Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAR034W1098107854880.0
Sklu_1989.21104106743750.0
KLLA0D14971g1091107843740.0
CAGL0G03091g110596243240.0
Kwal_23.39721100105542760.0
YGR094W (VAS1)1104104242580.0
Scas_705.21106196442520.0
Scas_716.31*101996533020.0
Scas_97.1*26125911001e-142
CAGL0G03311g10728564485e-45
YBL076C (ILS1)10728604316e-43
Scas_599.1310718584121e-40
KLLA0E20625g10738634022e-39
AER394W10728553952e-38
AGL247C9888403923e-38
Kwal_27.1081110998583915e-38
YPL040C (ISM1)10028963824e-37
CAGL0L12606g9828263807e-37
KLLA0D11858g9908633762e-36
Scas_568.310018273728e-36
Kwal_27.118279858143522e-33
KLLA0E05269g8754062662e-23
YLR382C (NAM2)8943982217e-18
AER043C8738252092e-16
Kwal_26.93748844771903e-14
CAGL0H05049g9078221861e-13
Scas_719.59398471797e-13
Sklu_2298.210964201035e-04
AAL088W1104581010.001
KLLA0D06105g1095361960.004
Scas_650.7111951920.012
CAGL0J03652g109351910.016
YPL160W (CDC60)109051890.027
Kwal_26.8831916157850.077
AAL133W56765820.14
Kwal_33.15315583138820.15
KLLA0F14971g568132790.33
Scas_620.7576123780.45
Sklu_2399.657484770.61
CAGL0G02057g274152721.9
Sklu_2208.435659722.1
YOR195W (SLK19)82138703.9
YGR171C (MSM1)57547704.6
YGR136W (LSB1)24182685.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAR034W
         (1078 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH] complement(4...  2118   0.0  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement       1689   0.0  
KLLA0D14971g 1263323..1266598 highly similar to sp|P07806 Saccha...  1689   0.0  
CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharo...  1670   0.0  
Kwal_23.3972                                                         1651   0.0  
YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetas...  1644   0.0  
Scas_705.21                                                          1642   0.0  
Scas_716.31*                                                         1276   0.0  
Scas_97.1*                                                            428   e-142
CAGL0G03311g 315470..318688 highly similar to sp|P09436 Saccharo...   177   5e-45
YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRN...   170   6e-43
Scas_599.13                                                           163   1e-40
KLLA0E20625g 1825036..1828257 highly similar to sp|P09436 Saccha...   159   2e-39
AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH] complement(...   156   2e-38
AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH] (237045..24...   155   3e-38
Kwal_27.10811                                                         155   5e-38
YPL040C (ISM1) [5399] chr16 complement(475988..478996) Isoleucyl...   151   4e-37
CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces...   150   7e-37
KLLA0D11858g complement(1010259..1013231) similar to sp|P48526 S...   149   2e-36
Scas_568.3                                                            147   8e-36
Kwal_27.11827                                                         140   2e-33
KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces c...   107   2e-23
YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tR...    90   7e-18
AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH] (711416..71...    85   2e-16
Kwal_26.9374                                                           78   3e-14
CAGL0H05049g complement(483870..486593) similar to sp|P11325 Sac...    76   1e-13
Scas_719.5                                                             74   7e-13
Sklu_2298.2 YPL160W, Contig c2298 4548-7838                            44   5e-04
AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH] complement(1...    44   0.001
KLLA0D06105g complement(522480..525767) highly similar to sp|P26...    42   0.004
Scas_650.7                                                             40   0.012
CAGL0J03652g 346614..349895 highly similar to sp|P26637 Saccharo...    40   0.016
YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA synthe...    39   0.027
Kwal_26.8831                                                           37   0.077
AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH] complement(11...    36   0.14 
Kwal_33.15315                                                          36   0.15 
KLLA0F14971g complement(1386169..1387875) similar to sp|P22438 S...    35   0.33 
Scas_620.7                                                             35   0.45 
Sklu_2399.6 YGR171C, Contig c2399 15064-16788                          34   0.61 
CAGL0G02057g complement(181467..182291) similar to sp|P36025 Sac...    32   1.9  
Sklu_2208.4 YDR322W, Contig c2208 7462-8532                            32   2.1  
YOR195W (SLK19) [4991] chr15 (712866..715331) Protein involved w...    32   3.9  
YGR171C (MSM1) [2124] chr7 complement(840827..842554) Methionyl-...    32   4.6  
YGR136W (LSB1) [2093] chr7 (762431..763156) Protein with weak si...    31   5.7  

>AAR034W [220] [Homologous to ScYGR094W (VAS1) - SH]
            complement(402706..406002) [3297 bp, 1098 aa]
          Length = 1098

 Score = 2118 bits (5488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1026/1078 (95%), Positives = 1026/1078 (95%)

Query: 1    MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTEQQLPEVDANGEIIINPLKE 60
            MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTEQQLPEVDANGEIIINPLKE
Sbjct: 1    MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTEQQLPEVDANGEIIINPLKE 60

Query: 61   DGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDE 120
            DGSP                                                    FVDE
Sbjct: 61   DGSPKTAKEVEKERKKAEKLLKFAAKQAKKAENKANQQKNQTKKEKKKKETEAVVEFVDE 120

Query: 121  TVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAP 180
            TVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAP
Sbjct: 121  TVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAP 180

Query: 181  PPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKK 240
            PPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKK
Sbjct: 181  PPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKK 240

Query: 241  TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300
            TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL
Sbjct: 241  TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300

Query: 301  HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPV 360
            HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPV
Sbjct: 301  HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPV 360

Query: 361  VDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDM 420
            VDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDM
Sbjct: 361  VDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDM 420

Query: 421  EFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIE 480
            EFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIE
Sbjct: 421  EFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIE 480

Query: 481  KLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITP 540
            KLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITP
Sbjct: 481  KLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITP 540

Query: 541  KSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQK 600
            KSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQK
Sbjct: 541  KSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQK 600

Query: 601  KAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILY 660
            KAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILY
Sbjct: 601  KAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILY 660

Query: 661  FWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHA 720
            FWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHA
Sbjct: 661  FWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHA 720

Query: 721  TLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYR 780
            TLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYR
Sbjct: 721  TLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYR 780

Query: 781  KFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDF 840
            KFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDF
Sbjct: 781  KFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDF 840

Query: 841  LTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFIS 900
            LTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFIS
Sbjct: 841  LTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFIS 900

Query: 901  EEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVK 960
            EEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVK
Sbjct: 901  EEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVK 960

Query: 961  NGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNV 1020
            NGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNV
Sbjct: 961  NGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNV 1020

Query: 1021 HALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDS 1078
            HALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDS
Sbjct: 1021 HALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDS 1078

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 1689 bits (4375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 811/1067 (76%), Positives = 909/1067 (85%), Gaps = 4/1067 (0%)

Query: 13   LLKQQLFRSTAPRSIFERIRPQSVAMSTEQQLPEVD-ANGEIIINPLKEDGSPXXXXXXX 71
            LLK+Q++RST+  +       ++   + +Q LP VD   GEIIINPLKEDG+        
Sbjct: 21   LLKRQVYRSTSILTHRSYSTNKNKMGADQQNLPPVDPKTGEIIINPLKEDGT-AKTPKEI 79

Query: 72   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDETVPGEKKILKS 131
                                                         FVD+TVPGEKKIL S
Sbjct: 80   EKERKKAEKLLKFAAKQAKKAAATKTASTAPKKEKKKKEVEPIPEFVDKTVPGEKKILVS 139

Query: 132  LDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAPPPNVTGALHIG 191
            LDDPALKAYNPANVESSWY+WWVKSG FEPE TKDGK+KPEG+FCIPAPPPNVTGALHIG
Sbjct: 140  LDDPALKAYNPANVESSWYEWWVKSGLFEPEFTKDGKVKPEGLFCIPAPPPNVTGALHIG 199

Query: 192  HALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTRHDYGREEFV 251
            HALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWA EKKTRHDYGREEFV
Sbjct: 200  HALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKEKKTRHDYGREEFV 259

Query: 252  KKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASR 311
             KVW+WKE YH +IK Q+++LGASYDW REAFTLDP+LS +VTEAFVRLHEEG+IYRASR
Sbjct: 260  GKVWEWKEEYHGRIKGQIKKLGASYDWKREAFTLDPKLSTAVTEAFVRLHEEGIIYRASR 319

Query: 312  LVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIIAT 371
            L+NWSVKLNTAISNLEVENK++  +TLLSVPGYDEKVEFGVLTSFAY VVDSDEKLIIAT
Sbjct: 320  LINWSVKLNTAISNLEVENKDVKARTLLSVPGYDEKVEFGVLTSFAYQVVDSDEKLIIAT 379

Query: 372  TRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITP 431
            TRPETMFGDTAIA+HP+DPRYKHLHGKFVQHPFLPRK+PIVCD+EAVDMEFGTGAVKITP
Sbjct: 380  TRPETMFGDTAIAVHPEDPRYKHLHGKFVQHPFLPRKLPIVCDSEAVDMEFGTGAVKITP 439

Query: 432  GHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQ 491
             HDQNDYNTGKRH+LE INILTDDGLLNENCGPEW GMKRFDARK+V+E+L+  GL++ Q
Sbjct: 440  AHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWCGMKRFDARKKVVEELKNAGLYIGQ 499

Query: 492  QDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITPKSSASEYFHWL 551
            +DNEM IP CSRSGD+IEP+LKPQWWVSQ EMAKEAI AV++G ITITPKSS SEYFHWL
Sbjct: 500  EDNEMTIPICSRSGDIIEPLLKPQWWVSQTEMAKEAIKAVRNGDITITPKSSESEYFHWL 559

Query: 552  ENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVY 611
            ENIQDWCISRQLWWGHRCPVYFV IEG++  +N+G YWVSGR  EEA++KAA+ F  + Y
Sbjct: 560  ENIQDWCISRQLWWGHRCPVYFVKIEGEDNDKNDGKYWVSGRTTEEAEEKAAKAFSGKKY 619

Query: 612  TLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGI 671
            TLEQDEDVLDTWFSSGLWPFSTLGWP+KTPDM  FYPFSMLETGWDIL+FWV+RMILLG+
Sbjct: 620  TLEQDEDVLDTWFSSGLWPFSTLGWPEKTPDMENFYPFSMLETGWDILFFWVSRMILLGL 679

Query: 672  KLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPRE 731
            KLTG++PF EVFCHSLVRDAQGRKMSKSLGNVVDPL VI G  LE+LHA L  GNLDPRE
Sbjct: 680  KLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVIGGIKLEDLHAKLLLGNLDPRE 739

Query: 732  VEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK 791
            VEKAK GQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK
Sbjct: 740  VEKAKTGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATK 799

Query: 792  FALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFW 851
            FALMRLGDDY PPAEE+LSG ESLVE+WILH+L++ +KTVNEA DKRDFL STSAIY+FW
Sbjct: 800  FALMRLGDDYQPPAEEKLSGKESLVEQWILHKLTNYSKTVNEALDKRDFLNSTSAIYEFW 859

Query: 852  YLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRA 911
            YLICD+YIENSK+LI EG+++EKKSARDTLY L+DNAL++IHPFMPFISEEMWQHLPKR 
Sbjct: 860  YLICDIYIENSKHLINEGSEVEKKSARDTLYILLDNALKMIHPFMPFISEEMWQHLPKRV 919

Query: 912  SETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGN 971
            SE S SIVKA YPV++ +F +E++A DY  VL  TKEARSLLA+Y+I+KNGKVFIE   N
Sbjct: 920  SEVSPSIVKASYPVYKAEFDNEKAATDYEFVLDVTKEARSLLAQYSILKNGKVFIET--N 977

Query: 972  NDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDID 1031
            ND +F    SQ  S+VSLIKAID+VTVVRSA+++PEG VL +VTP+VNVH LVKG VDID
Sbjct: 978  NDSLFKTAASQKDSVVSLIKAIDEVTVVRSASDVPEGAVLQAVTPEVNVHVLVKGHVDID 1037

Query: 1032 TEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDS 1078
             EI K  KKL+KAQKSK+ IEK++ S DYE KANEQAK++NK +L++
Sbjct: 1038 AEISKTQKKLEKAQKSKQGIEKIINSKDYEAKANEQAKESNKIKLEN 1084

>KLLA0D14971g 1263323..1266598 highly similar to sp|P07806
            Saccharomyces cerevisiae YGR094w VAS1 valyl-tRNA
            synthetase, start by similarity
          Length = 1091

 Score = 1689 bits (4374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 811/1078 (75%), Positives = 910/1078 (84%), Gaps = 13/1078 (1%)

Query: 1    MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTE--QQLPEVD-ANGEIIINP 57
            MLR    + +F+LL+ QL   T+  SI  R       MSTE  Q LP+VD   GEIIINP
Sbjct: 1    MLR-LFPTRTFNLLRTQLL-PTSSLSITIR------KMSTEPKQDLPQVDEKTGEIIINP 52

Query: 58   LKEDGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 117
            LKEDG+                                                     F
Sbjct: 53   LKEDGTQKSPKEIEKEKKKAEKLLKFAAKQAKQAQNQAGQAKNAAKKEKKKKETEPIPEF 112

Query: 118  VDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCI 177
            VD+TV GEKKIL SLDDPALKAYNPANVESSWY+WW KSGFFEPE TKDGKIKPEG+F I
Sbjct: 113  VDKTVAGEKKILVSLDDPALKAYNPANVESSWYEWWNKSGFFEPEFTKDGKIKPEGVFTI 172

Query: 178  PAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAN 237
            PAPPPNVTG+LHIGHALTIAIQDSL RY RMKGKTVLFLPGFDHAGIATQSVVEKQIWA+
Sbjct: 173  PAPPPNVTGSLHIGHALTIAIQDSLCRYYRMKGKTVLFLPGFDHAGIATQSVVEKQIWAS 232

Query: 238  EKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAF 297
            EKKTRHDYGREEFV KVW+WKE YH KIK+QV++LGASYDWSREAFTLDP+LS++V EAF
Sbjct: 233  EKKTRHDYGREEFVDKVWEWKEEYHKKIKNQVKKLGASYDWSREAFTLDPKLSKAVVEAF 292

Query: 298  VRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFA 357
            V+LHEEG+IYRA+RLVNWSVKLNTAISNLEVENK+I GKTLLSVPGYDEKVEFGVLTSF+
Sbjct: 293  VKLHEEGIIYRAARLVNWSVKLNTAISNLEVENKDIKGKTLLSVPGYDEKVEFGVLTSFS 352

Query: 358  YPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEA 417
            YPVV SDEKLI+ATTRPETMFGDTA+AIHPDD RYKHLHG FVQHPFL RKMPIVCDAEA
Sbjct: 353  YPVVGSDEKLIVATTRPETMFGDTAVAIHPDDERYKHLHGHFVQHPFLNRKMPIVCDAEA 412

Query: 418  VDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKR 477
            VDMEFGTGAVKITP HDQNDYNTG RH+LE+IN  TDDGLLNENCGPEW+G +RFDARK 
Sbjct: 413  VDMEFGTGAVKITPAHDQNDYNTGLRHNLEVINTFTDDGLLNENCGPEWEGTRRFDARKL 472

Query: 478  VIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRIT 537
            VIEKL+E GLFV Q+DNEM IPTCSRSGD+IEP+LKPQWWVSQ +MA+EAI  V++G IT
Sbjct: 473  VIEKLKEKGLFVGQKDNEMTIPTCSRSGDIIEPLLKPQWWVSQKQMAEEAIKVVRNGEIT 532

Query: 538  ITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEE 597
            ITPKSS SEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEG+E  RN+ ++WVSGRNLEE
Sbjct: 533  ITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGEENDRNDNSFWVSGRNLEE 592

Query: 598  AQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWD 657
            A+ KAA KF ++ YTLEQDEDVLDTWFSSGL+PFSTLGWPDKTPDMS FYP SMLETGWD
Sbjct: 593  AEAKAATKFADKKYTLEQDEDVLDTWFSSGLYPFSTLGWPDKTPDMSQFYPASMLETGWD 652

