262
            +  L  L  +    AG  S      +     R+++V        T + G+        F
Sbjct: 132 SSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVV------LQTSESGS--------F 177

Query: 263 LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
           LG A  ++R  G+ SL++G    L +  P + +    Y+   R L 
Sbjct: 178 LGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLS 223

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 103/294 (35%), Gaps = 48/294 (16%)

Query: 44  PMDTVKIRRQLQLASE--HKYHGILHTFRTVARE---EGVRALWKGNVPASAMYVLYGSL 98
           P D +K+R Q   AS        +LH  ++ +       ++  ++G +P         ++
Sbjct: 48  PFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAV 107

Query: 99  QF------------GTYAWLNTAAASAGLPPQAHSLAVGALAGLVS----SLLTYPLDLL 142
            F            G+    + A +S+ L P   S    ALAG  S    +L+T P + +
Sbjct: 108 SFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQL--ALAGFFSAIPTTLITAPTERV 165

Query: 143 RTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETC---- 198
           +  L  + S  F      AR +    G    F+                   YE      
Sbjct: 166 KVVLQTSESGSFLG---AARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFL 222

Query: 199 TIAADTYGLPWLA-AAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSAL 257
           +   DT  L  ++   A   AG+     VFP+DT++ +LQ                 S+ 
Sbjct: 223 SRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ-----------------SSS 265

Query: 258 RGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTR 311
           R    +  A  +    G+   + GL  AL +S P    T    +   +L +  R
Sbjct: 266 RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQLFKQNR 319

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 10/140 (7%)

Query: 43  APMDTVKIRRQLQL-ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           AP++  K + Q+Q  A   KY G +   + V    GVR L+KG + ++ ++       +G
Sbjct: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKG-LTSTLIFRTNFVFWWG 235

Query: 102 TYA----WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR--SAHFF 155
           +Y     W       +       S    A  G  ++   YP D+++  ++ N      F 
Sbjct: 236 SYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTT--AYPSDVIKQVVLCNDKYDGTFR 293

Query: 156 SLRRQARVIWDTEGPAGFFR 175
           S +  A+ IW T G  GFF+
Sbjct: 294 SWKLAAKDIWRTRGYRGFFK 313

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 66/153 (43%), Gaps = 23/153 (15%)

Query: 44  PMDTVKIRRQLQLASEHK-YHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P+  VK R QL  A + + Y       +++ R EG+  L++G + AS +  + G LQ+  
Sbjct: 199 PIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRG-LSASYLGSVEGILQWLL 257

Query: 103 YAWL-----------------NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTR 145
           Y  L                 +T   +  +           LA  ++S++TYP +++RTR
Sbjct: 258 YEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTR 317

Query: 146 L----VANRSAHFFSLRRQARVIWDTEGPAGFF 174
           L    + N    +  L +  RVI   EG A  +
Sbjct: 318 LRQSPLENGKVKYTGLVQSFRVIIKEEGLASMY 350

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           A  ++    +P + VR RL+           + P     ++ T  +     +++ EG+AS
Sbjct: 300 AKFMASIVTYPHEVVRTRLR-----------QSPLENGKVKYTGLVQSFRVIIKEEGLAS 348

Query: 278 LYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           +Y GLT  L ++ P ++I    ++  ++LL
Sbjct: 349 MYSGLTPHLMRTVPNSIIMFGTWEVVIKLL 378

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 42  TAPMDTVKIR-RQLQLAS-EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           T P + V+ R RQ  L + + KY G++ +FR + +EEG+ +++ G  P     V    + 
Sbjct: 308 TYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIM 367

Query: 100 FGTY 103
           FGT+
Sbjct: 368 FGTW 371

>Kwal_0.232
          Length = 274

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 64/138 (46%), Gaps = 14/138 (10%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREE---GVR-ALWKGNVPASAMYVLYGSLQ 99
           P + +K R Q      HK    L T + + + E   G+R  L++G        + +  +Q
Sbjct: 115 PAEVIKQRTQ-----THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQ 169

Query: 100 FGTYAWLNTAAASAGLPPQA---HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
           F  Y +L    A +G   Q         G +AG +++  T PLD+L+TRL+ + ++    
Sbjct: 170 FPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTS--VP 227

Query: 157 LRRQARVIWDTEGPAGFF 174
           +   AR I+ TEG   FF
Sbjct: 228 VLHLARQIYATEGWKVFF 245

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVA 148
           SL  GA AG  + L  +P+D L+TRL A
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQA 36

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 61/121 (50%), Gaps = 17/121 (14%)

Query: 44  PMDTVKIRRQLQLAS-EHKYHGI---LHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           P+DT+K R  +Q A  + +  G+   + T + + RE G+R  ++G          Y +L 
Sbjct: 315 PIDTLKFR--IQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALD 372

Query: 100 FGTYA----WLNTAAASA-GLPPQAHSLA------VGALAGLVSSLLTYPLDLLRTRLVA 148
            GT++    W  T  A+A G+      ++      +GA +G V + + YP++LLRTRL A
Sbjct: 373 LGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQA 432

Query: 149 N 149
            
Sbjct: 433 Q 433

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 94/264 (35%), Gaps = 41/264 (15%)

Query: 71  TVAREEGVRALWKGN-------VPASAMYVLYGSLQFGTYAWLN-TAAASAGLPPQAHSL 122
           ++ R+ G+RA + GN        P SAM   +GS +               G   +  + 
Sbjct: 242 SLYRQGGLRAFYLGNGLNVIKVFPESAMK--FGSFELAKRVLAGLEGCGETGELSRLSTY 299

Query: 123 AVGALAGLVSSLLTYPLDLLRTRL----VANRSAHFFSLRRQARVIWDTEGPAGFFRXXX 178
             G L G+++    YP+D L+ R+    +  R      L + A+ ++   G   F+R   
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 179 XXXXXXXXXXXXXXXXYET-----CTIAADTYGLPWLAAAASPT--------AGLVSKAA 225
                           +        T  A+  G+       S          +G V    
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATV 419

Query: 226 VFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285
           V+P++ +R RLQ       P   R  G     R T         V+ EG+  LYKGL   
Sbjct: 420 VYPINLLRTRLQAQGTYAHPH--RYDGFQDVFRKT---------VQREGLPGLYKGLVPT 468

Query: 286 LCKSTPTTVITLWVYQ---RCLRL 306
           L K  P   I+   Y+   R +RL
Sbjct: 469 LAKVCPAVAISYLCYENLKRAMRL 492

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 44  PMDTVKIRRQLQ--LASEHKYHGILHTFRTVAREEGVRALWKGNVPASA 90
           P++ ++ R Q Q   A  H+Y G    FR   + EG+  L+KG VP  A
Sbjct: 422 PINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLA 470

>Scas_640.25
          Length = 306

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 44  PMDTVKIRRQLQL------ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           P+D VK R QLQ+      AS   Y G++     + ++EG   ++KG      M     +
Sbjct: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92

Query: 98  LQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           ++F +   +  L  +        Q  S+  GA AG+  +L+  P +L++ RL
Sbjct: 93  VKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRL 144

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 66/179 (36%), Gaps = 29/179 (16%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS--------AHFFSLRRQARVIWDTE 168
           P  +    GA+AG+   ++ YPLD+++TR+    S         H+  +      I   E
Sbjct: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71

Query: 169 GPAGFFRXXXX-XXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS----PTAGLVSK 223
           GP   ++                     E   +    +G   L    S     +AG+   
Sbjct: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA 131

Query: 224 AAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
             + P + V+ RLQ V++K         G    L+         H+++ +G+  LY G+
Sbjct: 132 LVIVPFELVKIRLQDVNSKF-------KGPVEVLK---------HIIKQDGLKGLYSGV 174

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 4/50 (8%)

Query: 42  TAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
             P D VK R Q      +    KY+    +   +  EEG RAL+KG VP
Sbjct: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVP 276

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 213 AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRA 272
           A    +G V++  V+P D +RRR Q++         R      AL         + + + 
Sbjct: 15  AMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDAL---------ITIGKT 65

Query: 273 EGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           EG    YKGLT  L K  P+T ++  VY+
Sbjct: 66  EGPKGYYKGLTANLFKVIPSTAVSWLVYE 94

 Score = 36.6 bits (83), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFSLRRQAR-----VIWDTEGPAGF 173
           + LA+GA++G V+  L YP DLLR R  V     +    R ++       I  TEGP G+
Sbjct: 12  YKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGY 71

Query: 174 FR 175
           ++
Sbjct: 72  YK 73

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 7/110 (6%)

Query: 44  PMDTVKIRRQLQLASEH----KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           P+D VK R QLQ+ S       Y+G++     + + EG   L+KG      M     + +
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 100 FG---TYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           F    +Y  +           Q  S+  G+LAG+  + +  P +L++ RL
Sbjct: 88  FACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRL 137

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 63/178 (35%), Gaps = 29/178 (16%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL---VANRSAHFFSLRRQARVIWDTEGPAGF 173
           P  +    GA AG+   L+ YPLD+++TR+   V + +    +       +       GF
Sbjct: 7   PFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGF 66

Query: 174 FRXXXXXXXXXXXXXXXXXXXYETCT-----IAADTYGLPWLAAAAS----PTAGLVSKA 224
            R                   +  C      +  D YG+  L    S      AG+    
Sbjct: 67  SRLYKGISSPMLMEAPKRATKF-ACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEAC 125