Query: 658  ILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEE 717
            IL+FWV+RMILLG+KLTG++PF EVFCHSLVRDAQGRKMSKSLGNVVDPL VI+G  LE+
Sbjct: 653  ILFFWVSRMILLGLKLTGSIPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIKLED 712

Query: 718  LHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVE 777
            LHA L +GNLDPREVEKAK GQKESYP+GIP+CGTDALRFALCAYTTGGRDINLDILRVE
Sbjct: 713  LHAKLLQGNLDPREVEKAKNGQKESYPHGIPECGTDALRFALCAYTTGGRDINLDILRVE 772

Query: 778  GYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDK 837
            GYRKFCNKIYQATKFAL+RLGDDY PPA E LSGNESLVEKWILHEL+ TAK VNEAF+K
Sbjct: 773  GYRKFCNKIYQATKFALLRLGDDYKPPASEALSGNESLVEKWILHELTETAKNVNEAFEK 832

Query: 838  RDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMP 897
            RDFL STSAIY+FWYL+CDVYIENSKYLIQEGT++++KSA+DTLY L+DNAL++IHPFMP
Sbjct: 833  RDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTEVQQKSAKDTLYILIDNALKMIHPFMP 892

Query: 898  FISEEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEYN 957
            FISEEMWQHLP+ ASETS +IVK+ YP F+++F +  +A +Y L+L+ TK+ARSLLA+YN
Sbjct: 893  FISEEMWQHLPRYASETSPTIVKSSYPTFKEEFHNPSAAKEYELILNVTKDARSLLAQYN 952

Query: 958  IVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPD 1017
            I+KNGKVF+E    N+  ++ + SQ  SIVSLIKAID+V+VV+SA +IP+GCVL SV P+
Sbjct: 953  ILKNGKVFVE--SANESYYSTVQSQKDSIVSLIKAIDEVSVVKSAADIPQGCVLQSVNPE 1010

Query: 1018 VNVHALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDR 1075
            VNVH LVKG VDID EI K  KKLDK  KSK AI+K+V SSDYE KAN+Q K+ NK+R
Sbjct: 1011 VNVHVLVKGHVDIDAEISKVQKKLDKTLKSKSAIDKIVNSSDYEQKANDQVKQFNKER 1068

>CAGL0G03091g 286259..289576 highly similar to sp|P07806 Saccharomyces
            cerevisiae YGR094w VAS1 valyl-tRNA synthetase,
            hypothetical start
          Length = 1105

 Score = 1670 bits (4324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/962 (80%), Positives = 873/962 (90%), Gaps = 2/962 (0%)

Query: 117  FVDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFC 176
            FVD TVPGEKKIL SLDDPALKAYNPANVESSWYDWWVKSG F+PE T DGK+KPEG+FC
Sbjct: 126  FVDATVPGEKKILVSLDDPALKAYNPANVESSWYDWWVKSGAFDPEFTADGKVKPEGLFC 185

Query: 177  IPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWA 236
            IPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ+WA
Sbjct: 186  IPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQLWA 245

Query: 237  NEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEA 296
             EKKTRHD+GR +FV+KVW+WKE YH +IK+Q++ LGASYDW+REAFTLDP+LS+SV EA
Sbjct: 246  KEKKTRHDFGRTKFVEKVWEWKEEYHQRIKNQIKFLGASYDWNREAFTLDPQLSKSVVEA 305

Query: 297  FVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSF 356
            FVRLH++G IYRA+RLVNWSVKLNTAISNLEVENK++ G+TLLSVP YDEKVEFGVLTSF
Sbjct: 306  FVRLHDDGTIYRAARLVNWSVKLNTAISNLEVENKDVKGRTLLSVPNYDEKVEFGVLTSF 365

Query: 357  AYPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAE 416
            AYPV DSDEKL+IATTRPET+FGDTAIA+HPDD RYKHLHGKFVQHPFLPRK+PI+CD+E
Sbjct: 366  AYPVADSDEKLVIATTRPETIFGDTAIAVHPDDARYKHLHGKFVQHPFLPRKLPIICDSE 425

Query: 417  AVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARK 476
            AVDMEFGTGAVKITP HDQNDYNTGKRH+LE INILTDDGLLNENCGPEWQGMKRFDARK
Sbjct: 426  AVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWQGMKRFDARK 485

Query: 477  RVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRI 536
            +VIE +++L L++ Q+DNEM IPTCSRSGD+IEP+LKPQWWV+QGEMAK+AI AVK+G I
Sbjct: 486  KVIEDMKKLNLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQGEMAKDAIKAVKNGEI 545

Query: 537  TITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLE 596
             I PKSS +EYFHWLENIQDWCISRQLWWGHRCPVYF++IEG+E  RN+G YWV+GR+L 
Sbjct: 546  KIAPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIDIEGQENDRNDGNYWVAGRDLA 605

Query: 597  EAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGW 656
            EA+ KA  KFP+  +TL QDEDVLDTWFSSGLWPFSTLGWPDKT DM  FYPFSMLETGW
Sbjct: 606  EAETKAKAKFPDAKFTLHQDEDVLDTWFSSGLWPFSTLGWPDKTKDMEDFYPFSMLETGW 665

Query: 657  DILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLE 716
            DIL+FWV RMILLGIKLTG+VPFNEVFCHSLVRDAQGRKMSKSLGNVVDPL VITG  LE
Sbjct: 666  DILFFWVTRMILLGIKLTGSVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLDVITGIKLE 725

Query: 717  ELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 776
            +LHA L  GNLDPREVEKAK GQKESYPNGIPQCGTDA+RFALCAYTTGGRDINLDILRV
Sbjct: 726  DLHAKLLMGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRV 785

Query: 777  EGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFD 836
            EGYRKFCNKIYQATKFALMRLGDDYVPPA+E LSGNESLVEKWILH+L+ T++TVN+A +
Sbjct: 786  EGYRKFCNKIYQATKFALMRLGDDYVPPAKEGLSGNESLVEKWILHKLTKTSQTVNDALE 845

Query: 837  KRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFM 896
            KRDFLTSTSAIY+FWYLICDVYIENSK+LIQEG+DLEKKSARDTLY L+DNAL+LIHPFM
Sbjct: 846  KRDFLTSTSAIYEFWYLICDVYIENSKHLIQEGSDLEKKSARDTLYILLDNALKLIHPFM 905

Query: 897  PFISEEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAEY 956
            PFISEEMWQ +PKR++ET  +IV+A YPV+++ + DE+SAA Y LVL  TKEARSLLAEY
Sbjct: 906  PFISEEMWQRIPKRSTETVNTIVRASYPVYQKVYDDEKSAASYELVLDITKEARSLLAEY 965

Query: 957  NIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTP 1016
            NI+K GKVF+E   ++ + F    SQ  SIVSLIKAI++V VVRSA+EIPEGCVL +V P
Sbjct: 966  NILKEGKVFVE--SDHTESFETAQSQKDSIVSLIKAINEVDVVRSASEIPEGCVLKAVNP 1023

Query: 1017 DVNVHALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKDRL 1076
             VNVH LVKG +DID EI K  KK++KA+K+K+ IE+++   DY+TKANEQAK+ANK RL
Sbjct: 1024 QVNVHLLVKGHIDIDAEIAKVEKKIEKARKTKQGIEQIINGKDYDTKANEQAKEANKVRL 1083

Query: 1077 DS 1078
            ++
Sbjct: 1084 EN 1085

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 38 MSTEQQLPEVD-ANGEIIINPLKEDGS 63
          MS    LP VD   GE+IINPLKEDG+
Sbjct: 45 MSDLDNLPPVDPKTGEVIINPLKEDGT 71

>Kwal_23.3972
          Length = 1100

 Score = 1651 bits (4276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/1055 (74%), Positives = 893/1055 (84%), Gaps = 4/1055 (0%)

Query: 25   RSIFERIRPQSVAMSTEQQLPEVD-ANGEIIINPLKEDGSPXXXXXXXXXXXXXXXXXXX 83
            RS   R+     ++ + +QLP VD   GEIIINPLKEDGS                    
Sbjct: 29   RSASIRLASTWNSIMSSEQLPPVDPKTGEIIINPLKEDGS-EKTPKEIEKERKKAEKLLK 87

Query: 84   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVDETVPGEKKILKSLDDPALKAYNPA 143
                                             FVD+T  GEKKIL SL+DPALKAYNPA
Sbjct: 88   FAAKQAKKAEAASKQAAAPKKEKKKKVVVPIPEFVDKTAAGEKKILVSLEDPALKAYNPA 147

Query: 144  NVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLI 203
            NVESSWYDWWVKSGFFEPE TK+G+IKPEG+FCIPAPPPNVTGALHIGH LTIAIQDSLI
Sbjct: 148  NVESSWYDWWVKSGFFEPEFTKEGEIKPEGLFCIPAPPPNVTGALHIGHGLTIAIQDSLI 207

Query: 204  RYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHA 263
            RYNRMKGKTVLFLPGFDHAGIATQSVVEKQ+WA EKKTRHDYGRE FV+K+W+WKE YH 
Sbjct: 208  RYNRMKGKTVLFLPGFDHAGIATQSVVEKQVWAKEKKTRHDYGREAFVEKIWEWKEDYHK 267

Query: 264  KIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAI 323
            +IK+Q+ +LGASYDWSREAFTL PEL++SVTEAFVRLHE+GVIYRA+RLVNWSVKLNTAI
Sbjct: 268  RIKNQINKLGASYDWSREAFTLSPELTKSVTEAFVRLHEKGVIYRANRLVNWSVKLNTAI 327

Query: 324  SNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAI 383
            SNLEVENK+I  +TLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLI+ATTRPETMFGDT +
Sbjct: 328  SNLEVENKDIKARTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIVATTRPETMFGDTGV 387

Query: 384  AIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKR 443
            A+HPDDPRYKHLHGKFVQHPFLPRK+PI CD+EAVDM FGTGAVK+TP HDQNDYNTGKR
Sbjct: 388  AVHPDDPRYKHLHGKFVQHPFLPRKIPIFCDSEAVDMNFGTGAVKMTPAHDQNDYNTGKR 447

Query: 444  HDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSR 503
            H+LE IN+LTD GLLNENCGPEW GMKRFDARK VIE L++ GL++ Q+DNEM IPTCSR
Sbjct: 448  HNLEFINVLTDTGLLNENCGPEWAGMKRFDARKNVIEALKQKGLYIGQEDNEMTIPTCSR 507

Query: 504  SGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQL 563
            SGDVIEP+LKPQWWVSQ +MA++AI AVKDGRITITPKSS +EYFHWLENIQDWCISRQL
Sbjct: 508  SGDVIEPLLKPQWWVSQSQMAEKAIKAVKDGRITITPKSSEAEYFHWLENIQDWCISRQL 567

Query: 564  WWGHRCPVYFVNIEGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTW 623
            WWGHRCPVYFV+IEG++  + +G YWVSGRNLEEA+ KAA+KFPN  YTL+QDEDVLDTW
Sbjct: 568  WWGHRCPVYFVDIEGQDNDQIDGEYWVSGRNLEEAEAKAAKKFPNAKYTLKQDEDVLDTW 627

Query: 624  FSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVF 683
            FSSGLWPFSTLGWPDKT D+S FYPFSMLETGWDIL+FWV+RMILLG++LTG +PF EVF
Sbjct: 628  FSSGLWPFSTLGWPDKTKDLSQFYPFSMLETGWDILFFWVSRMILLGLELTGEIPFKEVF 687

Query: 684  CHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESY 743
            CHSLVRDAQGRKMSKSLGNVVDPL V+ G  LE+LHA L  GNLDPREVEKAKAGQKESY
Sbjct: 688  CHSLVRDAQGRKMSKSLGNVVDPLDVVCGIKLEDLHAKLLSGNLDPREVEKAKAGQKESY 747

Query: 744  PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVP 803
            PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFAL+RLG+DY P
Sbjct: 748  PNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALIRLGEDYQP 807

Query: 804  PAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSK 863
            P+ E+LSGNESLVEKWIL+++++ AK++NEA DKRDFLTSTS IY+FWYL+CDVYIENSK
Sbjct: 808  PSMEKLSGNESLVEKWILNKMTNYAKSINEALDKRDFLTSTSGIYEFWYLVCDVYIENSK 867

Query: 864  YLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASETSESIVKAKY 923
            YLI EGTD EKKSA+DTLY L+DNALRLIHPFMPFISEEMWQ LPKR SE S +IVKA Y
Sbjct: 868  YLITEGTDAEKKSAKDTLYILIDNALRLIHPFMPFISEEMWQRLPKRTSEQSPTIVKASY 927

Query: 924  PVFRQDFFDEESAADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGNNDKVFTCLNSQS 983
            PV+R+DF ++++  +Y L+L   KEARSLLA+Y I+KNGKVFIE   ++D  F    +Q 
Sbjct: 928  PVYRKDFDNQKAGEEYELILDTIKEARSLLAQYGILKNGKVFIE--SSSDAFFDTAVTQK 985

Query: 984  ASIVSLIKAIDQVTVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDIDTEIQKFNKKLDK 1043
             SIVSLIKAID+VTVV++ +EIPEG VL +VTP+VNVH LVKG VDI++EI K   KL+K
Sbjct: 986  DSIVSLIKAIDEVTVVKNVSEIPEGAVLQAVTPEVNVHVLVKGHVDIESEISKTEGKLEK 1045

Query: 1044 AQKSKEAIEKVVGSSDYETKANEQAKKANKDRLDS 1078
            AQK+KE I+K++ S DYE KANEQAK +N  RL +
Sbjct: 1046 AQKTKEGIDKIMNSKDYEEKANEQAKASNLARLQN 1080

>YGR094W (VAS1) [2054] chr7 (672188..675502) Valyl-tRNA synthetase
            (mitochondrial and cytoplasmic forms are coded from the
            same gene), member of class I family of aminoacyl-tRNA
            synthetases [3315 bp, 1104 aa]
          Length = 1104

 Score = 1644 bits (4258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1042 (76%), Positives = 891/1042 (85%), Gaps = 5/1042 (0%)

Query: 38   MSTEQQLPEVD-ANGEIIINPLKEDGSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 96
            MS    LP VD   GE+IINPLKEDGSP                                
Sbjct: 47   MSDLDNLPPVDPKTGEVIINPLKEDGSPKTPKEIEKEKKKAEKLLKFAAKQAKKNAAATT 106

Query: 97   XXXXXXXXXXXXXXXXXXXXFVDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKS 156
                                F+D+TVPGEKKIL SLDDPALKAYNPANVESSWYDWW+K+
Sbjct: 107  GASQKKPKKKKEVEPIPE--FIDKTVPGEKKILVSLDDPALKAYNPANVESSWYDWWIKT 164

Query: 157  GFFEPELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFL 216
            G FEPE T DGK+KPEG+FCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFL
Sbjct: 165  GVFEPEFTADGKVKPEGVFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFL 224

Query: 217  PGFDHAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASY 276
            PGFDHAGIATQSVVEKQIWA ++KTRHDYGRE FV KVW+WKE YH++IK+Q+Q+LGASY
Sbjct: 225  PGFDHAGIATQSVVEKQIWAKDRKTRHDYGREAFVGKVWEWKEEYHSRIKNQIQKLGASY 284

Query: 277  DWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGK 336
            DWSREAFTL PEL++SV EAFVRLH+EGVIYRASRLVNWSVKLNTAISNLEVENK++  +
Sbjct: 285  DWSREAFTLSPELTKSVEEAFVRLHDEGVIYRASRLVNWSVKLNTAISNLEVENKDVKSR 344

Query: 337  TLLSVPGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLH 396
            TLLSVPGYDEKVEFGVLTSFAYPV+ SDEKLIIATTRPET+FGDTA+A+HPDD RYKHLH
Sbjct: 345  TLLSVPGYDEKVEFGVLTSFAYPVIGSDEKLIIATTRPETIFGDTAVAVHPDDDRYKHLH 404