Query: 225 AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282
            + P + V+ RLQ V++K        P           + +    +R  GI SLY GL
Sbjct: 126 VIVPFELVKIRLQDVNSKF-----NGP-----------MEVVFKTIRETGILSLYNGL 167

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 207 LPWLAAAASPTAGLVSKAAV-FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
           LP++    S  A  VS+  V +PLD V+ R+Q+     +   T    AY+ +     LG 
Sbjct: 6   LPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL----QVGSGTGSGVAYNGV--IDCLG- 58

Query: 266 AVHMVRAEGIASLYKGLTMALCKSTP 291
              +V+ EG + LYKG++  +    P
Sbjct: 59  --QIVKREGFSRLYKGISSPMLMEAP 82

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 71/155 (45%), Gaps = 31/155 (20%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFR--TVAREEGVRALWKG-------NVPASAMY 92
           T P++ VKIR  LQ+ S++      ++    +V +  G+  L++G       ++P SA+Y
Sbjct: 636 TNPLEIVKIR--LQVKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIY 693

Query: 93  VLYGSLQFGTYAWLNTAAASAGLPPQAHS---------LAVGALAGLVSSLLTYPLDLLR 143
                  F TYA + +   +   P  +           L  G LAG+ ++ LT P D+++
Sbjct: 694 -------FPTYAHIKSNVFNFD-PKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIK 745

Query: 144 TRLVAN---RSAHFFSLRRQARVIWDTEGPAGFFR 175
           TRL  +     + +  +   AR I   EG   FF+
Sbjct: 746 TRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFK 780

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E  Y+GI    RT+ +EEG+++ +KG  PA    VL  S QF
Sbjct: 738 TTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGG-PAR---VLRSSPQF 793

Query: 101 G 101
           G
Sbjct: 794 G 794

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 94/273 (34%), Gaps = 30/273 (10%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R Q Q     KY   +     +  +EGVR L+ G  P         +++    
Sbjct: 544 PIDMVKTRMQAQ-RDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTVN 602

Query: 104 AWLN-TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQAR 162
             +  T A   G       +  GA AG    + T PL++++ RL         + R    
Sbjct: 603 DHMRATLAGRDGKLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVN 662

Query: 163 VI--WDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP------------ 208
            I      G  G +R                   Y    I ++ +               
Sbjct: 663 AISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTY--AHIKSNVFNFDPKDSDKRNKLNT 720

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W    +   AG+ +     P D ++ RLQI   K    +    G + A R          
Sbjct: 721 WQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYN---GIWDAART--------- 768

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
           +++ EGI S +KG    + +S+P    TL  Y+
Sbjct: 769 ILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYE 801

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 24/32 (75%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           ++  +G++AG + +++ YP+D+++TR+ A R 
Sbjct: 526 YNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRD 557

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 43/108 (39%), Gaps = 18/108 (16%)

Query: 196 ETCTIAADTYGLPWLAAAASPT----AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDP 251
           E+ + +++ Y  P   +  + T    AG +    V+P+D V+ R+Q           RD 
Sbjct: 508 ESESRSSNLYFYPIFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQA---------QRDF 558

Query: 252 GAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWV 299
             Y        +   + ++  EG+  LY GL   L    P   I L V
Sbjct: 559 SKYK-----NSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTV 601

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 42  TAPMDTVKIRRQLQ-LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P D +K R Q+     E  Y G++H  RT+ +EE +++ +KG  PA    VL  S QF
Sbjct: 718 TTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGG-PAR---VLRSSPQF 773

Query: 101 G 101
           G
Sbjct: 774 G 774

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 68/156 (43%), Gaps = 33/156 (21%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVA--REEGVRALWKG-------NVPASAMY 92
           T P++ VKIR  LQ+ S++           V   R+ G+R L+KG       +VP SA+Y
Sbjct: 616 TNPLEIVKIR--LQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIY 673

Query: 93  VLYGSLQFGTYAWLNTAAASAGLPPQAHS----------LAVGALAGLVSSLLTYPLDLL 142
                  F TYA L     +    P   +          L  G +AG+ ++ LT P D++
Sbjct: 674 -------FPTYAHLKKDVFN--FDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVI 724

Query: 143 RTRL-VANRSAH--FFSLRRQARVIWDTEGPAGFFR 175
           +TRL +  R     +  +   AR I   E    FF+
Sbjct: 725 KTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFK 760

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 71/185 (38%), Gaps = 17/185 (9%)

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV-IWDTEGPAGFFRXX- 177
           H+  +G++AG + + + YP+DL++TR+ A R++  +       V I+ T+G  G +    
Sbjct: 506 HNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLG 565

Query: 178 -XXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS-PTAGLVSKAAVFPLDTVRRR 235
                             +        +  + W     S  TAG        PL+ V+ R
Sbjct: 566 PQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIR 625

Query: 236 LQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVI 295
           LQ+               Y        LG AV ++R  G+  LYKG    L +  P + I
Sbjct: 626 LQM------------RSDYVGENARPQLG-AVGIIRQLGLRGLYKGAAACLLRDVPFSAI 672

Query: 296 TLWVY 300
               Y
Sbjct: 673 YFPTY 677

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/277 (20%), Positives = 103/277 (37%), Gaps = 41/277 (14%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV-RALWKGNVPASAMYVLYGSLQFGT 102
           P DTVK+R Q Q  + + +       +   + EG+ R  ++G         L  +  F +
Sbjct: 33  PFDTVKVRLQTQ--ASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVS 90

Query: 103 YAWLNT-AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL------VANRSAHFF 155
           Y   +        + P    L  G +AG  +SL+  P++L++ +L      VA+      
Sbjct: 91  YNQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHT 150

Query: 156 SLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA-ADTYGLP------ 208
            +    + I    G AG ++                   YE    +  D + L       
Sbjct: 151 KVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDE 210

Query: 209 ---WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGL 265
              W    +  +AGL   A++FP DTV+  +Q    +HI                  L  
Sbjct: 211 SKIWELLISGGSAGLAFNASIFPADTVKSVMQ---TEHIS-----------------LTN 250

Query: 266 AVHMVRAE-GIASLYKGLTMALCKSTPTTVITLWVYQ 301
           AV  +  + G+   Y+GL + L ++ P      ++++
Sbjct: 251 AVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 63/161 (39%), Gaps = 13/161 (8%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPA-GFFRXXXXXXXX 183
           G++AG    ++ +P D ++ RL    S  F +     +  +  EG A GFF+        
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVG 79

Query: 184 XXXXXXXXXXXYETCT--IAADTYGLPWLAAAAS-PTAGLVSKAAVFPLDTVRRRLQIVD 240
                      Y  C+  +   T   P      S   AG  +   + P++ V+ +LQ+ +
Sbjct: 80  ACLENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVAN 139

Query: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
            +          A +  + T+ L     ++   G+A L++G
Sbjct: 140 LQV---------ASAKTKHTKVLPTIKAIITERGLAGLWQG 171

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 68/149 (45%), Gaps = 17/149 (11%)

Query: 44  PMDTVKIRRQLQ-LASEHKYHGIL-HTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+DT+K R Q   L +E K   ++  T + +  E G++  ++G          Y +L  G
Sbjct: 340 PIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLG 399

Query: 102 TYAWLNT---AAASAGLPPQAHS--------LAVGALAGLVSSLLTYPLDLLRTRLVANR 150
           T++ L     ++ +  L  +           L +GA +G   + + YP++LLRTRL A  
Sbjct: 400 TFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQG 459

Query: 151 S-AHFFSLRRQARVIWDT---EGPAGFFR 175
           + AH +       V+  T   EG  G F+
Sbjct: 460 TFAHPYRYDGFRDVLLKTIQREGYPGLFK 488

>Scas_687.15*
          Length = 328

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D VK R Q + A  + Y   L+    V  EEG+ +LWKG +P      L G + FG
Sbjct: 251 TQPIDVVKTRMQSKTA-HYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFG 309

Query: 102 TYAWLNT 108
            Y ++  
Sbjct: 310 VYQYVEN 316

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 47/101 (46%), Gaps = 1/101 (0%)

Query: 55  QLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAG 114
           Q+ S++    I    + +    G+R   +G +P     V   +++F  Y  L    +   
Sbjct: 170 QVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQ 229

Query: 115 LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
              + ++  +G  +      LT P+D+++TR+  +++AH+F
Sbjct: 230 PLNEVYAFGIGLFSSCAVVALTQPIDVVKTRM-QSKTAHYF 269

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D +K R Q + A    Y   L+    +  EEG R +WKG VP      L G + FG
Sbjct: 266 TQPIDVIKTRMQSKTAW-FTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFG 324

Query: 102 TYAWLNT 108
            Y ++  
Sbjct: 325 VYQYVEN 331

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
           S H    +L  +RT     GVR   +G +P     +    ++F TYAW+  + +      
Sbjct: 192 SSHFAGTVLEIYRT----RGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALD 247

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           +  + A GAL+      LT P+D+++TR+
Sbjct: 248 EYQAFAAGALSSAAVVALTQPIDVIKTRM 276

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 108/286 (37%), Gaps = 65/286 (22%)

Query: 44  PMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P DTVK+R Q Q A+     +  + HT++    +EG   LW+G     A  V    L+  
Sbjct: 28  PFDTVKVRLQTQSAALFPTTWSCVSHTYK----QEG---LWRGFYQGMASPVFGAFLEHA 80

Query: 102 T-YAWLNTAAA------SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSA- 152
             +   N A A      S G  P    +  GA+AG  +S +  P++L++ +L V+N +  
Sbjct: 81  VLFVSFNRAQAVLENCYSCG--PLEKVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGV 138