Query: 397  GKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDG 456
            GKF+QHPFLPRK+PI+ D EAVDMEFGTGAVKITP HDQNDYNTGKRH+LE INILTDDG
Sbjct: 405  GKFIQHPFLPRKIPIITDKEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDG 464

Query: 457  LLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQW 516
            LLNE CGPEWQGMKRFDARK+VIE+L+E  L+V Q+DNEM IPTCSRSGD+IEP+LKPQW
Sbjct: 465  LLNEECGPEWQGMKRFDARKKVIEQLKEKNLYVGQEDNEMTIPTCSRSGDIIEPLLKPQW 524

Query: 517  WVSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNI 576
            WVSQ EMAK+AI  V+DG+ITITPKSS +EYFHWL NIQDWCISRQLWWGHRCPVYF+NI
Sbjct: 525  WVSQSEMAKDAIKVVRDGQITITPKSSEAEYFHWLGNIQDWCISRQLWWGHRCPVYFINI 584

Query: 577  EGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGW 636
            EG+E  R +G YWV+GR++EEA+KKAA K+PN  +TLEQDEDVLDTWFSSGLWPFSTLGW
Sbjct: 585  EGEEHDRIDGDYWVAGRSMEEAEKKAAAKYPNSKFTLEQDEDVLDTWFSSGLWPFSTLGW 644

Query: 637  PDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKM 696
            P+KT DM TFYPFSMLETGWDIL+FWV RMILLG+KLTG+VPF EVFCHSLVRDAQGRKM
Sbjct: 645  PEKTKDMETFYPFSMLETGWDILFFWVTRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKM 704

Query: 697  SKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALR 756
            SKSLGNV+DPL VITG  L++LHA L +GNLDPREVEKAK GQKESYPNGIPQCGTDA+R
Sbjct: 705  SKSLGNVIDPLDVITGIKLDDLHAKLLQGNLDPREVEKAKIGQKESYPNGIPQCGTDAMR 764

Query: 757  FALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLV 816
            FALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDY PPA E LSGNESLV
Sbjct: 765  FALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYQPPATEGLSGNESLV 824

Query: 817  EKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKS 876
            EKWILH+L+ T+K VNEA DKRDFLTSTS+IY+FWYLICDVYIENSKYLIQEG+ +EKKS
Sbjct: 825  EKWILHKLTETSKIVNEALDKRDFLTSTSSIYEFWYLICDVYIENSKYLIQEGSAIEKKS 884

Query: 877  ARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESA 936
            A+DTLY L+DNAL+LIHPFMPFISEEMWQ LPKR++E + SIVKA YPV+  ++ D +SA
Sbjct: 885  AKDTLYILLDNALKLIHPFMPFISEEMWQRLPKRSTEKAASIVKASYPVYVSEYDDVKSA 944

Query: 937  ADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQV 996
              Y+LVL+ TKEARSLL+EYNI+KNGKVF+E   N+++ F     Q  SIVSLIKAID+V
Sbjct: 945  NAYDLVLNITKEARSLLSEYNILKNGKVFVE--SNHEEYFKTAEDQKDSIVSLIKAIDEV 1002

Query: 997  TVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVG 1056
            TVVR A+EIPEGCVL SV P+VNVH LVKG VDID EI K  KKL+KA+KSK  IE+ + 
Sbjct: 1003 TVVRDASEIPEGCVLQSVNPEVNVHLLVKGHVDIDAEIAKVQKKLEKAKKSKNGIEQTIN 1062

Query: 1057 SSDYETKANEQAKKANKDRLDS 1078
            S DYETKAN QAK+ANK +LD+
Sbjct: 1063 SKDYETKANTQAKEANKSKLDN 1084

>Scas_705.21
          Length = 1061

 Score = 1642 bits (4252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/964 (79%), Positives = 872/964 (90%), Gaps = 4/964 (0%)

Query: 117  FVDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFC 176
            FVD+TVPGEKK+L SLDDP+LK+YNPANVESSWYDWWVKSGFFEPE T+DG+IKPEG+FC
Sbjct: 80   FVDKTVPGEKKVLVSLDDPSLKSYNPANVESSWYDWWVKSGFFEPEFTEDGEIKPEGLFC 139

Query: 177  IPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWA 236
            IP PPPNVTGALHIGHALTI+IQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ+WA
Sbjct: 140  IPCPPPNVTGALHIGHALTISIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQMWA 199

Query: 237  NEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEA 296
             EKKTRHDYGR EFV KVW+WK+ YH +IK+Q++ LGASYDW+REAFTLDP+L+ +V EA
Sbjct: 200  KEKKTRHDYGRTEFVNKVWEWKDEYHNRIKNQIKNLGASYDWTREAFTLDPKLTNAVVEA 259

Query: 297  FVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSF 356
            FVRLH++G IYRASRLVNWSVKLNTAISNLEVENK++ G+TLLSVP YDEKVEFGVLTSF
Sbjct: 260  FVRLHDDGTIYRASRLVNWSVKLNTAISNLEVENKDVKGRTLLSVPNYDEKVEFGVLTSF 319

Query: 357  AYPVVDSD--EKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCD 414
            AYPV DS+  EKLIIATTRPET+FGDTAIA+HPDDPRY HLHGKFVQHPFLPRK+PIV D
Sbjct: 320  AYPVADSETGEKLIIATTRPETLFGDTAIAVHPDDPRYTHLHGKFVQHPFLPRKLPIVLD 379

Query: 415  AEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDA 474
             EAVDMEFGTGAVKITP HDQNDY TGKRH+LE INILTD+GLLNENCGPEW+GM+RFDA
Sbjct: 380  KEAVDMEFGTGAVKITPAHDQNDYQTGKRHNLEFINILTDNGLLNENCGPEWEGMRRFDA 439

Query: 475  RKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDG 534
            RK VIEKL+E+GL++ Q+DNEM IPTCSRSGD+IEP+LKPQWWV+QG+MAKEAI  VK+G
Sbjct: 440  RKAVIEKLKEMGLYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVAQGDMAKEAIKVVKNG 499

Query: 535  RITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTYWVSGRN 594
             +TITPKSS +EYFHWLENIQDWCISRQLWWGHRCPVYF+ IEG+E  RN+GT+WV+GRN
Sbjct: 500  EVTITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIKIEGREDDRNDGTFWVAGRN 559

Query: 595  LEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLET 654
            L EA++KA  K+PNE +TLEQDEDVLDTWFSSGLWPFSTLGWP+KT D+  FYPFSMLET
Sbjct: 560  LAEAEEKAKAKYPNEKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTADLEHFYPFSMLET 619

Query: 655  GWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSS 714
            GWDIL+FWV+RMILLG+KLTG+VPF EVFCHSLVRDAQGRKMSKSLGNVVDPL VI+G  
Sbjct: 620  GWDILFFWVSRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVVDPLDVISGIK 679

Query: 715  LEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDIL 774
            LE+LHA L  GNLDPREVEKAK GQKESYPNGIPQCGTDA+RFALCAYTTGGRDINLDIL
Sbjct: 680  LEDLHAKLLLGNLDPREVEKAKLGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDIL 739

Query: 775  RVEGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEA 834
            RVEGYRKFCNKIYQATKFALMRLGDDY PPAE+ LSG ESLVEKWILH+L++T+K VNEA
Sbjct: 740  RVEGYRKFCNKIYQATKFALMRLGDDYQPPAEKHLSGKESLVEKWILHKLTTTSKVVNEA 799

Query: 835  FDKRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHP 894
             +KRDFL STSAIY+FWYL+CDVYIENSKYLIQEG+  E+KSA+DTLYTL+++AL+LIHP
Sbjct: 800  LEKRDFLNSTSAIYEFWYLVCDVYIENSKYLIQEGSPEEQKSAKDTLYTLIEDALKLIHP 859

Query: 895  FMPFISEEMWQHLPKRASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLA 954
            FMPFISEE+WQ LPKRA+ETS +IVKA YPV+ Q+F +E +A  Y LVL  TKEARSLLA
Sbjct: 860  FMPFISEELWQRLPKRATETSNTIVKASYPVYEQEFDNESAANAYELVLDVTKEARSLLA 919

Query: 955  EYNIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATEIPEGCVLSSV 1014
            EYNI+KNGKV++E   N+D+ F    SQ  SIVS+IKAID+VTVVR ++EIPEGCVL +V
Sbjct: 920  EYNILKNGKVYVE--SNHDESFETTTSQKDSIVSMIKAIDEVTVVRKSSEIPEGCVLKAV 977

Query: 1015 TPDVNVHALVKGQVDIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKANKD 1074
             PDVNVH LVKG +DI+ EI K  KKL+KA KSK+ IE+ +G  DYE+KAN+QAK+ANK 
Sbjct: 978  NPDVNVHLLVKGHIDIEAEIAKVQKKLEKANKSKQNIEQTIGRKDYESKANDQAKEANKV 1037

Query: 1075 RLDS 1078
            +L++
Sbjct: 1038 KLEN 1041

>Scas_716.31*
          Length = 1019

 Score = 1276 bits (3302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/965 (62%), Positives = 757/965 (78%), Gaps = 17/965 (1%)

Query: 123  PGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPELTKDGKIKPEGIFCIPAPPP 182
            P  KK+L  L+   LKAY+P   E +WY WW + G F+PE TKDGKIK EG+FCIPAPPP
Sbjct: 39   PIVKKVLPPLNSIELKAYDPEICEKNWY-WWDQIGAFKPEFTKDGKIKAEGLFCIPAPPP 97

Query: 183  NVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTR 242
            NVTGALH+GHALTIAIQDSLIRY RMKGKTVLFLPGFDHAGIATQSVVEKQ+W  EKKTR
Sbjct: 98   NVTGALHLGHALTIAIQDSLIRYYRMKGKTVLFLPGFDHAGIATQSVVEKQLWKQEKKTR 157

Query: 243  HDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHE 302
            +DYGR+ F+KK W+WKE YH +IK+Q++RLGASYDWSREAFTLDP+LS +V EAFVRLH+
Sbjct: 158  YDYGRDGFIKKAWEWKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEAFVRLHD 217

Query: 303  EGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVD 362
             G+IYRASRLVNWSVKL T ISNLEV+NK I G+TLL+VP Y +K+EFGVL   AYPV+D
Sbjct: 218  AGIIYRASRLVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIEFGVLIYIAYPVID 277

Query: 363  SD--EKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHPFLPRKMPIVCDAEAVDM 420
            S+  E++I+ATTRPET+FGD AIAIHP+D RYKHLHGKFVQHP +P+K+PI+ DA AVDM
Sbjct: 278  SNTNERIIVATTRPETLFGDVAIAIHPEDSRYKHLHGKFVQHPLIPKKIPIILDATAVDM 337

Query: 421  EFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDARKRVIE 480
             FGTGAVKITP HDQNDYN GKRH L+ +NI TDDGLLNENCG  W+G+KRFDAR+ VI+
Sbjct: 338  TFGTGAVKITPAHDQNDYNVGKRHSLQFVNIFTDDGLLNENCGSSWEGLKRFDARQLVID 397

Query: 481  KLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITP 540
            +L+  G F+ Q+DN M+IP CSRSGDVIEP+LK     S     +++        I  + 
Sbjct: 398  ELKRKGFFMKQEDNPMIIPLCSRSGDVIEPLLKHNGG-SHKINGQDSDRYCGKREIRFSS 456

Query: 541  KSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQS----RNEGTYWVSGRNLE 596
             ++ ++YF WLENIQDWCISRQLWWGHRCPVYF+N+EG E S    RN+G YWV+GRNLE
Sbjct: 457  SNTKNDYFRWLENIQDWCISRQLWWGHRCPVYFINVEGSEDSAAINRNDGKYWVAGRNLE 516

Query: 597  EAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGW 656
            EA  KAA+KFPN+ ++LEQD+DVLDTWFSS LWPFSTLGWP+KT DM+ FYPFSMLETGW
Sbjct: 517  EAVHKAAKKFPNKKFSLEQDQDVLDTWFSSALWPFSTLGWPNKTNDMNLFYPFSMLETGW 576

Query: 657  DILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLE 716
            DIL+FWV RMI+LG+KLTG++PF EV+CHSLVRD +GRKMSKSLGNV+DPL +I G +L+
Sbjct: 577  DILFFWVTRMIMLGVKLTGSIPFKEVYCHSLVRDFEGRKMSKSLGNVIDPLDIINGCTLK 636

Query: 717  ELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRV 776
            ELH  L +GNLDP++++K K  QK+ YP GIPQCG+DALRFALCAYTTGGRDINLDI RV
Sbjct: 637  ELHEKLQQGNLDPKKIDKMKIEQKKMYPRGIPQCGSDALRFALCAYTTGGRDINLDISRV 696

Query: 777  EGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFD 836
            EGYRKFCNKIYQATKF++ RLGDDY PP+      ++SLVEKWIL+++++T   VN++F+
Sbjct: 697  EGYRKFCNKIYQATKFSIQRLGDDYQPPSSTHTPASKSLVEKWILYQMNNTIAIVNDSFE 756

Query: 837  KRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFM 896
            KRDFLT TS IY+ WY+ICDVYIEN K+L  +   + +K+A+DTL+TL++N L++IHPFM
Sbjct: 757  KRDFLTCTSKIYELWYMICDVYIENFKWLAND--TIMEKAAKDTLHTLIENGLKMIHPFM 814

Query: 897  PFISEEMWQHLPKR-ASETSESIVKAKYPVFRQDFFDEESAADYNLVLSATKEARSLLAE 955
            P++SEE+WQ LP     + S SI+K  YP   +DF   + A  Y+ +L   K  RSLL+E
Sbjct: 815  PYLSEELWQRLPDGIGKDESSSIMKTLYPTPSEDFNYGKEAKQYDEILKIIKSMRSLLSE 874

Query: 956  YNIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSLIKAIDQVTVVRSATE---IPEGCVLS 1012
            YNI  N + F E+   +D++F  + ++  +I+S++K ++ ++ +  A +   I   CV  
Sbjct: 875  YNITANARFFFEIL--DDELFDIVRAEKDAILSVMKGVENISFLAVAPDRQPIKNDCVSC 932

Query: 1013 SVTPDVNVHALVKGQV-DIDTEIQKFNKKLDKAQKSKEAIEKVVGSSDYETKANEQAKKA 1071
            S++  VNV+ LVKGQ  DI  E+ K  K+L+K      A ++++ + D+  KA+E+ ++ 
Sbjct: 933  SISSQVNVYLLVKGQYKDISKELSKQLKQLEKLNNIYAATQRMLTNKDFIKKASEEIREM 992

Query: 1072 NKDRL 1076
            N+ +L
Sbjct: 993  NEKKL 997

>Scas_97.1*
          Length = 261

 Score =  428 bits (1100), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 199/259 (76%), Positives = 223/259 (86%), Gaps = 8/259 (3%)

Query: 344 YDEKVEFGVLTSFAYPVVDS--DEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQ 401
           YDEKV +     F  P++ S  DEKLIIATTRPETMF       HP+DPRYKHLHGKFVQ
Sbjct: 1   YDEKVNW-----FLTPLLSSRSDEKLIIATTRPETMFVH-CYCCHPEDPRYKHLHGKFVQ 54

Query: 402 HPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNEN 461
           HPFLPRK+PIVCD+EAVDMEFGTGAVKITP HDQNDYNTGKRH+LE INILTDDGLLNEN
Sbjct: 55  HPFLPRKLPIVCDSEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEN 114

Query: 462 CGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQG 521
           CGPEW GMKRFDARK+V+E+L+  GL++ Q+DNEM IP CSRSGD+IEP+LKPQWWVSQ 
Sbjct: 115 CGPEWCGMKRFDARKKVVEELKNAGLYIGQEDNEMTIPICSRSGDIIEPLLKPQWWVSQT 174

Query: 522 EMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQ 581
           EMAKEAI AV++G ITITPKSS SEYFHWLENIQDWCISRQLWWGHRCPVYFV IEG++ 
Sbjct: 175 EMAKEAIKAVRNGDITITPKSSESEYFHWLENIQDWCISRQLWWGHRCPVYFVKIEGEDN 234

Query: 582 SRNEGTYWVSGRNLEEAQK 600
            +N+G YWVSGR  EEA++
Sbjct: 235 DKNDGKYWVSGRTTEEAEE 253

>CAGL0G03311g 315470..318688 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1072

 Score =  177 bits (448), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 205/856 (23%), Positives = 345/856 (40%), Gaps = 153/856 (17%)

Query: 162 ELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDH 221
           ELTKD   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 222 AGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSRE 281
            G+  + +++K++    K+    YG + +  +       Y  + +  + RLG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGIKGKEDVFKYGLDNYNNECRAIVMTYADEWRKTIGRLGRWIDFDND 146

Query: 282 AFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSV 341
             T+ P    SV  AF +LHE+G +YR  R++ +S  L T +SN E +            
Sbjct: 147 YKTMYPSFMESVWWAFKQLHEKGQVYRGFRVMPYSTGLTTPLSNFEAQQ----------- 195

Query: 342 PGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPD------------- 388
             Y +  +  V   F   +     KL+  TT P T+  + A+ ++P+             
Sbjct: 196 -NYKDVNDPAVTIGFNV-IGQEKTKLVAWTTTPWTLPSNLALCVNPEFEYVKIYDENKDC 253

Query: 389 -----DPRYKHLHGKFVQH----------------------PFLPRKMP----IVCDAEA 417
                +   K L+ K                          P+   +M      V   + 
Sbjct: 254 YFILLESLIKTLYKKPAAEKYKIVEKIKGSELVGLKYEPIFPYFYEQMKETAFRVIAGDY 313

Query: 418 VDMEFGTGAVKITPGHDQNDY-----NTGKRHDLEIINILTDDGLLNENCGPEWQGMKRF 472
           V  + GTG V   P   + DY     N     D    N + D+G    +   ++ G+   
Sbjct: 314 VTADSGTGIVHNAPSFGEEDYAVCLENGVISEDTVAPNPVDDNGKFTSDV-TDFAGIYVK 372

Query: 473 DARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVK 532
           DA K +I+ L E G  +         P C RS   +     P W+V   E+A + +++V 
Sbjct: 373 DADKLIIKHLTETGNLLLASQIRHSYPFCWRSDTPLLYRSVPAWFVRVKEIAPKMLDSVM 432

Query: 533 DGRITITPKSSASEYF-HWLENIQDWCISRQLWWGHRCPVYFVN----------IEGKEQ 581
           +      P +   + F +W+ N +DW +SR  +WG   P++  +          IE  EQ
Sbjct: 433 NSHWV--PNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSDDFEEIVCVGSIEELEQ 490

Query: 582 SRNEGTYWVSG-RNLEEAQKKAAEKF--PNEVYT--LEQDEDVLDTWFSSGLWPFSTLGW 636
                   +SG +N+ +  +   +    P+++    L++ E+V D WF SG  P+++  +
Sbjct: 491 --------LSGVKNITDLHRDKIDHITIPSKMGKGDLKRIEEVFDCWFESGSMPYASQHY 542

Query: 637 P-DKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRK 695
           P + T   S   P + +  G D    W   + +LG  L G VP+  V    +V  + GRK
Sbjct: 543 PFENTEKFSDRVPANFISEGLDQTRGWFYTLSVLGTHLFGEVPYKNVIVSGIVLASDGRK 602

Query: 696 MSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDAL 755
           MSKSL N  DP  V+                      EK  A     Y    P    ++L
Sbjct: 603 MSKSLKNYPDPNIVL----------------------EKYGADALRLYLINSPVLKAESL 640

Query: 756 RFALCAYTTGGRDINLDILRVEGYRKFCNKI----YQATKF-----ALMRLGDDYVPPAE 806
           +F                 + EG ++   K+    + + KF     AL++   D     +
Sbjct: 641 KF-----------------KEEGVKEVVTKVLLPWWNSYKFLEGQLALLKKTSDVDFKYD 683

Query: 807 EQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE-NSKYL 865
            +LS +++++++WIL  + S  + +++        T    +  F   + + YI  N + L
Sbjct: 684 PKLS-SDNVMDRWILASMQSLVQFIHQEMAVYKLYTVVPKLLHFIDELTNWYIRFNRRRL 742

Query: 866 IQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHL----PKRA----SETSES 917
             E    +   A +TL+  +    R + PF PF+++ ++Q L    P+       +   S
Sbjct: 743 KGENGVDDCLKALNTLFDALFTFARAMAPFTPFLADGIYQRLRAYIPEEVLAQFGQDGRS 802

Query: 918 IVKAKYPVFRQDFFDE 933
           +    YP  RQ+ FDE
Sbjct: 803 VHFLSYPEVRQELFDE 818

>YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRNA
           synthetase, cytoplasmic, member of the class I aminoacyl
           tRNA synthetase family [3219 bp, 1072 aa]
          Length = 1072

 Score =  170 bits (431), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 200/860 (23%), Positives = 345/860 (40%), Gaps = 161/860 (18%)

Query: 162 ELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDH 221
           ELTKD   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 222 AGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSRE 281
            G+  + +++K++    K     YG E +  +       Y +  +  + RLG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGITGKDDVFKYGLENYNNECRSIVMTYASDWRKTIGRLGRWIDFDND 146

Query: 282 AFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSV 341
             T+ P    S   AF +LHE+G +YR  +++ +S  L T +SN E +            
Sbjct: 147 YKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPYSTGLTTPLSNFEAQQ----------- 195

Query: 342 PGYDEKVEFGVLTSFAYPVVDSDEKLIIA-TTRPETMFGDTAIAIHPD----------DP 390
             Y +  +  V   F   V+  ++  ++A TT P T+  + ++ ++ D            
Sbjct: 196 -NYKDVNDPAVTIGFN--VIGQEKTQLVAWTTTPWTLPSNLSLCVNADFEYVKIYDETRD 252

Query: 391 RY--------KHLHGK---------------------------FVQHPFLPRKMPIVCDA 415
           RY        K L+ K                           +    F      ++ D 
Sbjct: 253 RYFILLESLIKTLYKKPKNEKYKIVEKIKGSDLVGLKYEPLFPYFAEQFHETAFRVISD- 311

Query: 416 EAVDMEFGTGAVKITPGHDQND-----YNTGKRHDLEIINILTDDGLLNENCGPEWQGMK 470
           + V  + GTG V   P   + D      N     D  + N + D G   ++  P+++G+ 
Sbjct: 312 DYVTSDSGTGIVHNAPAFGEEDNAACLKNGVISEDSVLPNAIDDLGRFTKDV-PDFEGVY 370

Query: 471 RFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINA 530
             DA K +I+ L   G  +         P C RS   +     P W+V    +  + +++
Sbjct: 371 VKDADKLIIKYLTNTGNLLLASQIRHSYPFCWRSDTPLLYRSVPAWFVRVKNIVPQMLDS 430

Query: 531 VKDGRITITPKSSASEYF-HWLENIQDWCISRQLWWGHRCPVYF------VNIEGKEQSR 583
           V        P +   + F +W+ N +DW +SR  +WG   P++       V   G  +  
Sbjct: 431 VMKSHWV--PNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSDDFEEVVCVGSIKEL 488

Query: 584 NEGTYWVSGRNLEEAQKKAAEKF--PNEVYT--LEQDEDVLDTWFSSGLWPFSTLGWP-D 638
            E T     RN+ +  +   +K   P++     L++ E+V D WF SG  P+++  +P +
Sbjct: 489 EELT---GVRNITDLHRDVIDKLTIPSKQGKGDLKRIEEVFDCWFESGSMPYASQHYPFE 545

Query: 639 KTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSK 698
            T       P + +  G D    W   + +LG  L G+VP+  V    +V  A GRKMSK
Sbjct: 546 NTEKFDERVPANFISEGLDQTRGWFYTLAVLGTHLFGSVPYKNVIVSGIVLAADGRKMSK 605

Query: 699 SLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFA 758
           SL N  DP  V+                                      + G DALR  
Sbjct: 606 SLKNYPDPSIVLN-------------------------------------KYGADALRLY 628

Query: 759 LCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF-----ALMRLGDDYV 802
           L         IN  +L+        EG ++  +K+    + + KF     AL++   +  
Sbjct: 629 L---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKMSNID 679

Query: 803 PPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE-N 861
              ++ +  +++++++WIL  + S  + ++E   +    T    + +F   + + YI  N
Sbjct: 680 FQYDDSVK-SDNVMDRWILASMQSLVQFIHEEMGQYKLYTVVPKLLNFIDELTNWYIRFN 738

Query: 862 SKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASET------- 914
            + L  E    +   A ++L+  +   +R + PF PF+SE ++  L +   E        
Sbjct: 739 RRRLKGENGVEDCLKALNSLFDALFTFVRAMAPFTPFLSESIYLRLKEYIPEAVLAKYGK 798

Query: 915 -SESIVKAKYPVFRQDFFDE 933
              S+    YPV ++++FDE
Sbjct: 799 DGRSVHFLSYPVVKKEYFDE 818

>Scas_599.13
          Length = 1071

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 199/858 (23%), Positives = 341/858 (39%), Gaps = 157/858 (18%)

Query: 162 ELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDH 221
           ELTKD   KPE  F     PP  TG  H GH L   I+D + RY  M G  V    G+D 
Sbjct: 32  ELTKD---KPE--FSFFDGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDT 86

Query: 222 AGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSRE 281
            G+  + +++K++    K+    YG + +  +       Y    +  + RLG   D+  +
Sbjct: 87  HGVPIEHIIDKKLGIKGKEDVFKYGIDNYNNECRSIVMTYAEDWRKTIGRLGRWIDFDND 146

Query: 282 AFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSV 341
             T+ P    S   AF +L E+  +YR  R++ +S  L T +SN E +            
Sbjct: 147 YKTMYPSYMESTWWAFKQLFEKQQVYRGYRVMPYSTGLTTPLSNFEAQQ----------- 195

Query: 342 PGYDEKVEFGVLTSFAYPVVDSDEKLIIA-TTRPETMFGDTAIAIHPD------------ 388
             Y +  +  V   F   V+  ++  ++A TT P T+  + A+ ++PD            
Sbjct: 196 -NYKDVNDPAVTIGFN--VIGQEKTQLVAWTTTPWTLPSNMALCVNPDFEYVKIYDEKKD 252

Query: 389 ------------------DPRYK---HLHGK------------FVQHPFLPRKMPIVCDA 415
                             D +YK    + G             +    F      ++ D 
Sbjct: 253 RYYILLESLIKSLYKKPKDEKYKVVEKIKGSDLVGLKYEPLFPYFAEEFKDTAFRVISDG 312

Query: 416 EAVDMEFGTGAVKITPGHDQNDYNTGKRHDL-----EIINILTDDGLLNENCGPEWQGMK 470
             V  E GTG V   P   + DY    R  +        N L D G        ++ G+ 
Sbjct: 313 -YVTSESGTGIVHNAPAFGEEDYTICTREGIVSEGANFPNPLDDLGRFTSEV-TDFAGVY 370

Query: 471 RFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINA 530
             DA K +I+ L   G  +         P C RS   +     P W+V    +  + + +
Sbjct: 371 VKDADKLIIKHLTATGNMLYHTQIRHSYPFCWRSDTPLLYRAVPAWFVRVRNIVPQMLES 430

Query: 531 VKDGRITITPKSSASEYF-HWLENIQDWCISRQLWWGHRCPVYFVNIEGKE----QSRNE 585
           V+       P     + F +W+ N +DW +SR  +WG   P++ V+ + KE     S  E
Sbjct: 431 VEKSHWV--PNVIKEKRFANWIANARDWNVSRNRYWGTPIPLW-VSDDFKEIVCIGSVEE 487

Query: 586 GTYWVSGRNLEEAQKKAAEKF--PNEVYT--LEQDEDVLDTWFSSGLWPFSTLGWP-DKT 640
                    +++  +   +K   P++     L++ E+V D WF SG  P+++  +P + T
Sbjct: 488 LEKLSGVTGIKDLHRDTIDKLTIPSKQGKGELKRIEEVFDCWFESGSMPYASQHYPFENT 547

Query: 641 PDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSL 700
              S   P + +  G D    W   + +LG  L G+VP+  V    +V  A GRKMSKSL
Sbjct: 548 EKFSQRVPANFISEGLDQTRGWFYTLSVLGTHLFGSVPYKNVIVSGIVLAADGRKMSKSL 607

Query: 701 GNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALC 760
            N  DP  V+                                      + G DALR  L 
Sbjct: 608 KNYPDPNIVLV-------------------------------------KYGADALRLYL- 629

Query: 761 AYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF-----ALMRLGDDYVPP 804
                   IN  +L+        EG ++  +K+    + + KF     AL++   D    
Sbjct: 630 --------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKTSDIDFK 681

Query: 805 AEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE-NSK 863
            +  L  +++++++WIL  + S  + +++        T    + +F   + + YI  N +
Sbjct: 682 YDPSLM-SDNVMDRWILASMQSLVQFIHQEMGLYKLYTVVPRLLNFIDELTNWYIRFNRR 740

Query: 864 YLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMW----QHLP----KRASETS 915
            L  E    +   A ++L+  +   +R + PF PF+++ ++    +++P     + ++  
Sbjct: 741 RLKGENGVEDCLKALNSLFEALFTFVRAMAPFTPFLADTIYLKLKEYIPADVLAKYTKDG 800

Query: 916 ESIVKAKYPVFRQDFFDE 933
            S+    YPV R++ FDE
Sbjct: 801 RSVHFLSYPVVREELFDE 818

>KLLA0E20625g 1825036..1828257 highly similar to sp|P09436
           Saccharomyces cerevisiae YBL076c ILS1 isoleucyl-tRNA
           synthetase, start by similarity
          Length = 1073

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 199/863 (23%), Positives = 343/863 (39%), Gaps = 165/863 (19%)

Query: 162 ELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDH 221
           +LT+D   KPE  F     PP  TG  H GH L   ++D + RY  M G  V    G+D 
Sbjct: 33  KLTED---KPE--FSFFDGPPFATGTPHYGHLLASTVKDIVPRYATMTGHHVERRFGWDT 87

Query: 222 AGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSRE 281
            G+  + +++K++    K+  + +G + +  +       Y  + +  + RLG   D+  +
Sbjct: 88  HGLPIEHIIDKKLNITCKEDVYAFGIDNYNNECRAIVSTYAEEWRKTIGRLGRWIDFDDD 147

Query: 282 AFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVEN--KEIAGKTLL 339
             T+ P    S+  AF  L ++  +YR  +++ +S    T +SN E +   K++    + 
Sbjct: 148 YKTMYPTFMESIWWAFKELFDKDQVYRGYKVMPYSTGCTTPLSNFEAQQNYKDVNDPAI- 206

Query: 340 SVPGYDEKVEFGVLTSFAYPVVDSDE-KLIIATTRPETMFGDTAIAIHPD---------- 388
                          + A+ V+  ++ KL+  TT P T+  + A+ ++P+          
Sbjct: 207 ---------------TIAFNVIGQEKTKLVAWTTTPWTLPSNLALCVNPEFEYVKIYDEN 251

Query: 389 --------DPRYKHLHGKFVQH-------------------PFLPRKMPIVCDA------ 415
                   +   K L+ K  Q                    P  P  +    D       
Sbjct: 252 KDTYFILLESLIKTLYKKPAQEKYKVVEKIKGKDLVGLKYEPLFPYFVDEYKDTGFRVLG 311

Query: 416 -EAVDMEFGTGAVKITPGHDQNDYNTGKRH-----DLEIINILTDDGLLNENCGPEWQGM 469
              V  + GTG V   P   ++D      H     D    N + D G   +    ++ GM
Sbjct: 312 DSYVSNDSGTGIVHQAPAFGEDDNRVCLEHGVIREDTPAPNPIDDVGKFTKEVS-DFTGM 370

Query: 470 KRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAIN 529
              DA K +I+KL   G  +         P C RS   +     P W+V    +  + + 
Sbjct: 371 YVKDADKEIIKKLLASGHILLNSQIRHSYPFCWRSDTPLIYRTVPAWFVRVKTIIPQFLE 430