Query: 153 ---HFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPW 209
               + ++    R I    G  G ++                   YE            W
Sbjct: 139 SGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLK--------GW 190

Query: 210 LAAAASPTAGLVSK-------------AAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSA 256
           LA     T   V +             A++FP DTV+  +Q    +H+            
Sbjct: 191 LARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQ---TEHLG----------- 236

Query: 257 LRGTRFLGLAVHMV-RAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301
                 LG AV  V +  G    Y+G+ + L ++ P   +  +VY+
Sbjct: 237 ------LGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 21/145 (14%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVL 94
           TAP + VK+   LQ +S+  +   +   +T+ +E G+ +L+KG++       P SA+Y  
Sbjct: 159 TAPTERVKVV--LQTSSKGSF---IQAAKTIVKEGGIASLFKGSLATLARDGPGSALY-- 211

Query: 95  YGSLQFGTYAWLNTAA--ASAGLPPQAHSLAV---GALAGLVSSLLTYPLDLLRTRLVAN 149
           + S +  +  +LN+      AG     + L V   G +AG+   L  +P+D ++T+L A+
Sbjct: 212 FASYEI-SKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQAS 270

Query: 150 RSAHFFSLRRQARVIWDTEGPAGFF 174
            +     L     +     G  GFF
Sbjct: 271 STRQNM-LSATKEIYLQRGGIKGFF 294

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 54/277 (19%), Positives = 94/277 (33%), Gaps = 42/277 (15%)

Query: 44  PMDTVKIRRQLQLASE--HKYHGILHTFRTVAR----EEGVRALWKGNVPASAMYVLYGS 97
           P D +K+R Q   A+   H    I+   +T  +       V+  +KG +P         +
Sbjct: 55  PFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFA 114

Query: 98  LQFGTY------AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           + F  Y         N     +         A G ++ + ++L+T P + ++  L  +  
Sbjct: 115 VSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSK 174

Query: 152 AHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLA 211
             F    + A+ I    G A  F+                   YE      ++      A
Sbjct: 175 GSFI---QAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDA 231

Query: 212 AAASPT-----------AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGT 260
               P            AG+    AVFP+DT++ +LQ    +            + L  T
Sbjct: 232 GKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQ-----------NMLSAT 280

Query: 261 RFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITL 297
           +     +++ R  GI   + GL  AL +S P    T 
Sbjct: 281 K----EIYLQRG-GIKGFFPGLGPALLRSFPANAATF 312

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 69/140 (49%), Gaps = 19/140 (13%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVLY 95
           AP + VK+  Q Q       H +    + +    GVR+L++G++       P SA+Y  +
Sbjct: 168 APTERVKVVLQTQ-----SNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALY--F 220

Query: 96  GSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
            S +  T A+LN  + +  L  +   LA G +AG+   +  +P+D ++T L ++ +    
Sbjct: 221 ASYE-ATKAYLNARSGTNELSIKNVCLA-GGMAGVSMWVGVFPIDTIKTELQSSNTRQ-- 276

Query: 156 SLRRQARVIWDTEGP-AGFF 174
           ++    R I++T G   GFF
Sbjct: 277 TMMEATRKIYNTRGGIKGFF 296

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 112 SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           S  L   A SLA GA+ G+ + L  +P DLL+ R  +N+++
Sbjct: 41  SNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS 81

>Kwal_26.8669
          Length = 296

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 5/115 (4%)

Query: 44  PMDTVKIRRQLQLASE--HKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           P+D VK R QLQ++     +Y G++   + +  +EG   L+KG      M     + +F 
Sbjct: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88

Query: 102 TY-AWLNTAAASAGLPPQAHSLAV--GALAGLVSSLLTYPLDLLRTRLVANRSAH 153
               +        G+     SL++  GA AG   + +  P +L++ RL    S++
Sbjct: 89  CNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY 143

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
             P + VKIR Q   +S   Y G +   R +  +EGV A++ G       + ++ +  FG
Sbjct: 126 VVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182

Query: 102 TYAWLNTAAASAGLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146
               +      A    Q   + L  G++ G + SL++ P D++++R+
Sbjct: 183 IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 67/179 (37%), Gaps = 25/179 (13%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAG 172
           P  +  A GA+AG+   L+ YPLD+++TR+    S      +  +    + I   EG + 
Sbjct: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67

Query: 173 FFRXXXX-XXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAAS----PTAGLVSKAAVF 227
            ++                     E   I    +G+  L  + S     +AG      V 
Sbjct: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286
           P + V+ RLQ V + +        G    +R          ++  EG+ ++Y GL   L
Sbjct: 128 PFELVKIRLQDVSSSY-------KGPIDVVR---------KIIAQEGVLAMYNGLESTL 170

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 42  TAPMDTVKIRRQ---LQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
           + P D VK R Q   +      KY+    +  T+ +EEG RAL+KG VP
Sbjct: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVP 267

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 18/93 (19%)

Query: 203 DTYGLPWLAA-AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR 261
           D   LP+    AA   AG+     ++PLD V+ R+Q+                S   G +
Sbjct: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQL--------------QVSGGLGPQ 48

Query: 262 FLGLA---VHMVRAEGIASLYKGLTMALCKSTP 291
           + G+      +V  EG + LYKG++  +    P
Sbjct: 49  YKGVVDCIKQIVAKEGASRLYKGISSPVLMEAP 81

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 104/289 (35%), Gaps = 41/289 (14%)

Query: 42  TAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS 97
           T P++TVK R QLQ          Y G       + R EG+R L +G   A A  +L   
Sbjct: 29  TNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88

Query: 98  LQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTY---------PLDLLRTRL-- 146
            + G Y  L  A     L  +  +    ALA   ++             PL L++TR+  
Sbjct: 89  SRLGLYDPLRAALGGCVLSDR-RTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQA 147

Query: 147 VANRSAHFFSLRRQARVI--WDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIA--- 201
           +A R       R   R++  +   G  G ++                   Y     A   
Sbjct: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR 207

Query: 202 --ADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRG 259
              D   L  LA+A S  A  +   A+ P D    R+      H     R P        
Sbjct: 208 HVPDGMALYTLASALSSVAVCI---AMNPFDVAMTRMY----HHRGGLYRGP-------- 252

Query: 260 TRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
              L      VR EG ++LYKG    L +  P T++ L + ++ LR++ 
Sbjct: 253 ---LDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 16/113 (14%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT- 102
           P DT+K+R Q    +E ++ G L       R +G+R  + G  P    ++L  S+  G  
Sbjct: 43  PFDTIKVRLQTS-QNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCL 101

Query: 103 ---------YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
                    Y + N         P +  +  G LAG   S +  P++L + +L
Sbjct: 102 HNYRMLMHKYVYPNDEKL-----PLSGCIISGVLAGWSVSFIAPPIELAKAKL 149

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 14/141 (9%)

Query: 44  PMDTVKIRRQLQL-ASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           P++  K + Q+Q   +  +Y G L   + +   +G+R L+KG + ++ ++  +    +G+
Sbjct: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI-STLIFRTHFVYWWGS 199

Query: 103 YAWL------NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR--SAHF 154
           Y  L      NT  + A +    +  A G  A        YP D+++  ++ N      F
Sbjct: 200 YELLTRWFRENTKMSEAAI----NFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSF 255

Query: 155 FSLRRQARVIWDTEGPAGFFR 175
            S R   + I+ ++G  GFF+
Sbjct: 256 KSWRTAVKDIYQSKGINGFFK 276

>Scas_702.10
          Length = 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 58/138 (42%), Gaps = 8/138 (5%)

Query: 46  DTVKIRRQ----LQLASEHKY-HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           D V IR Q    L+      Y + I   ++    E G++ L  G  P     VL  + Q 
Sbjct: 123 DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQV 182

Query: 101 GTY-AWLNTAAASAGLPPQAHS--LAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSL 157
            TY  + N         P+ +S  L+   LAGLV++ +  P D+++TR++        S 
Sbjct: 183 VTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTESESA 242

Query: 158 RRQARVIWDTEGPAGFFR 175
            +        EGP+  FR
Sbjct: 243 IKILTSAIKKEGPSFMFR 260

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 22/124 (17%)

Query: 43  APMDTVKIRRQ------LQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPAS 89
           AP++ +K R Q          ++  +  +L   R   R  G + L+KG       +VP S
Sbjct: 172 APLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFS 231

Query: 90  AMYVLYGSLQF-GTYAWLNTAAASA--GLPPQ----AHSLAVGALAGLVSSLLTYPLDLL 142
           A+Y  +GS +F     W++ +       L P      +S   G+++G  ++LLT+P D+ 
Sbjct: 232 AIY--WGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVG 289

Query: 143 RTRL 146
           +TR+
Sbjct: 290 KTRM 293

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 61  KYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVLYGSLQFGTYAWLNTAAASA 113
           +++     F  ++  EG+  LW+G        +PA+ +Y       F  Y      +   
Sbjct: 96  RFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVY-------FSGYEMFRDHSPMR 148

Query: 114 GLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
              P  + L  GA A +V++    PL+L++TRL
Sbjct: 149 DSYPSLNPLFCGATARMVAATTVAPLELIKTRL 181

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 19/101 (18%)

Query: 217 TAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIA 276
           TA +V+   V PL+ ++ RLQ      IP   +D       +    L    + +R+ G  
Sbjct: 162 TARMVAATTVAPLELIKTRLQ-----SIPRSRKDTTTQMMFKD--LLKETRNEIRSGGYK 214