Query: 530 AVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVY-------FVNIEGKEQS 582
           +VK      T       + +W+ N +DW +SR  +WG   P++        V I   E+ 
Sbjct: 431 SVKKSNWVPT-VIKEKRFSNWIANARDWNVSRNRYWGTPIPLWVSEDYEEMVCIGSVEEL 489

Query: 583 RNEGTYWVSG-RNLEEAQKKAAEK--FPNE--VYTLEQDEDVLDTWFSSGLWPFSTLGWP 637
           R      +SG +++ +  + + +    P++     L + E+V D WF SG  P+++  +P
Sbjct: 490 RE-----LSGVQDITDLHRDSIDNITIPSKKGKGVLRRIEEVFDCWFESGSMPYASQHYP 544

Query: 638 -DKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKM 696
            + T   S   P + +  G D    W   + +LG  L G VP+  V    +V  A G+KM
Sbjct: 545 FENTEKFSQRVPANFISEGLDQTRGWFYTLGVLGTHLFGEVPYRNVIVSGIVLAADGKKM 604

Query: 697 SKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALR 756
           SKSL N  DP  V+                              E Y       G+DALR
Sbjct: 605 SKSLKNFPDPNIVL------------------------------EKY-------GSDALR 627

Query: 757 FALCAYTTGGRDINLDILRV-------EGYRKFCNKI----YQATKF-----ALMRLGDD 800
             L         IN  +L+        EG ++  +K+    + + KF     AL++   D
Sbjct: 628 LYL---------INSPVLKAESLKFKEEGVKEVVSKVLLPWWNSFKFLDGQIALLKKNSD 678

Query: 801 YVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE 860
                   L  +++++++WIL  L S    +++        T    + DF   + + YI 
Sbjct: 679 VDFKYNPHLK-SDNVMDRWILASLQSLVAYIHQEMSTYKLYTVVPRLLDFIDELTNWYIR 737

Query: 861 -NSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHL----PKRA---- 911
            N + L  EG   +   A +TL+  +   +R + PF PF+S+ ++  L    P+      
Sbjct: 738 FNRRRLKGEGGVEDCLKALNTLFDALFTFVRAMAPFTPFLSDNIYSKLRPFIPEEVLAQY 797

Query: 912 SETSESIVKAKYPVFRQDFFDEE 934
           S+ S S+    YP   +D +DE+
Sbjct: 798 SKDSRSVHFLSYPEVNEDLYDED 820

>AER394W [2894] [Homologous to ScYBL076C (ILS1) - SH]
           complement(1386794..1390012) [3219 bp, 1072 aa]
          Length = 1072

 Score =  156 bits (395), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 197/855 (23%), Positives = 341/855 (39%), Gaps = 164/855 (19%)

Query: 170 KPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSV 229
           +PE  F     PP  TG  H GH L   ++D + RY  M G  V    G+D  G+  + +
Sbjct: 37  RPE--FSFFDGPPFATGTPHYGHILASTVKDIVPRYATMNGYHVERRFGWDTHGLPIEHI 94

Query: 230 VEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPEL 289
           ++K++    K+  + +G E +  +       Y  + +  + RLG   D+  +  T+ P  
Sbjct: 95  IDKKLNITCKEDVYKFGIENYNNECRAIIMTYADEWRKTIGRLGRWIDFDNDYKTMYPSF 154

Query: 290 SRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVE 349
             SV  AF +L+E+  +YR  R++ +S    T +SN E +              Y E  +
Sbjct: 155 MESVWWAFKQLYEKEQVYRGYRVMPYSTGCTTPLSNFEAQQ------------NYKEVND 202

Query: 350 FGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPD----------DPRYKHLHGKF 399
             V   F   V + + + +  TT P T+  + A+ ++P+            RY  L    
Sbjct: 203 PAVTIGFNV-VGEENTQFVAWTTTPWTLPSNLALCVNPEFEYVKIYDEKKDRYFILMESL 261

Query: 400 VQHPF---LPRKMPIVCDAEAVDM--------------EFGTGAVK-ITPGHDQNDYNTG 441
           ++  +      K  +V      D+              E+GT A + I+  +  ND  TG
Sbjct: 262 LKSLYKKPAAEKYKVVERYTGKDLVGMKYEPLFPYFKEEYGTQAYRVISDSYVTNDSGTG 321

Query: 442 KRHDLEIIN-----ILTDDGLLNENCG---------------PEWQGMKRFDARKRVIEK 481
             H+          +   +G++NE+                  ++ G    DA K +I+ 
Sbjct: 322 IVHNAPAFGEDDYRVCLANGIINEDSTLPNPVDDSGKFTSEVTDFSGKYVKDADKEIIKH 381

Query: 482 LQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGR---ITI 538
           L      +         P C RS   +     P W+V    +  + + +VK        I
Sbjct: 382 LTATSNLLLATQVRHSYPFCWRSDTPLIYRSVPAWFVRVKPIIPQFLESVKKSNWVPTVI 441

Query: 539 TPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVN-----IEGKEQSRNEGTYWVSG- 592
             K  A+    W+ N +DW ISR  +WG   P++  +     +     +  E    VSG 
Sbjct: 442 KEKRFAT----WIANARDWNISRNRYWGTPIPLWVSDDFDEIVCVGSIAELEELSGVSGI 497

Query: 593 ----RNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWP-DKTPDMSTFY 647
               R+  +     ++K   E   L + E+V D WF SG  P+++  +P + T   +   
Sbjct: 498 SDLHRDTVDKITIPSKKGKGE---LRRIEEVFDCWFESGSMPYASQHYPFENTEKFAQRV 554

Query: 648 PFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPL 707
           P + +  G D    W   + +LG +L G+VP+  V    +V  A G+KMSKSL N  DP 
Sbjct: 555 PANFISEGLDQTRGWFYTLGVLGTQLFGHVPYQNVIVSGIVLAADGKKMSKSLKNYPDPN 614

Query: 708 YVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALCAYTTGGR 767
            VI                                      + G+DALR  L        
Sbjct: 615 IVID-------------------------------------KYGSDALRLYL-------- 629

Query: 768 DINLDILRV-------EGYRKFCNKI----YQATKF-----ALMR----LGDDYVPPAEE 807
            IN  +LR        EG ++  +K+    + + KF     AL++    +   Y P    
Sbjct: 630 -INSPVLRAESLKFKEEGVKEVVSKVLLPWWNSFKFLEGQIALLKKTSSVDFKYDPNVR- 687

Query: 808 QLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE-NSKYLI 866
               +++++++W+L  L S  K ++         +    + DF   + + YI  N + L 
Sbjct: 688 ----SDNVMDRWVLASLQSLIKYIHVEMKAYKLYSVVPRLLDFIDELTNWYIRFNRRRLK 743

Query: 867 QEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMW----QHLPK----RASETSESI 918
            E    +  +A +TL+  +   +R + PF PF+SE ++    +++PK       E  ES+
Sbjct: 744 GEDGMEDCINALNTLFEALFTFVRAMAPFTPFLSETIYLRLREYIPKDILDHFGENHESV 803

Query: 919 VKAKYPVFRQDFFDE 933
              +YPV ++  FD+
Sbjct: 804 HFLRYPVAKEHLFDD 818

>AGL247C [4065] [Homologous to ScYPL040C (ISM1) - SH]
           (237045..240011) [2967 bp, 988 aa]
          Length = 988

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 183/840 (21%), Positives = 312/840 (37%), Gaps = 143/840 (17%)

Query: 161 PELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFD 220
           P+ T       + +F +   PP   G LH+GHA+   ++D + RY   KG+ V + PG+D
Sbjct: 61  PDDTDKANFVRDRVFVLHDGPPYANGDLHVGHAMNKILKDIMSRYQLTKGRYVFYRPGWD 120

Query: 221 HAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAK-----IKSQVQRLGAS 275
             G+  +    + +         DY       +        HA+      + Q Q+ G  
Sbjct: 121 CHGLPIELKALRSL---------DYDTAAISPQQVRAMAAQHAEGAIAAQRKQFQQFGIL 171

Query: 276 YDWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKE--I 333
            DW     T+DP            +   G+I R  + V W  +  TA++  E+E ++  I
Sbjct: 172 TDWQDTYRTMDPGYEIQQLRLLQGIFARGLIRRQRKPVYWGTETRTALAEGELEYRDDHI 231

Query: 334 AGKTLLSVP---GYDEKVEFGVLTSFA-YPVVDSDEKLIIATTRPETMFGDTAIAIHPDD 389
           +    +  P   G    +   + TS    P+V      +I T+ P T+  + AI  H D 
Sbjct: 232 SKAAYVYFPLTEGASATLRERLGTSLPEQPIV-----CLIWTSTPWTLLSNRAICFHDDH 286

Query: 390 P----------------------------------RYKHLHGKFVQHPFLPRKM--PIVC 413
                                              R   L G +  +P L   +  P++ 
Sbjct: 287 AYLLLQWKGMLVVAERTELADFKWSGDTPVVVTSFRGSDLRGLYYTNPLLGDAVSRPLL- 345

Query: 414 DAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDG-LLNENCGPEWQGMKRF 472
             + V  + GTG V   PGH Q DY  G+ H +E+ + +  +G  + ++  P  + M R 
Sbjct: 346 HGDHVTADTGTGLVHTAPGHGQEDYLVGQAHGIEVYSPVDHEGRYILDDIPPHLRDMLRE 405

Query: 473 DARKR-----------VIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQG 521
           ++ K            +I+ L+E  + +   +     P   RS   +     PQW+    
Sbjct: 406 ESGKPLKVTDQKTAGVIIKLLEEHKMLLHSHEYTHSYPYDWRSKKPVILRATPQWFADLS 465

Query: 522 EMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQ 581
           +M   A+ ++++  +   P         ++++  +WCISRQ  WG   P   +     E 
Sbjct: 466 DMKHHAVESLEN--VEFFPARGKKRLEAFIKSRNEWCISRQRSWGVPIPALHLRSNPDEV 523

Query: 582 SRNEGTY--------------WVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSG 627
             N  T               W    N E  ++   EK+ +  +   +  D +D WF SG
Sbjct: 524 LLNNETLAHIIETISKVGINSWFEESNAENMKQWLPEKYHDVAHLYYRGRDTIDVWFDSG 583

Query: 628 L-------WPFSTLGWPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNV--P 678
                   W   TLG       ++  Y    LE G D    W    +L  +  +G V  P
Sbjct: 584 SSWNLLEKWYTETLGLKKPLQPLADVY----LE-GSDQHRGWFQSSLLTKVAASGTVGAP 638

Query: 679 FNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAG 738
           F ++  H    D  G KMSKSLGN + P  +I G    +L                    
Sbjct: 639 FGKIVTHGFTLDEAGLKMSKSLGNTIAPSSIIEGDQKLQL-------------------- 678

Query: 739 QKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLG 798
                    P+ G D LR  L A     +D+    L          K+    +F L  L 
Sbjct: 679 ---------PRLGVDGLRL-LVAQADFTKDVAFGPLIARHVADSLKKVRLTFRFILGNLQ 728

Query: 799 D-DYVPPAEEQLS---GNESLVEK---WILHELSSTAKTVNEAFDKRDFLTSTSAIYDFW 851
           D   V  A EQ S   G+ + + +   +IL +           ++ +++    S +    
Sbjct: 729 DCPSVASAGEQASLAPGDCAQLRRIDWYILDKTQKLTAKCQGLYESQNYSNVISLVLYHM 788

Query: 852 YLICDVYIENSK--YLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPK 909
                +Y + SK    ++   +  + + + TL+ ++D    ++ P MP + +E W  LP+
Sbjct: 789 SNDLSLYFDASKDTLYMEPPHNKRRLAIQTTLFHILDAYRSILGPIMPALVQEAWNCLPR 848

>Kwal_27.10811
          Length = 1099

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 194/858 (22%), Positives = 346/858 (40%), Gaps = 131/858 (15%)

Query: 151 DWWVKSGFFEPELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKG 210
           D W +   F+  L K  + KPE  F     PP  TG  H GH LT  ++D + RY  M G
Sbjct: 46  DLWNEIDAFQTSL-KLTEGKPE--FSFFDGPPFATGTPHYGHILTSTVKDVVPRYASMNG 102

Query: 211 KTVLFLPGFDHAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQ 270
             V    G+D  G+  + +++K++    K+  +  G +++  +      +Y  + +  + 
Sbjct: 103 FHVERRFGWDTHGLPIEHIIDKKLGITCKEDVYKMGIDKYNDECRAIVMMYAEEWRKTIG 162

Query: 271 RLGASYDWSREAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVEN 330
           R+G   D+  +  T+ P    S   AF +L E+G +YR  +++ +S    T +SN E + 
Sbjct: 163 RMGRWIDFDNDYKTMYPSFMESTWWAFKQLFEKGQVYRGYKVMPYSTGCTTPLSNFEAQQ 222

Query: 331 --KEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEK-LIIATTRPETMFGDTAIAIHP 387
             K+++          D  V +G      + V+  D   L++ TT P T+  + A+ ++ 
Sbjct: 223 NYKDVS----------DPAVTWG------FRVIGMDNTYLVVWTTTPWTIPSNLAVCVNA 266

Query: 388 --------DDPRYKH-------------------------LHGK----FVQHPFLPR--- 407
                   D+ R KH                         + GK        P  P    
Sbjct: 267 EFEYVKIYDETRDKHFIILESLIKTLYKKPEKEKYKVVEKIMGKDLVGLKYEPVYPYYKE 326

Query: 408 ----KMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRH-----DLEIINILTDDGLL 458
               K   V +   V  + GTG V   P   + DY    +H     D E+ N + D G  
Sbjct: 327 AYKDKAFRVIEDSYVTSDSGTGLVSNAPAFGEEDYKVCLQHGIISEDDELPNPVDDAGKF 386

Query: 459 NENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWV 518
                 ++ G    DA K++I+ L   G  ++        P C RS   +     P W+V
Sbjct: 387 TLPV-TDYLGQYVKDADKQIIKDLTANGTMLANTQFRHSYPFCWRSDTPLLYRSVPAWFV 445

Query: 519 SQGEMAKEAINAVKDGRITITPKSSASEYF-HWLENIQDWCISRQLWWGHRCPVYF---- 573
               +  + +++V+       P     + F +W+ N +DW +SR  +WG   P++     
Sbjct: 446 RVKPIIPKFLDSVQKSHWV--PNVIKEKRFSNWIANARDWNVSRNRYWGTPIPIWVSDDY 503

Query: 574 --VNIEGKEQSRNEGTYWVSG-RNLEEAQKKAAE--KFPNEVY--TLEQDEDVLDTWFSS 626
             V   G  Q   +    +SG + +E+  + + +    P++     L++ E+V D WF S
Sbjct: 504 EEVVCVGSVQELKD----LSGVQTIEDLHRDSIDGITIPSKKGKGVLKRIEEVFDCWFES 559

Query: 627 GLWPFSTLGWPDKTPD-MSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCH 685
           G  P+S+  +P +  D      P + +  G D    W   + +LG +L G VP+  V   
Sbjct: 560 GSMPYSSQHYPFENQDKFKERVPANFISEGLDQTRGWFYTLGVLGSQLFGQVPYQNVIVC 619

Query: 686 SLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPN 745
            +V  A G+KMSKSL N  DP  V+     + L   L    +   E  K K    +   +
Sbjct: 620 GIVLAADGKKMSKSLKNYPDPNLVLDKYGADALRLYLINSPVLKAESLKFKEDGVKEVVS 679

Query: 746 GIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPA 805
            +     ++ +F     +   +  N+D                            Y P  
Sbjct: 680 KVLLPWWNSFKFLDGQISLLKKTSNIDF--------------------------KYDPTI 713

Query: 806 EEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIE-NSKY 864
           +     +++++++WIL  L +  K ++              + DF   + + YI  N + 
Sbjct: 714 K-----SDNVMDRWILASLQTLVKNIHAEMKSYKLYAVVPRLLDFIDQLTNWYIRLNRRR 768