Query: 277 SLYKGLTMALCKSTPTTVI----------TLWV--YQRCLR 305
            L+KGL + L +  P + I            W+   ++CLR
Sbjct: 215 VLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLR 255

>Kwal_47.19228
          Length = 281

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 41/89 (46%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
            EH     L T + + R  G+R   +G +P         +++F TY  L    +      
Sbjct: 124 DEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLN 183

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           + ++ A+G ++      +T P+D+++TR+
Sbjct: 184 EYYAFALGFISSCAVVAVTQPIDVIKTRM 212

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D +K R Q +    + Y   L+    +  EEG    WKG  P      L G + FG
Sbjct: 202 TQPIDVIKTRMQSKYTWSN-YKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFG 260

Query: 102 TYAWL-NTAAASAGLPPQAHS 121
            Y ++ N   A  G    +H 
Sbjct: 261 VYQYVDNLMKAVNGQQEMSHE 281

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 23/100 (23%)

Query: 66  LHTFRTVA---REEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAAS-AGLPP---- 117
           LHT   +     +EG+R LWK N        +Y  L      W     +S  G+P     
Sbjct: 227 LHTIDVINALFDQEGIRGLWKANNTT----FIYNFLSLSIDTWFTGLLSSFLGVPDPYFM 282

Query: 118 ---------QAHSLAVGALAGLVSSLLTYPLDLLRTRLVA 148
                    ++  LA+GA  G+ +S++  P+DL+RTRL+ 
Sbjct: 283 EVINSPDISKSFILALGA--GVFTSIILLPVDLIRTRLIV 320

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D VK R Q +       + +   +RT   EEG+ +LWKG VP      L G + FG
Sbjct: 264 TQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFI-EEGLTSLWKGWVPRLFKVGLSGGVSFG 322

Query: 102 TYAWLNT 108
            Y +++ 
Sbjct: 323 VYQYVDN 329

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
            +H    I  T R + +  G    ++G++P     V   +++F TY  L    +      
Sbjct: 186 EKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKPLS 245

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQA 161
           + ++  +G  +      LT P+D+++TR+   +S + +SL R +
Sbjct: 246 EYYAFGIGVFSSCAVVALTQPIDVVKTRM---QSKYTWSLYRNS 286

>Kwal_23.3529
          Length = 395

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 45  MDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVR--------ALWKGNVPASAMYVLYG 96
           +DTVK R+Q    +  KY  ++  ++ +  EEG+R        A   G+ P++A++    
Sbjct: 106 LDTVKTRQQ-GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIF---- 160

Query: 97  SLQFGTYAWLNTAAASA-GLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
              FGTY           G+      L  G    LVSS++  P ++L+TRL
Sbjct: 161 ---FGTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRL 208

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 6/89 (6%)

Query: 214 ASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAE 273
           A  +  LVS     P + ++ RLQ+    + P F      Y  LR          +VR E
Sbjct: 186 AGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHF-HSGYNYRNLRDA-----ITAIVRLE 239

Query: 274 GIASLYKGLTMALCKSTPTTVITLWVYQR 302
           G  +L+ G    LC+  P +      Y++
Sbjct: 240 GWQTLFFGYKATLCRDLPFSAFQFAFYEK 268

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 65/155 (41%), Gaps = 24/155 (15%)

Query: 44  PMDTVKIRRQLQ-------LASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96
           P + +K R QLQ         S + Y  +      + R EG + L+ G        + + 
Sbjct: 200 PSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFS 259

Query: 97  SLQFGTYAWLNTAAAS--AGLPPQAHSL----AVGALAGLVSSLLTYPLDLLRTRL---- 146
           + QF  Y      A +     P Q  SL      GA AG ++ ++T P+D+++TR+    
Sbjct: 260 AFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQM 319

Query: 147 ---VANRSAHFF----SLRRQARVIWDTEGPAGFF 174
              VA+ S        SL +    ++ +EG  GFF
Sbjct: 320 PSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFF 354

>Kwal_27.11419
          Length = 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 77/200 (38%), Gaps = 30/200 (15%)

Query: 117 PQAHSLAVGA-LAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV---IWDTEGPAG 172
           P+  S  +G  + GL S+++  P DLL+TRL  N+S++   + R       +W    P+ 
Sbjct: 5   PRGRSHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIETPGQLWKGTLPSA 64

Query: 173 FFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYG----LPWLAAAASPTAGLVSKAAV-- 226
                                  +     A   G    LP L+   +  +G +++AAV  
Sbjct: 65  LRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGV 124

Query: 227 --FPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLG-LAVHMVRAEGIASLYKGLT 283
              P+  ++ R +                 S +   + LG  A H+ R+EGI  L+ G  
Sbjct: 125 ATMPITVLKVRFE-----------------STMYNYKSLGEAATHIYRSEGIRGLFSGCG 167

Query: 284 MALCKSTPTTVITLWVYQRC 303
             + +  P   + +  Y++ 
Sbjct: 168 ATVMRDAPYAGLYVLFYEQS 187

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84
           T+P DT+K R QL   +  +Y+G + TF+++ R E  R L+ G
Sbjct: 232 TSPFDTIKTRMQL---NPSQYYGFIQTFKSIIRYERPRNLFDG 271

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 21/149 (14%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYVL 94
           T P+  +K+R +   ++ + Y  +      + R EG+R L+ G       + P + +YVL
Sbjct: 126 TMPITVLKVRFE---STMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVL 182

Query: 95  Y---GSLQFGTY--AWLNTAAASAGLPPQAHSLAVGALAGLVSSLL----TYPLDLLRTR 145
           +     LQ       W+      +G+     S  + ++A   S+ L    T P D ++TR
Sbjct: 183 FYEQSKLQLPRILPVWM-VEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTR 241

Query: 146 LVANRSAHFFSLRRQARVIWDTEGPAGFF 174
           +  N S  ++   +  + I   E P   F
Sbjct: 242 MQLNPS-QYYGFIQTFKSIIRYERPRNLF 269

>Scas_714.18
          Length = 305

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 19/99 (19%)

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W    +  TAGL    +VFP DTV+    I+  +H+           AL  T        
Sbjct: 226 WQLLISGATAGLAFNGSVFPADTVK---SIMQTEHL-----------ALMET-----VRS 266

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           ++  +G+A  Y+GL + L ++ P+     + Y++  ++L
Sbjct: 267 ILERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLSKIL 305

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 6/119 (5%)

Query: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTA--AASAGLP 116
           E ++  I+ T +++ +E+G+  LW+G         +   + F TY  +        + + 
Sbjct: 164 EGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVN 223

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
                L  GA AGL  +   +P D +++ +   ++ H  +L    R I + +G AGF+R
Sbjct: 224 TTWQLLISGATAGLAFNGSVFPADTVKSIM---QTEH-LALMETVRSILERDGVAGFYR 278

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/137 (18%), Positives = 49/137 (35%), Gaps = 4/137 (2%)

Query: 108 TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDT 167
            A    G       +  G++AG +   + YP D ++ RL    +  F S     +  ++ 
Sbjct: 2   NAVEEGGFGAALREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYEN 61

Query: 168 EGP-AGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAV 226
           EG   GF++                   Y  C+   + +           +AG     A 
Sbjct: 62  EGILEGFYQGIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFAGSCAS 121

Query: 227 F---PLDTVRRRLQIVD 240
           F   P++ ++ +LQI +
Sbjct: 122 FVLTPVELIKCKLQISN 138

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 60/139 (43%), Gaps = 11/139 (7%)

Query: 46  DTVKIRRQ----LQLASEHKYHGILHTFRTVAREEG-VRALWKGNVPASAMYVLYGSLQF 100
           D V IR Q    L+ A    Y   +     + R EG ++ L+ G  P     +L  + Q 
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQV 186

Query: 101 GTY----AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
            TY     +L T           H L    LAGLV++ +  P D+++TR++     H  +
Sbjct: 187 VTYDVFKNYLVTKLDFDASKNYTH-LTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPA 245

Query: 157 LRRQARVIWDTEGPAGFFR 175
           L+  A  +   EGP+  FR
Sbjct: 246 LKILADAV-RKEGPSFMFR 263

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 49/126 (38%), Gaps = 5/126 (3%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D  K+R Q   A+      +     ++   EGV  L+ G   A      Y +++FG
Sbjct: 31  THPLDLAKVRLQ---AAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFG 87

Query: 102 TYAWL-NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQ 160
            Y  L         L   A+ L     +G +  L     D++  R+  N SA   + RR 
Sbjct: 88  AYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRM-QNDSALEAAKRRN 146

Query: 161 ARVIWD 166
            +   D
Sbjct: 147 YKNAID 152

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 108/297 (36%), Gaps = 62/297 (20%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGV-RALWKG--------NVPASAMYVL 94
           P DTVK+R Q Q    H +           + EG+ +  ++G         +  +A+++ 
Sbjct: 33  PFDTVKVRLQTQ--GRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLS 90

Query: 95  YGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAH 153
           Y         + N +  +       + L  GA AG  +S +  P++L++ +L V+N  + 
Sbjct: 91  YNQCSKFLQHYTNVSDLT-------NILISGAFAGSCASFVLTPVELIKCKLQVSNLQSL 143

Query: 154 FFSL-------RRQARVI------WDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTI 200
              +        R  R+I          G  G ++                   YE    
Sbjct: 144 PLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKK 203

Query: 201 ------AADTYGLP-----WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTR 249
                   +   LP     W   A+  +AGL   A++FP DTV+  +Q          T 
Sbjct: 204 YLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQ----------TE 253

Query: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRL 306
             G  +A++          +   +G+   Y+GL + L ++ P      +VY+   +L
Sbjct: 254 HLGLKTAIK---------KIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSKL 301

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 60/165 (36%), Gaps = 13/165 (7%)

Query: 125 GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEG-PAGFFRXXXXXXXX 183
           G++AG +  ++ YP D ++ RL       F          +  EG   GFF+        
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAG 79

Query: 184 XXXXXXXXXXXYETC-------TIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRL 236
                      Y  C       T  +D   +    A A   A  V    + P++ ++ +L
Sbjct: 80  AAIENAALFLSYNQCSKFLQHYTNVSDLTNILISGAFAGSCASFV----LTPVELIKCKL 135

Query: 237 QIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG 281
           Q+ + + +P      G     R TR +     +++  G   L++G
Sbjct: 136 QVSNLQSLPLGVAG-GNTVTERHTRIIPTIQAVIKNRGFIGLWQG 179

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 21/122 (17%)

Query: 44  PMDTVKIRRQLQLASE------------HKYHGILHTFRTVAREEGVRALWKG------- 84
           P+D VK R QLQ+ ++              Y G++     + ++EG   L+KG       
Sbjct: 31  PLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILM 90

Query: 85  NVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRT 144
             P  A+    G+  F T+ +        G   Q  ++  GA AG V + +  P +L++ 
Sbjct: 91  EAPKRAIK-FSGNDTFQTF-YKKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKI 148

Query: 145 RL 146
           RL
Sbjct: 149 RL 150

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 5/106 (4%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
           AP + VKIR Q       ++   +   +    + GV +L+ G       +VL+ +  FG 
Sbjct: 141 APFELVKIRLQ---DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGI 197

Query: 103 YAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
              +     AA        + L  GA+ G V  LL  P D++++R+
Sbjct: 198 IFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87
             P D VK R Q       KY+  L +   V REEG +AL+KG  P
Sbjct: 233 NTPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAP 278

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 201 AADTYGLPWLAA-AASPTAGLVSKAAVFPLDTVRRRLQI-VDAKHIPFFTRDPGAYSALR 258
           + D   LP++    A   AG+     ++PLD V+ R+Q+ V  K  P       A     
Sbjct: 3   SIDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYT 62

Query: 259 GTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITL 297
           G   +     +V+ EG + LYKG+T  +    P   I  
Sbjct: 63  GV--MDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKF 99

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           P  +    GA+AG+   L+ YPLD+++TR+
Sbjct: 10  PFIYQFTAGAIAGVSELLVMYPLDVVKTRM 39

>Kwal_56.23011
          Length = 303

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 44  PMDTVKIRRQLQLASEH--KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG-SLQF 100
           P++ V+IR QLQ AS    +YHG L   R + ++    AL +G   A+ +   +G  + F
Sbjct: 138 PIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQG---ALMRG-FTATTLRTSHGFGIYF 193

Query: 101 GTYAWLNTAAASAGL----PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
            TY  L    A  G+     P       GA +G     +TYP D++++ + A++  +   
Sbjct: 194 LTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVY 253

Query: 157 LRRQ---ARVIWDTEGPAGF 173
            R     A+ I+   GP  F
Sbjct: 254 GRNPLAVAKAIYRERGPRAF 273

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/280 (20%), Positives = 95/280 (33%), Gaps = 34/280 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P D  K+R Q           I    +++ + EG+ A +KG +   A      S QFG  
Sbjct: 43  PFDITKVRLQTSPVPTTAAQVI----KSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVN 98

Query: 104 A----WLNTAAASAGLP-PQAHSLAVGALAGLVSSLLTYPLDLLRTRL----VANRSAHF 154
                W      +   P       A G ++G  ++ L  P++ +R RL     ++ +A +
Sbjct: 99  EALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEY 158

Query: 155 FSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGL------P 208
                 AR +          R                   YET       +G+       
Sbjct: 159 HGSLDCARKLLKQ---GALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPA 215

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W        +G    A  +P D V+  +Q  D    P + R+P           L +A  
Sbjct: 216 WKVCVYGAFSGAFFWAMTYPFDVVKSVMQ-ADKLKNPVYGRNP-----------LAVAKA 263

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
           + R  G  +  KG T  + +S P    T   ++  +RL+ 
Sbjct: 264 IYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLIN 303

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 61/150 (40%), Gaps = 25/150 (16%)

Query: 44  PMDTVKIRRQLQLA---SEHKYHGILHTFRTVAREEGVRALWKG-------NVPASAMYV 93
           P+  +K R QL  A   S  +Y       ++V R EG   L+KG       +V     ++
Sbjct: 195 PIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWL 254

Query: 94  LYGSLQ----------FGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLR 143
           LY  ++          FG Y    T + S  +           LA  V+S+ TYP +++R
Sbjct: 255 LYEQMKRLIKERSIEKFG-YQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVR 313

Query: 144 TRL----VANRSAHFFSLRRQARVIWDTEG 169
           TRL      N    +  L +  +VI   EG
Sbjct: 314 TRLRQTPKENGKRKYTGLVQSFKVIIKEEG 343

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 218 AGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIAS 277
           A  V+  A +P + VR RL+           + P      + T  +     +++ EG+ S
Sbjct: 298 AKFVASIATYPHEVVRTRLR-----------QTPKENGKRKYTGLVQSFKVIIKEEGLFS 346

Query: 278 LYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           +Y GLT  L ++ P ++I    ++  +RLL
Sbjct: 347 MYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 42  TAPMDTVK--IRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQ 99
           T P + V+  +R+  +   + KY G++ +F+ + +EEG+ +++ G  P     V    + 
Sbjct: 306 TYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIM 365

Query: 100 FGTY 103
           FGT+
Sbjct: 366 FGTW 369

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 42/106 (39%), Gaps = 13/106 (12%)

Query: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQ--------IVDAKHIPFFTRDPGA--YSAL 257
           PW+   A    G+       P D V+ RLQ           A +I   +  P +  Y   
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQ 111

Query: 258 RGTRF---LGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
            GT F   LG+  ++ + EG  SL+KGL   L    P   I  + Y
Sbjct: 112 AGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY 157

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 80/213 (37%), Gaps = 28/213 (13%)

Query: 44  PMDTVKIRRQLQLA-----SEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAM 91
           P+D +K R Q   A      +     +L    +++ +EG   LWKG         PA A+
Sbjct: 38  PLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAV 97

Query: 92  YVLYGSLQFGTY----AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLV 147
           Y       F TY    ++L   A S        +   GA A + +  L  P D+++ R+ 
Sbjct: 98  Y-------FATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQ 150

Query: 148 ANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGL 207
            N +    S+   A+ I+  EG   F+                    Y+T T   +  G+
Sbjct: 151 LNTN---ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRYFNPSGV 207

Query: 208 --PWLAAAASPTAGLVSKAAVFPLDTVRRRLQI 238
             P++       +G        PLD ++  LQ+
Sbjct: 208 YNPFIHCLCGGISGAACAGLTTPLDCIKTALQV 240

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 69/207 (33%), Gaps = 31/207 (14%)

Query: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF-------SLRRQARVIWDTEG 169
           P AH L  GA AG+    + +PLD L+TRL A  +           ++ RQ   I   EG
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG 76

Query: 170 PAGFFRXXXXXXXXXXXXXXXXXXXYETCTI-----AADTYGLPWLAAAAS-PTAGLVSK 223
               ++                   YE         A  T    +   A S  TA + + 
Sbjct: 77  SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAAD 136

Query: 224 AAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLT 283
           A + P D +++R+Q+    +I  +      YS                 EG  + Y    
Sbjct: 137 ALMNPFDVIKQRIQL--NTNISVWDTAKRIYS----------------KEGFQAFYSSYP 178

Query: 284 MALCKSTPTTVITLWVYQRCLRLLEPT 310
             L  + P       +Y    R   P+
Sbjct: 179 TTLAINIPFAAFNFGIYDTATRYFNPS 205

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 75/195 (38%), Gaps = 27/195 (13%)

Query: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXX 178
           AH++A G+L G  S  +TYPL  + T L    +     L    + I++  G  G+F    
Sbjct: 13  AHAIA-GSLGGAASIAVTYPLVTITTNLQTKENEARPKL-ETIKEIYNKNGIIGYFLGLE 70

Query: 179 XXXXXXXXXXXXXXXXYETC-----TIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVR 233
                           YE C     T+    Y   W +  AS  AG ++  A  P+    
Sbjct: 71  SAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVAN 130

Query: 234 RRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC-KSTPT 292
            R+ +  + H           S LR        + +V+ +G  +L  GL  AL   S P 
Sbjct: 131 TRMTVAKSNH-----------STLRT------VIDIVKTDGPLTLLNGLKPALVLVSNP- 172

Query: 293 TVITLWVYQRCLRLL 307
            +I   VY++   L+
Sbjct: 173 -IIQYTVYEQLKNLV 186

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 9/108 (8%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R Q+   +   Y   L  ++T+ R EG+  ++ G       Y L G+ ++G Y
Sbjct: 35  PLDLVKCRLQV---NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGY 91