Query: 865 LIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQ----HLPKRASET----SE 916
           L  E  + +  +A ++L+  +   +  + PF PF+S+ ++Q    ++P+    T    S 
Sbjct: 769 LKGENGEQDCLNALNSLFDALFTFVCAMAPFTPFLSDNIYQRMKEYIPENVLSTFGPDSR 828

Query: 917 SIVKAKYPVFRQDFFDEE 934
           S+    YPV  +  FDE+
Sbjct: 829 SVHFLSYPVVDEKLFDEK 846

>YPL040C (ISM1) [5399] chr16 complement(475988..478996)
           Isoleucyl-tRNA synthetase, mitochondrial [3009 bp, 1002
           aa]
          Length = 1002

 Score =  151 bits (382), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 202/896 (22%), Positives = 361/896 (40%), Gaps = 147/896 (16%)

Query: 130 KSLDDPALKAYNPANVESSWYDWWVKSG----------FFEPELTK----DGKIK--PEG 173
           K+L+ P  K  N +N+E +  +   KS           FFE E +K    D K++   E 
Sbjct: 27  KTLNLPKTKFPNRSNLEITLRELIPKSSQLVYKEQLRDFFE-EFSKLNTTDEKLEFIKEK 85

Query: 174 IFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ 233
           +F +   PP   G LH+GHAL   ++D + RY   +GK + + PG+D  G+  +    K 
Sbjct: 86  LFILHDGPPYANGELHLGHALNKILKDIINRYQLSQGKYIFYKPGWDCHGLPIEIKALKD 145

Query: 234 IWANEKKTRHDYGREEFVKKVWDWKEVYHAK--IKSQ---VQRLGASYDWSREAFTLDPE 288
           + A + ++           K        HA+  IK Q    Q      DW     T+D +
Sbjct: 146 LSAQQIESISPLKIRSMALK--------HAQKAIKRQRETFQHFAILTDWETPYLTMDKD 197

Query: 289 LSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVE----NKEIAGKT---LLSV 341
              +    F  ++E G+I R ++ V W  +  TA++  E+E    +K IA      L   
Sbjct: 198 YEINQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEGELEYNENHKSIAAYVKFPLEKK 257

Query: 342 PGYDEKVEFGVLTS--------------------------FAYPVVDSDEKLIIATTRPE 375
              D   + G+  +                          F+Y ++  + +LI+  T   
Sbjct: 258 SQMDLCKKLGITNNLPIYCLIWTSTPWTLLSNRAICFNQDFSYSLLRLNSELILVETGSI 317

Query: 376 TMFGDTAIAIHP-DDPRYKHLHGKFVQHPFLPRKM--PIVCDAEAVDMEFGTGAVKITPG 432
              G T  +       +  HL+G + Q+  +  K+  P++  A  V    GTG V   PG
Sbjct: 318 DKLGLTTNSFETIKQFQGTHLNGLYYQNLLVDDKVGRPLLHGAH-VTSGTGTGLVHTAPG 376

Query: 433 HDQNDYNTGKRHDLEIINILTDDGLLNENCGPE------------WQGMKRFDAR--KRV 478
           H Q+DY  G ++ LEI + +   G    N  P+             +G +  DA   K +
Sbjct: 377 HGQDDYLIGIQNGLEIYSPVDHQGRYQLNELPQSVRSIVRDEGDLTKGRQVLDAETAKII 436

Query: 479 IEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITI 538
           + KL +L L     +     P   RS   +     PQW+    ++   A+ ++   R+  
Sbjct: 437 LCKLSDLNLLYKSHEYTHSYPYDWRSKKPVIIRATPQWFADLHDVKNLALESI--SRVKF 494

Query: 539 TPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIE-------------GKEQSRNE 585
            PK   S    ++++  +WCISRQ  WG     ++   E               E+ + +
Sbjct: 495 CPKRGYSRLSSFMKSRNEWCISRQRSWGIPILSFYKKSEPDSVLMNSEILAHAIEKIKQK 554

Query: 586 G-TYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMS 644
           G   W + ++  + ++   EK+ +  +   + +D +D WF SG        + +K+  +S
Sbjct: 555 GINAWFNDKD-NDMKEWLPEKYHDVAHEYCRSQDTMDVWFDSGSSWSVIKDFYEKSLKLS 613

Query: 645 TFYP--FSMLETGWDILYFWVARMILLGIKLTGNVP---FNEVFCHSLVRDAQGRKMSKS 699
                 + +   G D    W    +L  +  + NVP   + EV  H    D  G KMSKS
Sbjct: 614 KLPSPLYQVCLEGSDQHRGWFQSSLLTKVA-SSNVPVAPYEEVITHGFTLDENGLKMSKS 672

Query: 700 LGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFAL 759
           +GN + P  +I G             NL                  G+P  G D LR+ L
Sbjct: 673 VGNTISPEAIIRGDE-----------NL------------------GLPALGVDGLRY-L 702

Query: 760 CAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRL--GDDYVPPAEEQLSGNESLVE 817
            A +    DI      ++   +   K+    ++ L  L    D+     EQL      V+
Sbjct: 703 IAQSNFTTDIVAGPTVMKHVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRR----VD 758

Query: 818 KWILHELSSTAKTVNEAFDKRDFLTSTSAI-YDFWYLICDVYIENSKYLI--QEGTDLEK 874
           ++ L++++   +T  E + K +F      + Y     +   Y + SK ++   + + L +
Sbjct: 759 QYTLYKINELLETTREHYQKYNFSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLAR 818

Query: 875 KSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASETSESI----VKAKYPVF 926
           +  + TL  +++    ++ P +P + +E+W+++P+   +  E I    ++ K+P  
Sbjct: 819 RQVQTTLVHILNAYRAILAPILPVMVQEVWKYIPEGWLQGQEHIDINPMRGKWPFL 874

>CAGL0L12606g 1353211..1356159 similar to sp|P48526 Saccharomyces
           cerevisiae YPL040c isoleucine--tRNA ligase,
           mitochondrial, hypothetical start
          Length = 982

 Score =  150 bits (380), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 186/826 (22%), Positives = 315/826 (38%), Gaps = 144/826 (17%)

Query: 172 EGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 231
           E +F +   PP   G LH+GHAL   ++D + R+   +GKTV + PG+D  G+  +    
Sbjct: 72  ERLFVLHDGPPYANGDLHLGHALNKILKDFVNRFQLSQGKTVYYRPGWDCHGLPIEMKAL 131

Query: 232 KQIWANEK----KTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDP 287
           K +   +K    K R +  R+  ++ +         K + Q ++ G   DWS    T+D 
Sbjct: 132 KDLRDADKMDSVKVR-ELARQHALRSL--------DKQRDQFKKYGILTDWSDPYVTMDK 182

Query: 288 ELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAI--SNLEVENKEIAGKTLLSVP-GY 344
               +  + F ++   G+I R ++ V W     TA+  S LE   K ++    +  P   
Sbjct: 183 SFEVNQLKVFQKMFNMGLIKRQNKPVYWGTVTKTALAESELEYNEKHVSTAAYVKFPLTA 242

Query: 345 DEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPD--------DPRY---- 392
           D +            + +     +I T+ P T+F + AI  + +        D  Y    
Sbjct: 243 DSRAHLQDKLKLENELQNDQISCLIWTSTPWTLFSNRAICFNENFSYSLLQLDGSYVIVE 302

Query: 393 ----------------KHLHGKFVQHPFLPRKMPIVCDAEA--------VDMEFGTGAVK 428
                           K   GK ++  F     P+V D  A        V    GTG V 
Sbjct: 303 NNLINQLGSDHKGEILKTFEGKLLKGLFYYN--PLVSDIVARPLIHGDHVTDNAGTGLVH 360

Query: 429 ITPGHDQNDYNTGKRHDLEIINILTDDG--LLNE---NC------GPEWQGMKRFDARKR 477
             PGH  +DY  G  +DLEI + +  +G  +LNE   NC      G    G K  D+   
Sbjct: 361 TAPGHGHDDYFLGIENDLEIYSPVDHEGRYILNELPDNCKELLMEGGTGLGRKVLDSETT 420

Query: 478 --VIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGR 535
             +++ L +    +         P   R+   +     PQW+    ++   AI +++  +
Sbjct: 421 TVILDLLSKKQALLKAHKYTHSYPYDWRAKTPVIIRATPQWFADLHDVKDLAIKSLE--K 478

Query: 536 ITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVY---------FVNIEGKEQ----- 581
           +   PK   +    ++++  +WCISRQ  WG   PV+          +N E  E      
Sbjct: 479 VEFYPKRGENRLSSFIKSRNEWCISRQRSWGVPIPVFHNKSNPDKVLINDELLEYIITRI 538

Query: 582 SRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQD----EDVLDTWFSSG-LWPF----- 631
           S++    W S       +   ++ FP    T+ +D     D +D WF SG  W       
Sbjct: 539 SKHGSDLWFS------PEDDISDWFPENYRTMAKDFIKGTDTMDVWFDSGSTWNIIREFY 592

Query: 632 -STLGWPD-KTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVR 689
              LG      P  + +   S    GW    F  + +  +   ++   P+NEV  H    
Sbjct: 593 QKELGLSTVPQPLANVYLEGSDQHRGW----FQSSLLTKVACSMSEIAPYNEVITHGFTL 648

Query: 690 DAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQ 749
           D +G KMSKS+GN + P  +I G           K NL                    P 
Sbjct: 649 DEKGIKMSKSIGNTISPESIIEGD---------KKRNL--------------------PA 679

Query: 750 CGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPAEEQL 809
            G D LR     Y     D   D+       K   +  +  +  +  L  +        L
Sbjct: 680 LGIDGLR-----YFVAQADFTTDVTVGPTVLKHVAEALKKCRLTMRFLISNLEISKRYSL 734

Query: 810 SGNESL--VEKWILHELSSTAKTVNEAFDKRDFLTSTSAI-YDFWYLICDVYIENSKYLI 866
                L  V+K++L  ++   +   E +   +F  +  A+ +     +   Y + SK  +
Sbjct: 735 LNTSELRPVDKYVLASVNKLLEETKELYKVHNFSKALVALQFHMNNELSSFYFDISKDSL 794

Query: 867 QEGT--DLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKR 910
              +   L+++  + TL+ + D    ++ P +P + +E W  LPK+
Sbjct: 795 YSDSIESLKRRQIQTTLFHIYDAYRAMLAPILPILVQESWNFLPKQ 840

>KLLA0D11858g complement(1010259..1013231) similar to sp|P48526
           Saccharomyces cerevisiae YPL040c ISM1 isoleucine--tRNA
           ligase, mitochondrial, start by similarity
          Length = 990

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 188/863 (21%), Positives = 330/863 (38%), Gaps = 135/863 (15%)

Query: 172 EGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 231
           E +F +   PP   G LH+GHAL   ++D + R+  + GK V+++PG+D  G+  +    
Sbjct: 77  ENVFILHDGPPYANGDLHLGHALNKILKDIINRFQLLNGKHVVYIPGWDCHGLPIELKAL 136

Query: 232 KQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSR 291
            ++  N++  R    +   + +    K +     + Q ++ G   +W     T+DP+   
Sbjct: 137 NKL--NDQLDRISPTKIRSIARAHAQKTI--KSQRQQFEQFGILTNWDTNYVTMDPKFEI 192

Query: 292 SVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKE--IAGKTLLSVPGYDEKVE 349
           +    F  L  + +I R  + V W  +  TA++  E+E KE  I+    +  P  +E   
Sbjct: 193 NQLSVFQELFRKKLIKRQRKPVYWGTETKTALAEGELEYKEDHISIAAYVKFPLTEESK- 251

Query: 350 FGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHP--DDPRYKH------------- 394
               +   +P  ++    +I T+ P T+  + AI  +   D    KH             
Sbjct: 252 ----SVLGFP--EAPVSFLIWTSTPWTLLSNRAICFNQSLDYVLIKHNGEYMIVEKNLAD 305

Query: 395 -------------LHGKFVQHPFLPRKMPIVCD--------AEAVDMEFGTGAVKITPGH 433
                        L G F+ H  L    PI+ D         + V    GTG V   PGH
Sbjct: 306 KLDFLSGFELVKDLDGNFLSH--LKYTNPILKDNVTRPLFHGDHVTSVTGTGLVHTAPGH 363

Query: 434 DQNDYNTGKRHDLEIINILTDDG-------------LLNENCGPEWQGMKRFD--ARKRV 478
              DY  G ++ LEI + +  +G             LL E  G   +G K  D    +++
Sbjct: 364 GHEDYIIGIQNFLEIFSPVDHEGRYNVEELPAHLRDLLKEESG---KGRKVLDRTTTEKI 420

Query: 479 IEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITI 538
           +  L+   + +   +     P   RS   I     PQW+    ++   A+ A++   +  
Sbjct: 421 LSVLKGENMLMHHHEYVHSYPYDWRSKKPIIIRATPQWFADLHDVKTLALRALE--TVKF 478

Query: 539 TPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEGTY---------- 588
            P+   +    +++   +WCISRQ +WG   P      +      NE T           
Sbjct: 479 VPERGINRLSSFIKTRNEWCISRQRYWGVPIPSLHKRDDPDSVLMNEETISHIIKTIESK 538

Query: 589 ----WVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMS 644
               W +   ++   +   +K+ +  +   +  D +D WF SG        W      + 
Sbjct: 539 GVNSWFAESTVDSMYQWLPKKYHDIAHEYYRGTDTVDVWFDSGSSWNVIADWYKNVAGLQ 598

Query: 645 TFYPFSMLET---GWDILYFWVARMILLGIKLTG--NVPFNEVFCHSLVRDAQGRKMSKS 699
           +  P  + +    G D    W    +L  +  +G  + P+  V  H    D  G KMSKS
Sbjct: 599 SQLPVPLADIYLEGSDQHRGWFQSSLLTKVASSGMPDAPYKNVITHGFTLDENGIKMSKS 658

Query: 700 LGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFAL 759
           +GN + P  +I G               DP+                +P  G D LR  L
Sbjct: 659 IGNTISPGAIIKG---------------DPKA--------------NLPALGVDGLRL-L 688

Query: 760 CAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDD----YVPPAEEQLSGNESL 815
            A +    D+      ++       K     KF L  L +      +P +E +     +L
Sbjct: 689 VAQSNFTSDVVAGPTVMKHVADALKKFRLTFKFILGNLQETQSHGLIPFSELRRVDQYTL 748

Query: 816 VEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKK 875
           +    L  LS   K + + ++  + LT     Y     +  +Y   +K  +   +   KK
Sbjct: 749 LN---LKALSQETKKLYQQYNFSNVLTQVQ--YHMNNDLSALYFSVTKDSLYSDSLNNKK 803

Query: 876 --SARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKR--ASETSESIVKAKYPVFRQ--D 929
             S + TL+ ++D    ++ P +P + +E+W + PK      +SE + + + P  RQ   
Sbjct: 804 RLSIQTTLFHILDTYRSIMSPIIPIMVQEVWNYTPKEWINENSSEGVAEIETPFTRQWDS 863

Query: 930 FFDEESAADYNLVLSATKEARSL 952
             D  S+ D  L   A+ E + L
Sbjct: 864 LQDVPSSNDERLESFASNELKIL 886

>Scas_568.3
          Length = 1001

 Score =  147 bits (372), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 176/827 (21%), Positives = 323/827 (39%), Gaps = 140/827 (16%)

Query: 172 EGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 231
           E +F +   PP   G LH+GHAL   ++D ++RY    GK V + PG+D  G+  +  V 
Sbjct: 79  ENLFILHDGPPYANGDLHLGHALNKILKDIIVRYQYSSGKYVFYKPGWDCHGLPIELKVL 138

Query: 232 KQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKI-----KSQVQRLGASYDWSREAFTLD 286
           K +   + +T          +K        HA       + Q  +     DW+    T+D
Sbjct: 139 KSLPKKDIETISPEKIRSMARK--------HALTAIDHQRKQFHQFAIFTDWNDPYITMD 190