Query: 104 AWLNTAAASAGLPPQAHS------LAVGALAGLVSSLLTYPLDLLRTR 145
            +     ++   P  AH       L   A A  ++ +L  P + ++ +
Sbjct: 92  EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 53/118 (44%), Gaps = 13/118 (11%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
            P + +K+++Q  +    K    L  +  +   EG+  L+KG  P     + Y   +F +
Sbjct: 131 CPWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188

Query: 103 YAWLNTAAASAGLPPQAH----------SLAVGALAGLVSSLLTYPLDLLRTRLVANR 150
           +  +      A LP              S   G LAG++ +++++P D++ +++ A+R
Sbjct: 189 FERI-VEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 213 AASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRA 272
            AS +A  ++   + P + ++ + Q      IP F ++           FL     +  A
Sbjct: 117 CASASAEFLADILLCPWEAIKVKQQTT----IPPFCKN-----------FLEGWSKITAA 161

Query: 273 EGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           EG++ LYKG+T   C+  P T+     ++R + ++
Sbjct: 162 EGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196

>Scas_667.22
          Length = 306

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/279 (20%), Positives = 92/279 (32%), Gaps = 33/279 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R  LQ +S       +   R + + EG +  +KG +          SLQFG  
Sbjct: 45  PFDTTKVR--LQTSSTPTT--AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVN 100

Query: 104 AWL-------NTAAASAGLP-PQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHF 154
             +       N  + S  L  PQ +    G   G+ +S L  P++ +R RL     S   
Sbjct: 101 EAMKRFFHSRNPDSTSQILSLPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPN 158

Query: 155 FSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP------ 208
              +     I       GF R                   YE         G        
Sbjct: 159 VEFKGPLDCIRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPA 218

Query: 209 WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVH 268
           W        +G      V+PLD ++  +Q  + K            S   G     +A  
Sbjct: 219 WKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLK------------SPKYGNSISSVAKT 266

Query: 269 MVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
           +    G+ + +KG    + ++ P    T   ++  +RLL
Sbjct: 267 LYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLL 305

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 15/114 (13%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNV-------PASAMYVL 94
           TAP + +K+   LQ  SE K    +   + +    GV++L+ G++       P SA+Y  
Sbjct: 150 TAPTERIKV--VLQTNSEFK-GSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALY-- 204

Query: 95  YGSLQFGTYAWLNTAAASAGLPPQ--AHSLAVGALAGLVSSLLTYPLDLLRTRL 146
           + S +  + A+LN + A         A+    G +AG+   L+ +P+D ++TRL
Sbjct: 205 FASYEL-SKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRL 257

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 33/84 (39%), Gaps = 8/84 (9%)

Query: 228 PLDTVRRRLQIVDAKH----IPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLT 283
           P D ++ R Q   AK     +    ++  + S + G+    L   +     +   YKG+ 
Sbjct: 41  PFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGS----LTTSLFFKNSVKGFYKGVI 96

Query: 284 MALCKSTPTTVITLWVYQRCLRLL 307
             L   TP   ++ W Y    RL+
Sbjct: 97  PPLIGVTPIFAVSFWGYDIGKRLV 120

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 16/139 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREE---GVR-ALWKGNVPASAMYVLYGSLQ 99
           P + VK R Q      H  H    T R + + E   GVR  L++G        + +  +Q
Sbjct: 113 PAEVVKQRSQ-----THASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQ 167

Query: 100 FGTYAWLNTAAA----SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
           F  Y ++    A    S  + P   ++  G++AG +++  T PLD L+TRL+  + +   
Sbjct: 168 FPLYEYMKKVWAELDESDRVEPWKGAVC-GSIAGGIAAATTTPLDFLKTRLMLCKKS--I 224

Query: 156 SLRRQARVIWDTEGPAGFF 174
            L      I+  EG   FF
Sbjct: 225 PLGTLVSTIYKEEGFKVFF 243

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 72/182 (39%), Gaps = 18/182 (9%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXX 180
           SL  GA AG  + L+ +P+D L+TRL A     FF             G  G +R     
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAK--GGFFR----------NGGYRGVYRGLGSA 55

Query: 181 XXXXXXXXXXXXXXYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD 240
                         Y+TC   A+T G       +S  A +V+      +  +   +  V 
Sbjct: 56  VVASAPGASLFFITYDTC--KAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVP 113

Query: 241 AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGI-ASLYKGLTMALCKSTPTTVITLWV 299
           A+ +   ++   ++S+    R +   +     EG+  +LY+G +  + +  P T I   +
Sbjct: 114 AEVVKQRSQTHASHSSWETLREI---LKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPL 170

Query: 300 YQ 301
           Y+
Sbjct: 171 YE 172

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D +K R Q + A  + Y   L+    +  EEG+   WKG  P      L G + FG
Sbjct: 341 TQPIDVIKTRMQSKYAWAN-YKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFG 399

Query: 102 TYAWLNT 108
            Y ++  
Sbjct: 400 VYQYVEN 406

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/119 (19%), Positives = 52/119 (43%), Gaps = 1/119 (0%)

Query: 58  SEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPP 117
            EH       T + +    G+R   +G  P     +   +++F TY  L    +      
Sbjct: 263 EEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLN 322

Query: 118 QAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS-AHFFSLRRQARVIWDTEGPAGFFR 175
           + ++  +G ++      +T P+D+++TR+ +  + A++ +    A  I+  EG   F++
Sbjct: 323 EYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWK 381

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D +K R Q +  S   Y   ++    +  EEG   LWKG +P      L GS+ FG
Sbjct: 252 TQPLDVIKTRMQAK-DSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFG 310

Query: 102 TYAWLNTAAA 111
            Y +     A
Sbjct: 311 IYQYTENMIA 320

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 64  GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ-AHSL 122
            +L T   + R+ G+RA +KG +P     V    ++F T+  L   A     P +  ++ 
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFA-----PKEYQNNE 234

Query: 123 AVGALAGLVSSLL----TYPLDLLRTRLVANRSAHFF 155
               L GL+SS      T PLD+++TR+ A  S   +
Sbjct: 235 YFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLY 271

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           +  G+++GL S+ +TYP + L+T L  +R+
Sbjct: 13  ITAGSVSGLFSATITYPFEFLKTGLQLHRN 42

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 54/277 (19%), Positives = 90/277 (32%), Gaps = 30/277 (10%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R Q                + + + EG +  +KG +          S+QFG  
Sbjct: 45  PFDTTKVRLQTSKVPTSAAE----VVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVN 100

Query: 104 AWLN------TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL-VANRSAHFFS 156
             +           +A L    + L  G   G+ +S L  P++ +R RL     S     
Sbjct: 101 EAMKRFFHARNVDHNATLSLSQYYLC-GLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAE 159

Query: 157 LRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGL------PWL 210
            +     I       G  R                   YE         GL      PW 
Sbjct: 160 FKGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWK 219

Query: 211 AAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMV 270
                  +G      V+P+D V+  +Q  D  + P             G   + +A ++ 
Sbjct: 220 LCLYGALSGTALWLMVYPIDVVKSVMQ-TDNLNKP-----------QNGKNMIQVARNLY 267

Query: 271 RAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
             EG+ + +KG    + ++ P    T   ++  +RLL
Sbjct: 268 AREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKG 84
           TAP DT+K R QL+     K+    +TF ++ + E V  L+ G
Sbjct: 241 TAPFDTIKTRMQLE---PSKFTNSFNTFTSIVKNENVLKLFSG 280

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 16/78 (20%)

Query: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC 287
           P DT++ R+Q+  +K    FT     ++++            V+ E +  L+ GL+M L 
Sbjct: 243 PFDTIKTRMQLEPSK----FTNSFNTFTSI------------VKNENVLKLFSGLSMRLA 286

Query: 288 KSTPTTVITLWVYQRCLR 305
           +   +  I   +Y+  ++
Sbjct: 287 RKAFSAGIAWGIYEELVK 304

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 116 PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA 152
           P  +  L  G   GL S++   PLDLL+TR+  ++ A
Sbjct: 8   PRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKA 44

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R  LQ +S       +   R +   EG R  +KG +          SLQFG  
Sbjct: 45  PFDTTKVR--LQTSSTPTT--AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVN 100

Query: 104 AWL-------NTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
             +       N   +S    PQ +  A G   G+V+S L  P++ +R RL
Sbjct: 101 EAMKRFFHHRNADMSSTLSLPQYY--ACGVTGGIVNSFLASPIEHVRIRL 148

>Scas_715.45
          Length = 305

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/121 (16%), Positives = 57/121 (47%), Gaps = 13/121 (10%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT 102
            P + +K+++Q  +      + ++  ++ +  +EG+   +KG  P     + Y   +F +
Sbjct: 134 CPFEAIKVKQQTTMPPWC--NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191

Query: 103 YAWLNTAAASAGLPPQAHSLAV----------GALAGLVSSLLTYPLDLLRTRLVANRSA 152
           +  +   A  A LP +   ++           G +AG++ +++++P D++ +++   R  
Sbjct: 192 FERI-VEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKV 250

Query: 153 H 153
           +
Sbjct: 251 N 251

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 3/102 (2%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D VK R Q+   +   Y   L  FR +   EG + ++ G       Y L G+ ++G Y
Sbjct: 38  PLDLVKCRLQV---NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGY 94

Query: 104 AWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTR 145
            +     +S   P     L   A A  ++ ++  P + ++ +
Sbjct: 95  EYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVK 136

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/122 (19%), Positives = 58/122 (47%), Gaps = 14/122 (11%)

Query: 43  APMDTVKIRRQLQLASEHKYHGILHTFRTVAREEG-VRALWKGNVPASAMYVLYGSLQFG 101
            P + +K+++Q  +      + ++  ++ +  E G ++A +KG VP     + Y   +F 
Sbjct: 128 CPFEAIKVKQQTTMPPFC--NNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFT 185

Query: 102 TYAWLNTAAASAGLPPQAH----------SLAVGALAGLVSSLLTYPLDLLRTRLVANRS 151
           ++  +     S  LP +            S   G LAG++ + +++P D++ +++ + R 
Sbjct: 186 SFEKIVQKIYSV-LPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERK 244

Query: 152 AH 153
           A+
Sbjct: 245 AN 246

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 67/143 (46%), Gaps = 16/143 (11%)

Query: 44  PMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG-SLQF 100
           P++ V+IR QLQ  +  + +Y G L   + + ++   +AL +G   A+ M   +G  + F
Sbjct: 138 PIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---KALMRG-FTATLMRTSHGFGVYF 193

Query: 101 GTYAWLNTAAASAG-----LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR---SA 152
            TY  L       G     +PP       GA +G     +TYP D++++ + A+R     
Sbjct: 194 LTYEALIMNQNKNGVLRKDIPPW-KVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPV 252

Query: 153 HFFSLRRQARVIWDTEGPAGFFR 175
           H  ++ + A+ I  T G   F +
Sbjct: 253 HGKNVFQVAKSIHATRGWGAFVK 275

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D +K R  L     HK    LH  +T+ +EEGV+  + G  P +      G++  G
Sbjct: 210 TTPLDVLKTRIMLH----HKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLG 265

Query: 102 TY 103
            Y
Sbjct: 266 VY 267

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           SL  GA AG  + L  +P+D L+TRL A 
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAK 37

>Scas_613.24
          Length = 177

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 116 PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           P  +  L  G + GL S++   PLDLL+TR+  ++ A  +S       I D + P  F+R
Sbjct: 6   PKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWS------AIKDIKDPIQFWR 59

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 14/139 (10%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVARE---EGV-RALWKGNVPASAMYVLYGSLQ 99
           P + +K R Q      H  +  L T R + R+   EGV R L++G        + +  +Q
Sbjct: 113 PAEVIKQRTQ-----THHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQ 167

Query: 100 FGTYAWLNTAAASAGLPPQA---HSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
           F  Y +L    A+     +         G+LAG +++  T PLD+L+TR++ +       
Sbjct: 168 FPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERR--VP 225

Query: 157 LRRQARVIWDTEGPAGFFR 175
           +   AR ++  EG   FFR
Sbjct: 226 MLHLARTLFREEGARVFFR 244

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D +K R  L      +   +LH  RT+ REEG R  ++G  P +      G++  G Y
Sbjct: 209 PLDVLKTRMMLH----ERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVY 264

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVAN 149
           SL  GA AG  + ++ +P+D L+TRL A 
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAK 36

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 69/215 (32%), Gaps = 38/215 (17%)

Query: 115 LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS-------AHFFSLRRQARVIWDT 167
           L     SLA G + G+ + L  +P DL++ R  +N++       +H     RQA      
Sbjct: 25  LTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSL 84

Query: 168 EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGL----------PWLAAAASPT 217
               GF++                   Y+       +             P L  +    
Sbjct: 85  NAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAA 144

Query: 218 AGLVSKA----AVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAE 273
           AG +S         P + V+  LQ    K                   FL  A  +VR +
Sbjct: 145 AGFISAIPTTLVTAPTERVKVVLQTTQGK-----------------ASFLDAAKQIVRTQ 187

Query: 274 GIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
           G  SL+KG    L +  P + +    Y+ C   L 
Sbjct: 188 GFQSLFKGSLATLSRDGPGSALYFASYEICKEYLN 222

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 60/146 (41%), Gaps = 21/146 (14%)

Query: 46  DTVKIRRQ----LQLASEHKYHGILHTFRTVAREEGVRAL----WKGNVPASAMYVLYGS 97
           D + IR Q    L L     Y   +     + + EG ++L    WK N+      VL  +
Sbjct: 120 DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRG---VLMTA 176

Query: 98  LQFGTYAWL-NTAAASAGLPPQAHS--LAVGALAGLVSSLLTYPLDLLRTRLVANRSA-- 152
            Q  TY    N       + P+ +S  L    LAG V++ +  P D+++T +V N     
Sbjct: 177 SQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKT-IVMNAHKKP 235

Query: 153 ---HFFSLRRQARVIWDTEGPAGFFR 175
              H  S +     I + EGP+  FR
Sbjct: 236 GHNHDSSFKILMEAI-NKEGPSFMFR 260

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 54/145 (37%), Gaps = 20/145 (13%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D  K+R Q   A+      I+   R++ + EG+  L+ G   +      Y + +FG
Sbjct: 24  THPLDLTKVRLQ---AAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFG 80

Query: 102 TYAWLNTAAASAGLPPQ-----AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFS 156
            Y  L                   S+  GAL GL  +      DL+  R+  N SA    
Sbjct: 81  MYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRM-QNDSALPLD 135

Query: 157 LRRQAR-------VIWDTEGPAGFF 174
            RR  +        I+  EG    F
Sbjct: 136 KRRNYKNAIDGMVKIYKAEGAKSLF 160

>AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH]
           complement(1112020..1113423) [1404 bp, 467 aa]
          Length = 467

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 47/112 (41%), Gaps = 23/112 (20%)

Query: 66  LHT---FRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGL------- 115
           LHT      V  +EG R +W+ N        +Y  L     AW  T   S  L       
Sbjct: 206 LHTMDVLNAVMDKEGTRGVWRAN----NTIFIYNFLSESLDAWF-TGLLSPFLQIPDPYF 260

Query: 116 ------PPQAHSLAVGALAGLVSSLLTYPLDLLRTRLV--ANRSAHFFSLRR 159
                 P    S+A+   A + + L+  PLD+++TRLV  A  S H  SLRR
Sbjct: 261 IDIINSPDVQKSVALTFAAAIFTGLVLLPLDVIKTRLVVGAVASTHERSLRR 312

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 22/111 (19%)

Query: 51  RRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAA 110
            R +   S+H     L    ++  EEG++ LWK N       +L  +L+    AW  T  
Sbjct: 226 ERSINPESKH----TLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLE----AWY-TGL 276

Query: 111 ASAGLP------------PQAHSLAVGALA-GLVSSLLTYPLDLLRTRLVA 148
            S  L             P   S  +  L+ G++++L   P+DL+RTR + 
Sbjct: 277 ISPLLHIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRFIV 327

>Kwal_55.21338
          Length = 323

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 64  GILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYA----WLNTAAASAGLPPQA 119
           G L T   + ++EG+  L+KG  PA  + V+   +Q+  Y     W+ ++  +  L P +
Sbjct: 154 GTLSTIFDIVKDEGISGLFKGLNPA-LILVINPIIQYTVYEQLKNWILSSRQTRTLSP-S 211

Query: 120 HSLAVGALAGLVSSLLTYPLDLLRTRL 146
            +  +GA+  L ++  TYP   ++ R+
Sbjct: 212 WAFILGAVGKLAATGSTYPYVTMKARM 238

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 60/165 (36%), Gaps = 27/165 (16%)

Query: 131 VSSLLTYPLDLLRTRL-VANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXX 189
           +S  LTYPL ++ T+L   +      SL    + I+  +G  GFF               
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNF 94

Query: 190 XXXXXYET---CTIAADTYGLPWLAAAAS----PTAGLVSKAAVFPLDTVRRRLQIVDAK 242
                YE    C + A       L  A S      AG ++  A  PL     R+ +  + 
Sbjct: 95  VYYYCYEASSRCVLRAR--HTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD 152

Query: 243 HIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALC 287
                          RGT  L     +V+ EGI+ L+KGL  AL 
Sbjct: 153 ---------------RGT--LSTIFDIVKDEGISGLFKGLNPALI 180

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 103/266 (38%), Gaps = 35/266 (13%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGS-LQF 100
           T P+  V  + Q Q A   K   +  T + + R++G    + G   A     L+G+ L  
Sbjct: 40  TYPLIVVTTKLQTQDAKGEKL-SLADTIKDIYRKDGAMGFFAGLESA-----LFGTTLSN 93

Query: 101 GTYAWLNTAAASAGLPPQ-------AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAH 153
             Y +   A++   L  +       A S+ VG++AG +++    PL +  TR+   +S  
Sbjct: 94  FVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD- 152

Query: 154 FFSLRRQARVIWDT---EGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLPWL 210
               R     I+D    EG +G F+                    +       +     L
Sbjct: 153 ----RGTLSTIFDIVKDEGISGLFKGLNPALILVINPIIQYTVYEQLKNWILSSRQTRTL 208

Query: 211 AAAASPTAGLVSKAA----VFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLA 266
           + + +   G V K A     +P  T++ R+ ++  +H       P +         L L 
Sbjct: 209 SPSWAFILGAVGKLAATGSTYPYVTMKARMHLL-GEHKSSTAAPPRS--------LLSLM 259

Query: 267 VHMVRAEGIASLYKGLTMALCKSTPT 292
             +++ +GI  LY+G+ + L +S  T
Sbjct: 260 AEIIKKDGILGLYRGIGIKLVQSILT 285

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 113/274 (41%), Gaps = 39/274 (14%)

Query: 42  TAPMDTVKIRRQLQLASEH-KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           T P+ T+  + Q Q   E+ +    L T + + R++G+   + G    SA+Y +  +L  
Sbjct: 31  TYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAG--LESAIYGM--ALTN 86