Query: 287 PELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDE 346
            +      + F +++ EG+I R ++ V W  +  TA++  E+E      K+  S   Y  
Sbjct: 191 KKFEIDQLKIFQKMYHEGLILRQNKPVFWGTETKTALAESELE----YNKSHESTSAY-- 244

Query: 347 KVEFGVLTSFAYPVVDS-----DEKLIIA----TTRPETMFGDTAIA------------- 384
            V+F +    +  ++++     D  + I+    T+ P T+F + AI              
Sbjct: 245 -VKFPLTKQSSLQLIENLNIVQDTPVTISCLIWTSTPWTLFSNRAICFNQNFSYSLVKLV 303

Query: 385 --------------IHPDDPRY---KHLHGKFV-----QHPFLPRKMPI-VCDAEAVDME 421
                         I  + P Y   K   G+ +     ++P    + P+ +     V  +
Sbjct: 304 DNNNEFILVESNLLIQLNIPNYDIVKTFSGELLTNLKYENPLFSEEEPLPLLHGTHVTND 363

Query: 422 FGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDG-------------LLNENCGPEWQG 468
            GTG V   PGH  +DY  G R++L I + +  +G             LL +   P   G
Sbjct: 364 TGTGLVHTAPGHGPDDYLVGIRNNLPIYSPVDHEGRYNLSELPSSTHKLLTDPDAPGNTG 423

Query: 469 MKRFDARKR--VIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKE 526
               D +    +IEKL+EL +    +      P   RS   +     PQW+++  +M + 
Sbjct: 424 RYVLDPKTTLIIIEKLKELNMLFRSKKYTHSYPYDWRSKKPVIIRATPQWFLNLAKMKQL 483

Query: 527 AINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKEQSRNEG 586
           A+ ++ D ++   P+   +    +++N  +WCISRQ  WG   P ++      E   NE 
Sbjct: 484 AVESLND-KVNFFPERGKTRLLSFIKNRNEWCISRQRAWGVPIPAFYRIENSDEVLMNEE 542

Query: 587 TYWVSGRNLEE-------------AQKKAAEKFPNEVYTLEQDEDVLDTWFSSGL-WPFS 632
                 + +E               ++   E + N  +   +  D +D WF SG  W   
Sbjct: 543 IINHVIKTIESNGIDKWFDQYSSPTEEWLPESYKNVAHEYRRGTDTMDVWFDSGSSWKVI 602

Query: 633 TLGWPD--KTPDMSTFYP--FSMLETGWDILYFWVARMILLGIKLT--GNVPFNEVFCHS 686
              + D  K  + S      F +   G D    W   ++L  +  +     P+  +  H 
Sbjct: 603 ESFYHDTLKIRNGSVLPSPLFDVALEGSDQHRGWFQSLLLTKVAYSKVAEAPYRNIITHG 662

Query: 687 LVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNG 746
              D +G KMSKS+GN + P  VI G+                                G
Sbjct: 663 FTLDEKGIKMSKSIGNTISPTDVIQGNPAR-----------------------------G 693

Query: 747 IPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRL--GDDYVPP 804
           +   G D LR+ + A++   +D+ +    ++   +   KI    +F L  L     + P 
Sbjct: 694 LIPLGIDGLRYYV-AHSNFTKDLVVGANIMKRVSESLKKIRITFRFLLSNLEKSGTFEPL 752

Query: 805 AEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAI-YDFWYLICDVYIENSK 863
           A E+L      V+++I+  L        E++   +F    + + +     +   Y ++SK
Sbjct: 753 AVEELRP----VDQYIISTLQKLLAESKESYQSYNFSKILTTLQHHLSSELSAFYFDSSK 808

Query: 864 YLIQEG--TDLEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLP 908
             +     T  ++K  +  L  ++     +++P +P + +E+  ++P
Sbjct: 809 DSLYSDSITSEKRKQIQTVLLYVLQTYSTILNPILPTLIQEVRNYIP 855

>Kwal_27.11827
          Length = 985

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 179/814 (21%), Positives = 317/814 (38%), Gaps = 132/814 (16%)

Query: 174 IFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQ 233
           +F +   PP   G LH+GHA+   ++D + RY  ++GK + + PG+D  G+  +    ++
Sbjct: 74  LFVLHDGPPYANGDLHLGHAMNKMLKDIINRYQLLQGKFIFYKPGWDCHGLPIELKALQK 133

Query: 234 IWANEKKTRHDYGREEFVKKVWDWKEVYHAKI----KSQVQRLGASYDWSREAFTLDPEL 289
           +  +E         E F  ++      +  K      SQ ++   + DW     T+  + 
Sbjct: 134 LNKDES--------ELFPTRIRKLASQHAQKTIKSQASQFKQFAIATDWDDCYETMQQQF 185

Query: 290 SRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEI--AGKTLLSVPGYDEK 347
                +    + ++G+I R ++ V W  +  TA++  E+E ++   +    +  P  +E 
Sbjct: 186 EFDQLDNLKIMIQKGLIKRQNKPVYWGTETKTALAEGELEYRDDHESMSAFIKFPLTEES 245

Query: 348 VEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPD-DPRYKHLHGKFV------ 400
               V+  +    +DS   L I T+ P T+F + A+  +   D     L+ ++V      
Sbjct: 246 SR--VVAEWNKLRLDSPISLAIWTSTPWTIFANQAVCFNESFDYGLYELNNEYVVLESGL 303

Query: 401 -------------------------QHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQ 435
                                      PFL +    +   + V    GTG V   PGH  
Sbjct: 304 GSKVLPDIARLIATIPGTKLKDLKYYIPFLNKSPKPLIHGDHVTNISGTGLVHTAPGHGH 363

Query: 436 NDYNTGKRHDLEIINILTDDGLLNENCGP----EWQGMKRFDARKRVIEKLQELGLFVSQ 491
           +DY  G ++ L I + + D+G    +  P    E          ++V+ +     +    
Sbjct: 364 DDYLIGVKNGLNIYSPVDDEGRYKTDMMPSHLREILIEPETGKARKVLSEATTSQILTML 423

Query: 492 QDNEMVI---------PTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDGRITITPKS 542
           Q+++M++         P   RS   +     PQW+    ++   A+ ++K+  +T  P+ 
Sbjct: 424 QNHQMLLRAEKYIHSYPYDWRSKKPVIVRSTPQWFADLTDVKSLALESLKN--VTFHPER 481

Query: 543 SASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGKE--QSRNEGTYWVSGRN------ 594
             +    ++++  +WCISRQ  WG   P +    + +E   S     Y +S         
Sbjct: 482 GLNRLTSFIKSRNEWCISRQRSWGVPIPAFHKVGKSEEVLMSEEVAKYAISAIKRKGIDA 541

Query: 595 -LEEAQKKAAEKFP----NEVYTLEQDEDVLDTWFSSG-LWPF------STLGWPDKTPD 642
             +E      E  P    +  +   +  D +D WF SG  W          LG P     
Sbjct: 542 WFKEDNSDINEWLPPSYQDRGHEYRRGRDTVDVWFDSGSTWKVIDRFYNHRLGLPLPRSP 601

Query: 643 MSTFYPFSMLETGWDILYFWVARMILLGIKLTG--NVPFNEVFCHSLVRDAQGRKMSKSL 700
           ++  Y    LE G D    W    +L  +   G    P+  V  H    D  G KMSKSL
Sbjct: 602 LADLY----LE-GSDQHRGWFQSSLLTKVATAGIPQAPYAAVLTHGFTLDENGSKMSKSL 656

Query: 701 GNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRFALC 760
           GN + P  VI                          AG K+    GIP  G D LR  L 
Sbjct: 657 GNTILPSAVI--------------------------AGDKD---RGIPALGVDGLRL-LI 686

Query: 761 AYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRL-----GDDYVPPAEEQLSGNESL 815
           A T    D+++    ++   +   K+    KF L  L     G + +P  + +     +L
Sbjct: 687 AQTDFTTDVSIGPTVIKHVAEALKKLRLTLKFMLGNLQKTAAGCELLPFEKLRDIDQYTL 746

Query: 816 VEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGT--DLE 873
            +   L ELS  AK   +A++    L  T+ +Y     +   Y + +K  +  G+   L+
Sbjct: 747 CK---LQELSIQAKDHYDAYNFSKVL--TAVLYHMNNQLSAFYFDVTKDALYSGSINSLK 801

Query: 874 KKSARDTLYTLVDNALRLIHPFMPFISEEMWQHL 907
           ++  R TL+ + D    ++ P +P + +E W  L
Sbjct: 802 RQQIRTTLFHIFDTYRSILGPILPVMIQEAWNCL 835

>KLLA0E05269g 476546..479173 similar to sp|P11325 Saccharomyces
           cerevisiae YLR382c NAM2 leucine--tRNA ligase precursor,
           mitochondrial singleton, start by similarity
          Length = 875

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/406 (25%), Positives = 169/406 (41%), Gaps = 105/406 (25%)

Query: 162 ELTKDGKIKPEGIFCI-PAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFD 220
           +L+KD + K   + C+ P P    +G LHIGH     I D + R+ ++KG  VL   G+D
Sbjct: 40  KLSKDDRNKNIYVLCMFPYP----SGTLHIGHLRVYTISDVVNRFYQLKGYNVLHPMGWD 95

Query: 221 HAGIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSR 280
             G+  ++       A E+K             +W  + +   K+K+Q+  + ++++W R
Sbjct: 96  AFGLPAENA------AIERKVN---------PAIWTKENI--GKMKAQMGMMASNFNWDR 138

Query: 281 EAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVEN---------- 330
           E  T DPE  +   + F+ L + G  YR    +NW     T ++N +V++          
Sbjct: 139 EIATCDPEYYKFTQKLFLELFKNGYAYRKEAEINWDPVDQTVLANEQVDSNGKSWRSGAQ 198

Query: 331 --KEIAGKTLLSVPGYDEKVEF------------------------GVLTSFAYPVVDSD 364
             K++  +  L +  +  +++                         GV   F  P +D  
Sbjct: 199 VEKKLLSQWFLGITRFAHELQHDLDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPSIDP- 257

Query: 365 EKLIIATTRPETMFG--------DTAIA-------------IH-----PDDPRYKH-LHG 397
             + I TTRPET++         D +I              IH     P+D +  + L  
Sbjct: 258 --IKIFTTRPETLYSVQFVTLALDHSIVRKLKEEDNNLQEFIHRAEKLPEDSKKGYMLSN 315

Query: 398 KFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILT---- 453
            F QHP  P+K   +  A  V   +G GAV   P HDQ D++  K +      I T    
Sbjct: 316 IFCQHPLDPKKTVPIFVAPYVLGNYGHGAVMGCPAHDQRDFDFWKENCPGKPMIYTVSSA 375

Query: 454 ------------DDGLLNENCGPEWQGMKRFDARKRVIEKLQELGL 487
                        DG++NEN G +  G+   +ARK V+EKL  LGL
Sbjct: 376 EAKIDTSGPYVSKDGVMNENAG-DLVGLTTHEARKLVVEKLTSLGL 420

>YLR382C (NAM2) [3761] chr12 complement(882067..884751) Leucyl-tRNA
           synthetase, mitochondrial, forms a ternary complex with
           bI4 maturase and bI4 intron and stimulates bI4 intron
           splicing activity, dominant alleles suppress mutations
           in the bI4 maturase [2685 bp, 894 aa]
          Length = 894

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 152/398 (38%), Gaps = 112/398 (28%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWANEKK 240
           P  +GALHIGH     I DSL R+ + KG  V+   G+D  G+ A  + +E+ I      
Sbjct: 56  PYPSGALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSI------ 109

Query: 241 TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300
                        +W    +  AK+K Q+Q + A++DW RE  T DPE  +     F++L
Sbjct: 110 ----------NPAIWTRDNI--AKMKQQMQSMLANFDWDREITTCDPEYYKFTQWIFLKL 157

Query: 301 HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFA--- 357
            E G+ YR    +NW     T ++N +V+ +  + ++   V     K  F  +T FA   
Sbjct: 158 FENGLAYRKEAEINWDPVDMTVLANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKL 217

Query: 358 -------------------------------YPVVDSD-EKLIIATTRPETMFGDTAIAI 385
                                          + V D   E LI+ TTRPET+F    +A+
Sbjct: 218 KKHLNQLKDWPSNVKQMQKNWIGESVGAELVFKVADPKFENLIVFTTRPETLFAVQYVAL 277

Query: 386 HPDDPRYKHLH------GKFVQ---------------------HPFLPRKMPIVCDAEAV 418
             D P  +          +F+Q                     +P    ++PI   A  V
Sbjct: 278 ALDHPIVQKYCEEMPDLKEFIQKSDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFA-APYV 336

Query: 419 DMEFGTG--AVKITPGHDQNDY---------------------------NTGKRHDLEII 449
              +G+   AV   PGHD  D+                              ++  ++ +
Sbjct: 337 VSSYGSAPSAVMGCPGHDNRDFEFWQTNCPGEHIKTCIAPFFDDASKVTEQERQRIIDTV 396

Query: 450 NILTDDGLLNENCGPEWQGMKRFDARKRVIEKLQELGL 487
              + DG+L + CG E  G+    ARK ++  L   GL
Sbjct: 397 PFTSTDGVLTKECG-EHSGVLTVVARKSIMGMLNSEGL 433

>AER043C [2548] [Homologous to ScYLR382C (NAM2) - SH]
           (711416..714037) [2622 bp, 873 aa]
          Length = 873

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 170/825 (20%), Positives = 290/825 (35%), Gaps = 204/825 (24%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWANEKK 240
           P  +G LHIGH     I D+L R+ RMKG  V+   G+D  G+ A  + +E+ I      
Sbjct: 56  PYPSGMLHIGHLRVYTISDALNRFYRMKGYEVVHPMGWDAFGLPAENAALERGIAPA--- 112

Query: 241 TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300
                          DW     A++K Q   + A ++W RE  T DPE  R   E F+ L
Sbjct: 113 ---------------DWTRQNIARMKQQKGDMLAHFEWGREVTTCDPEYYRFTQELFLEL 157

Query: 301 HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPV 360
              G+ Y+    +NW     T ++N +V+ +  + ++   V        F  +T FA+ +
Sbjct: 158 WHHGMAYKKEAEINWDPVDKTVLANEQVDAQGRSWRSGALVEKRKLNQWFLRITRFAHEL 217

Query: 361 ---------------------------------VDSDEKLIIATTRPETMFGDTAIAIHP 387
                                                E ++  T R E +FG   +AI  
Sbjct: 218 SHDLDGLDGWPAKVKAMQKHWIGEVEGTEVRLCTGDGEAIVAFTPRIEAVFGLQYVAIST 277

Query: 388 DDPRYK---------------------------HLHGKFVQHPFLP---RKMPI-VCDAE 416
           +    K                            L G +VQHPF      ++P+ V    
Sbjct: 278 EHALTKKMAERLPELCEFLQRPLVLSESDLSGFQLPGTYVQHPFAKDHGHRIPVFVSPYV 337

Query: 417 AVDMEFGTGAVKITPGHDQNDYN--TGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDA 474
             D   G GAV  TP HD+ D+      +    +I+     G  ++ C  + +G+   +A
Sbjct: 338 PAD---GAGAVLGTPAHDEFDHKFWRANKPAEPVISSFEASGECDDECHIQTKGI--LNA 392

Query: 475 RKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDG 534
           +   ++        +S QD + V+                           + + A  DG
Sbjct: 393 KAGNLKG-------ISSQDAKQVL--------------------------ADKLVATGDG 419

Query: 535 RITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEGK---------EQSRNE 585
           R T       ++Y      ++DW ISRQ +WG   P+ + +  G              N 
Sbjct: 420 RQT-------TQY-----RLRDWLISRQRYWGAPIPIIYCDSCGTVPVPKQDLPVMLPNI 467

Query: 586 GTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTL---------GW 636
                 G  LE   +      P+     +++ D +DT+  S  + F  L         G+
Sbjct: 468 AGLSKKGNTLEHIPEFVNTSCPSCGGPAKRETDTMDTFMDSSWYFFRYLDSHNQKEPFGY 527