Query: 101 GTYAWLNTAAASAGLPPQAH-------SLAVGALAGLVSSLLTYPLDLLRTRLVANRS-- 151
             Y +     +   L  + H       S+  G +AG V+++ + P+ +  TR+   +S  
Sbjct: 87  FVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSEK 146

Query: 152 ---AHFFSLRRQ--ARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYG 206
              A    + ++  A+ +++   PA                        +   +A +  G
Sbjct: 147 TALATIIEIVKKDSAKTLFNGLKPA-------LVLVMNPIVQYTVFEQLKNLVLAWNKQG 199

Query: 207 L--PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDA-KHIPFFTRDPGAYSALRGTR-- 261
           +  P  A        L +  + +P  T++ R+ + ++ KH    T D     A +G +  
Sbjct: 200 ILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKH----TDDDSGKKA-KGHKAS 254

Query: 262 ---FLGLAVHMVRAEGIASLYKGLTMALCKSTPT 292
               L L   +V+ +G++ LY+G+ + L +S  T
Sbjct: 255 SKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILT 288

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+D VK R   Q A + +Y   L+    +  +EG+   WKG++       + G L F 
Sbjct: 212 TQPIDVVKTRMMSQNA-KTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFT 270

Query: 102 TY 103
            Y
Sbjct: 271 VY 272

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 12/142 (8%)

Query: 43  APMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQF 100
           +P++ V+IR Q Q  +    ++HG L   + +       +L +G  P          + F
Sbjct: 139 SPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYF 195

Query: 101 GTYAWLNTAAASAGLP----PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVAN---RSAH 153
            TY  L       G+     P       GA +G    L+ YPLD++++ +  +   +   
Sbjct: 196 LTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQ 255

Query: 154 FFSLRRQARVIWDTEGPAGFFR 175
             ++ + A+ I+ T G + FF+
Sbjct: 256 GKNMLQVAKTIYSTRGLSSFFK 277

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 39/97 (40%), Gaps = 21/97 (21%)

Query: 66  LHTF---RTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGL------- 115
           LHT     +V  EEG R LW+ N        +Y  L     AW  T   S  L       
Sbjct: 231 LHTMDIMNSVMDEEGTRGLWRANNTT----FIYNFLSATLDAWF-TGMLSPFLQIPDPYF 285

Query: 116 ------PPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146
                 P    S+A+   A + + +   PLDL++TRL
Sbjct: 286 IDIIHSPDPQKSIALTLAASVFTGIALLPLDLIKTRL 322

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 135 LTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           L  PL++++T + ANRS  FF+  +    +W   G  GF++
Sbjct: 35  LGQPLEVIKTTMAANRSFSFFNAIKH---VWSRGGVFGFYQ 72

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 58/296 (19%), Positives = 109/296 (36%), Gaps = 59/296 (19%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P+D +K R Q          G L  ++TV   +    LW+G +P++    +  +L   + 
Sbjct: 24  PLDLLKTRFQ------QTKGGTL--WQTVKSLDTPWQLWRGTLPSAIRTSVGSALYLSSL 75

Query: 104 AWLNTAAA---------------SAGLPPQA--HSLAVGALAGLVSSLLTYPLDLLRTRL 146
             + TA A               S+ LP  +   +L  GA A      +T P+ +++ R 
Sbjct: 76  NLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRY 135

Query: 147 VANRSAHFFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCT------- 199
            +    ++ S+   A+ I   EG  GFFR                   YE          
Sbjct: 136 ESTL-YNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTIL 194

Query: 200 ----IAADTYG--LPWLAAAASPTAGLVSKA----AVFPLDTVRRRLQIVDAKHIPFFTR 249
               +  D+ G    + + A + T+ ++S +       P DT++ R+Q+   K   F++ 
Sbjct: 195 PKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWST 254

Query: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLR 305
                              +V  E    ++ GL+M L +   +  I   +Y+  ++
Sbjct: 255 ----------------LTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIK 294

>Scas_705.9
          Length = 323

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 3/60 (5%)

Query: 42  TAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFG 101
           T P+   K+  Q    S  K+       R + +EEGV ALWKG  P     VL   L F 
Sbjct: 240 TQPLIVAKVSLQ---RSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFA 296

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 53/286 (18%), Positives = 95/286 (33%), Gaps = 48/286 (16%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P DT K+R Q    S +     +   + + + EG    +KG +          SLQFG  
Sbjct: 43  PFDTTKVRLQTSETSTNA----VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVN 98

Query: 104 AWLN------TAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSL 157
             +         AAS  L    + +  G   G  +S L  P++ +R RL     +     
Sbjct: 99  EAMKRFFHTFDEAASQHLSLLQYYIC-GVAGGFTNSFLASPIEHIRIRLQTQTGSG---- 153

Query: 158 RRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTY------------ 205
                   + +GP    +                      C +   TY            
Sbjct: 154 -----ATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGI 208

Query: 206 ---GLP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTR 261
               +P W        +G +    V+PLD ++  +Q  + K            +   G  
Sbjct: 209 QRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK------------TPKNGNN 256

Query: 262 FLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307
            L +   ++  +G++ L+KG    + ++ P    T   ++  +RLL
Sbjct: 257 ILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLL 302

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 55/281 (19%), Positives = 90/281 (32%), Gaps = 36/281 (12%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTY 103
           P D  K+R Q    S       +    ++ + EG+   +KG +          S QFG  
Sbjct: 43  PFDITKVRMQTSAGSATA----VDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFG-- 96

Query: 104 AWLNTAAAS-----AGLPPQAHSL----AVGALAGLVSSLLTYPLDLLRTRL-VANRSAH 153
             +N A         G P +  SL      G  +G  ++ L  P++ +R RL +  +S  
Sbjct: 97  --VNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLA 154

Query: 154 FFSLRRQARVIWDTEGPAGFFRXXXXXXXXXXXXXXXXXXXYETCTIAADTYGLP----- 208
               +     +          R                   YE         G+P     
Sbjct: 155 NAEYQGSLDCMRKLLKQGALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIA 214

Query: 209 -WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267
            W        +G    A  +P+D V+  +Q                 S + GT    +A 
Sbjct: 215 PWKVCIFGAFSGACYWAMAYPIDVVKSIMQ------------SDRLVSPVHGTNVWQVAK 262

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308
            +    G  +  KG   A+ +S P    T   ++  +RLLE
Sbjct: 263 SIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLE 303

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 44  PMDTVKIRRQLQLASEHKYHGILHTFRTVAREEG----VRALWKGNVPASAMYVLYGSLQ 99
           P + +K R Q      HK +    TF  + + E     +R L++G        + +  +Q
Sbjct: 115 PAEVIKQRTQ-----THKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQ 169

Query: 100 FGTYAWLNTAAASAG----LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFF 155
           F  Y +L    A       + P   S+  G++AG +++  T PLD+L+TRL+ +  +   
Sbjct: 170 FPLYEFLKKTWAKRNGQDHVAPWQGSVC-GSVAGAIAAATTTPLDVLKTRLMLSHKS--I 226

Query: 156 SLRRQARVIWDTEGPAGFF 174
            + + A+ I+  EG   FF
Sbjct: 227 PVAQLAKNIYAEEGFKVFF 245

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 121 SLAVGALAGLVSSLLTYPLDLLRTRLVA 148
           SLA GA AG  + L  +P+D L+TRL A
Sbjct: 9   SLASGAAAGTSTDLAFFPIDTLKTRLQA 36

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 211 AAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLA---V 267
           +A     A  ++  AV+PLD  +    I+ ++  P  + D      L   R+  +    +
Sbjct: 6   SALTGAVASAMANIAVYPLDLSKT---IIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMI 62

Query: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVY 300
           ++ + +GI  LY+G+T+    +T  T +  +VY
Sbjct: 63  NIFKEKGILGLYQGMTV----TTVATFVQNFVY 91

>Scas_696.9
          Length = 312

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 135 LTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           L  PL++++T + ANR+ +F +     + +W   G  GF++
Sbjct: 35  LGQPLEVVKTTMAANRNLNFVN---SMKYVWSRGGIVGFYQ 72

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 107 NTAAASA--GLPPQAHSLAVGALAGLVS-SLLTYPLDLLRTRLVANRSAHFFSLRRQARV 163
           NTAAA+     P    ++ +GA   L   + L  PL++++T + ANR+   F+     + 
Sbjct: 6   NTAAANVIEKKPVSFSNILLGACLNLSEVTTLGQPLEVVKTTMAANRN---FTFLESVKH 62

Query: 164 IWDTEGPAGFFR 175
           +W   G  G+++
Sbjct: 63  VWSRGGILGYYQ 74

>Kwal_34.15907
          Length = 312

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 132 SSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFR 175
           ++ L  PL++++T + ANR+ +F    +  + +W   G  GF++
Sbjct: 32  ATTLGQPLEVIKTTMAANRNLNF---GQSVKHVWSRGGVFGFYQ 72

>Scas_660.17
          Length = 497

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 122 LAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVI-----WDTEGP 170
           + +   A ++++L+  P+DL++ RL+   +    + RR  R +     W  +GP
Sbjct: 305 ILINLTAAILTNLVLIPMDLIKLRLIVTSTMESSNKRRSLRRLITKWSWRNDGP 358

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,914,910
Number of extensions: 252175
Number of successful extensions: 1803
Number of sequences better than 10.0: 196
Number of HSP's gapped: 1428
Number of HSP's successfully gapped: 552
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)