Query: 637 PDKTPDMSTFYPFSMLETGWD--ILYFWVARMILLGIKLTG--------NVPFNEVFCHS 686
              T  M    P  M   G +  IL+   AR I   +   G          PF  +    
Sbjct: 528 DKATRSM----PVDMYIGGVEHSILHLLYARFISKFLASIGKWDGSACNGEPFKRLVTQG 583

Query: 687 LVR-----DAQGRKMSK----SLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKA 737
           +V      D +     K     + N  DP+   TG      +  +SK   +  +  +   
Sbjct: 584 MVHGKTFIDPENGSFLKPEELDMSNPADPIICRTGQKPRVSYEKMSKSKYNGADPAQC-- 641

Query: 738 GQKESYPNGIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRL 797
                    I + G DA+R  +         +N D  ++ G  ++  +I    K A    
Sbjct: 642 ---------ISKHGPDAIRAHILFQAPISDVVNWDETKIVGIERWLARI---IKLAHTLA 689

Query: 798 GDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDV 857
            D  +      ++   ++ E  + +E+     ++ ++F +   L+  + I D        
Sbjct: 690 ADSQL--KHGPVAKLTNMHEIALFNEVQKLLGSITDSFSRT--LSLNTVISD-------- 737

Query: 858 YIENSKYLIQEGTDLEKKSARDTLYTLVDNALRLIHPFMPFISEE 902
           Y++ +  L Q   + +   A   L T     + +IHP +P +SEE
Sbjct: 738 YMKLTNLLDQALKNKDINPA--WLLTHFKKLVSVIHPTVPAVSEE 780

>Kwal_26.9374
          Length = 884

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 103/477 (21%), Positives = 170/477 (35%), Gaps = 129/477 (27%)

Query: 161 PELTKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFD 220
           P L K GK           P P  +G LHIGH     I D+L R+ +  G  V+   G+D
Sbjct: 39  PVLPKSGKDHNNVYILSMFPYP--SGNLHIGHLRVYTITDALNRFYKQNGYNVIHPMGWD 96

Query: 221 HAGI-ATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWS 279
             G+ A  + +E+++                      W     AK+K Q+  + A++DW 
Sbjct: 97  AFGLPAENAAIERKV------------------NPASWTHQNIAKMKEQLNNMLANFDWD 138

Query: 280 REAFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLL 339
           RE  T +P+  +   + F+ L + G+ YR    +NW     T ++N +V+ +  + ++  
Sbjct: 139 REVTTCNPDYYKHTQKLFLELFKRGLAYRKDAEINWDPVDQTVLANEQVDAQGRSWRSGA 198

Query: 340 SVPGYDEKVEFGVLTSFAYPV---------------------------------VDSDEK 366
            V        F  +T +A+ +                                   + E 
Sbjct: 199 LVEKRKLNQWFLGITKYAHALQHDLNQLQDWPRNVKTMQKNWVGESHGTEIDFKCSTSET 258

Query: 367 LIIATTRPETMFGDTAIAIHPDDPRYK---------------------------HLHGKF 399
           + + TTRPET+F    +A+  D+P  +                            L G  
Sbjct: 259 IQVFTTRPETLFSVQYVALALDNPVIEKAAISDPELRKFIDQAKFLSPDCKDGYQLKGVK 318

Query: 400 VQHPFLPRK---MPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDG 456
            ++P L      +PI   A  V   +G GAV   P HD+ D                   
Sbjct: 319 AKNPILKAAEYDLPIFA-APYVLGNYGKGAVMGCPAHDERD------------------- 358

Query: 457 LLNENCGPEW-QGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQ 515
                    W Q M     +  +I K  E G       N + +P  S+SG          
Sbjct: 359 ------NAFWAQNMPGHPTKPSIIAK--EDG----TATNLLQLPFTSKSG---------- 396

Query: 516 WWVSQGEMAKEAINAVKDGR-ITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPV 571
             +S   M    ++     + +T   +SS +  +     ++DW ISRQ +WG   P+
Sbjct: 397 -ILSSAAMTYAGMDTTTAAKQMTKALESSGNGRYMVSYKLRDWLISRQRYWGTPIPI 452

>CAGL0H05049g complement(483870..486593) similar to sp|P11325
           Saccharomyces cerevisiae YLR382c NAM2, hypothetical
           start
          Length = 907

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 175/822 (21%), Positives = 308/822 (37%), Gaps = 186/822 (22%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWANEKK 240
           P  +G LH+GH     I D+L R+ + +G  V+   G+D  G+ A  + +E+ I  +E  
Sbjct: 77  PYPSGMLHMGHLRVYVISDTLNRFYQQRGYNVIHPMGWDAFGLPAENAAIERGIDPSE-- 134

Query: 241 TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300
                           W +    K+K Q+  + A+++W RE  T DPE  +     F++L
Sbjct: 135 ----------------WTKQNIKKMKEQMNDMLANFNWEREVTTCDPEYYKFTQWLFLQL 178

Query: 301 HEEGVIYRASRLVNWSVKLNTAISNLEVE------------NKEIAGKTLLSVPGYDEKV 348
           ++ G+ YR    +NW     T ++N +V+             K+   +  L +  + +++
Sbjct: 179 YKNGLAYRKDAEINWDPVDKTVLANEQVDANGRSWRSGAIVEKKKLTQWFLGITKFVDQL 238

Query: 349 E------------------------FGVLTSFAY-PVVDSDEKLIIATTRPETMFGDTAI 383
                                     G+  +F     +   E + + TTR ET+F    +
Sbjct: 239 RDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKIGKFENVTVFTTRAETLFSVEYV 298

Query: 384 AIHPDDPRYKH-----------LH----------------GKFVQHPFLPRKMPIVCDAE 416
            +  D P  +H           LH                   V++P     +P+   A 
Sbjct: 299 VLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTGYRISDLTVENPITHEVIPVFV-AP 357

Query: 417 AVDMEFG--TGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLLNENCGPEWQGMKRFDA 474
            V   +G    AV   P HD  DY   K               +N N   E  G      
Sbjct: 358 YVISGYGDLPAAVMGCPAHDLRDYEFRK---------------INLNTNEEPFGC----- 397

Query: 475 RKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEMAKEAINAVKDG 534
              +I  L  LG     QD+   IP  S+SG + E   K   W          +NA +D 
Sbjct: 398 ---IIPDLSRLG-----QDS---IPYTSKSGTMNERCGKYVGW---------DVNATRDA 437

Query: 535 RIT-ITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNIEG----KEQSRNEGTYW 589
             T +  K+       +   I+DW ISRQ +WG   P+   N  G     E+       +
Sbjct: 438 ISTELENKNLGKRTTRY--RIKDWLISRQRYWGSPIPIIHCNNCGIVPVPEEDLPVTLPY 495

Query: 590 VSGRN-----LEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMS 644
           V G +     L         + P    + +++ D +DT+  S  + F  +   +K    S
Sbjct: 496 VQGLHQKGNPLSNISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVLPFS 555

Query: 645 -----TFYPFSMLETGWD--ILYFWVARMILLGIKLTG--------NVPFNEVFCHSLVR 689
                   P  +   G +  IL+   +R I   +   G          PF ++    +V 
Sbjct: 556 PEKANKSMPVDIYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQGMV- 614

Query: 690 DAQGRKM-SKSLGNVVDP--LYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPN- 745
             QG+ +     G  + P  +  ++ SS  ++        L   ++ K+K    +  PN 
Sbjct: 615 --QGKTLIDPETGKFLTPNDIDYLSSSSTPKIKGKNIAPILKYEKMSKSKYNGAD--PNE 670

Query: 746 GIPQCGTDALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQ-ATKFALMR---LGDDY 801
            I + G DA R  +   +     +  D  ++ G  ++ +KI Q    FA      +G   
Sbjct: 671 CISKHGPDATRAHILFQSPISDALRWDEEKIVGIERWLDKILQLCMSFASNPDKIVGMTG 730

Query: 802 VPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIEN 861
           +PP  +Q + +E      + + +S    ++ ++F +   L+  + I D  Y+     +EN
Sbjct: 731 IPP--DQYNTDEIT----LYNNVSKMVNSITKSFSEN--LSLNTVISD--YMKLTTLLEN 780

Query: 862 SKYLIQEGTDLEKKSARDTL-YTLVDNALRLIHPFMPFISEE 902
           +K         +    RDT+    V + ++ I+P +P I+EE
Sbjct: 781 AK---------KNTKIRDTVTINYVRDLIKCIYPVVPSIAEE 813

>Scas_719.5
          Length = 939

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 180/847 (21%), Positives = 314/847 (37%), Gaps = 231/847 (27%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGI-ATQSVVEKQIWANEKK 240
           P  +G LH+GH     I DSL R+ + +G  V+   G+D  G+ A  + + + I      
Sbjct: 79  PYPSGTLHMGHLRVYVISDSLNRFFKQRGYEVIHPMGWDAFGLPAENAAIARGI------ 132

Query: 241 TRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRL 300
                          DW +   AK+K Q+  + A++DW RE  T DP+  +     F++L
Sbjct: 133 ------------NPADWTKQNIAKMKEQMNNMLANFDWDREVTTCDPDYYKFNQWIFLKL 180

Query: 301 HEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFA--- 357
           +E G+ Y+    +NW     T ++N +V++  I+ ++   V     K  F  +T FA   
Sbjct: 181 YENGLAYQKEAEINWDPVDKTVLANEQVDSNGISWRSGAKVEKRQLKQWFLGITKFAKDL 240

Query: 358 ---------YP-------------------VVDSDEKLI----IATTRPETMFGDTAIAI 385
                    +P                   +  +D +L     + TTR ET+F    +A+
Sbjct: 241 RKDLYTLKKWPENVKTMQRNWIGESSGATLLFGTDNELFKHIQLFTTRAETLFAVQFVAL 300

Query: 386 ---HP-------DDPRYKHL------------HGKFVQ-----HPFLPRKM-----PIVC 413
              HP        DP+ +               G  ++     +P   +K+     P V 
Sbjct: 301 SKEHPIVEHYAKTDPKLREFITIMDTLPDDSKTGYLLKDIKAINPLTKKKVSIFVAPYVI 360

Query: 414 DAEAVDMEFGTGAVKITPGHDQNDY-----NTGKRHDLEIIN---ILTDD---------- 455
            +   D E G  AV   P HD+ D+     N+     +  I+   +L DD          
Sbjct: 361 GSYGSDNEPG-AAVMGCPAHDERDFAFWHENSPNEPIISCIDPFTLLEDDSITALNSPLP 419

Query: 456 -----GLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEP 510
                G ++E C  E+ G+    AR  +++KL+   L                       
Sbjct: 420 YTYDLGSMSEICA-EYHGLATEAARASIVQKLRSENL----------------------- 455

Query: 511 ILKPQWWVSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCP 570
                                  G  TI  K            I+DW ISRQ +WG   P
Sbjct: 456 -----------------------GHTTINYK------------IRDWLISRQRYWGTPIP 480

Query: 571 VYFVNIEGKEQSRNEG---------TYWVSGRN-LEEAQKKAAEKFPNEVYTLEQDEDVL 620
           +   +  G      +          T    G N L +  +    K P+     +++ D +
Sbjct: 481 IIHCDHCGPVPVPEKDLPVMLPEVKTITAKGGNPLSQIPEFVNAKCPSCGSDAKRETDTM 540

Query: 621 DTWFSSGLWPFSTLGWPDKT----PDM-STFYPFSMLETGWD--ILYFWVARMILLGIKL 673
           DT+  S  + F  L   +K     P + S   P  +   G +  IL+   AR I    K 
Sbjct: 541 DTFMDSSWYFFRYLDPKNKELPFDPKLASRNIPVDIYIGGVEHAILHLLYARFI---SKF 597

Query: 674 TGNV-----------PFNEVFCHSLVRDAQGRK-MSKSLGNVVDPLYVITGSSLEELHAT 721
            G++           PF ++    +V   QG+  ++   G  + P  V   ++  + H  
Sbjct: 598 LGSIGMFDGAKFKFEPFKQLVTQGMV---QGKTYINPENGRFLKPDEVELDTA--KGHPI 652

Query: 722 LSKGNLDPR-EVEK-AKAGQKESYPNG-IPQCGTDALRFALCAYTTGGRDINLDILRVEG 778
           +    L P+   EK +K+    + PN  I + G DA R  +   +     +  D +++ G
Sbjct: 653 IKATGLAPQVSYEKMSKSKYNGADPNQCIAKHGPDATRAHILFQSPITDALAWDEVKIIG 712

Query: 779 YRKFCNKIYQATKFAL--MRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFD 836
             ++  ++ + T       +   DY  P++      +  +E    +E+    K++ + FD
Sbjct: 713 IERWLIRVIRHTMVLSKEQKYAFDYTTPSDM----TDPEIE--FHNEIQRLLKSITQGFD 766

Query: 837 KRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTDLEKKSARDTLYTL-VDNALRLIHPF 895
              +L+  + I D  Y+     +EN+          + K+ R  L  L +   + +I+P 
Sbjct: 767 I--YLSLNTVISD--YMKFTNVLENA---------YKNKTVRKELQMLNLQKLISVIYPV 813

Query: 896 MPFISEE 902
            P ISEE
Sbjct: 814 TPSISEE 820

>Sklu_2298.2 YPL160W, Contig c2298 4548-7838
          Length = 1096

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 139/420 (33%), Gaps = 119/420 (28%)

Query: 257 WKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR-----LHEEGVIYRASR 311
           W E+     +      GA  DW R   T D        +AF+R     L   G I    R
Sbjct: 199 WSELLPTIGEQDSTSFGARIDWRRSFITAD---MNPYYDAFIRWQMNKLKALGKIKFGER 255

Query: 312 LVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL---- 367
              +S K   A  + + ++ E  G T     G   K+E       A  +VDS + L    
Sbjct: 256 YTIYSEKDGQACMDHDRQSGE--GVTPQEYIGI--KIEVTEFAPEAKKIVDSSDALDKSK 311

Query: 368 ----IIATTRPETMFGDTAIAIHPD---------DPRY---------------------- 392
               + AT RPETM+G T   + P          D  Y                      
Sbjct: 312 KIYFVAATLRPETMYGQTCCFVSPKIEYGIFDAGDAYYITTERAFKNMSYQKLTPKRGYY 371

Query: 393 --------KHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGK-- 442
                   KH  G  +  P    +   +   E V    GTG V   P +  +DY T K  
Sbjct: 372 KPIVTISGKHFIGSKIHAPLAAYEELRILPMETVIANKGTGVVTCVPSNSPDDYMTTKDL 431

Query: 443 --------------RHD-LEIINI-----LTDDGLLNEN--------------------- 461
                         +H+ + IIN      L    +  EN                     
Sbjct: 432 QHKPEYYGIEADWIKHEPIPIINTEKYGDLIAKAVCEENKIKSPKDTNQLAEAKKIAYKE 491

Query: 462 -------CGPEWQGMKRFDARKRVIEKLQELG-LFVSQQDNEMVIPTCSRSGDVIEPILK 513
                     +++G K   A+ +V   +   G  FV  +   +VI   SRSGD     L+
Sbjct: 492 DYYTGTMIYGKYKGEKVEAAKSKVKSDMIAAGQAFVYDEPESLVI---SRSGDECIVSLE 548

Query: 514 PQWWVSQGEMA--KEAINAVKDGRITITPKSSASE-YFHWLENIQDWCISRQLWWGHRCP 570
            QW+V  GE +  ++AI  ++   +      +A E    WL+N   W + R    G R P
Sbjct: 549 DQWYVDYGEESWKEQAIECLEQMELFAPEVKNAFEGVLEWLKN---WAVCRTYGLGTRLP 605

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 232
           P + G LH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 121

>AAL088W [99] [Homologous to ScYPL160W (CDC60) - SH]
           complement(185828..189142) [3315 bp, 1104 aa]
          Length = 1104

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 175 FCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 232
           F  P   P + G LH+GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 72  FMAPMAYPYMNGVLHVGHCFTMSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 129

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 96/433 (22%), Positives = 139/433 (32%), Gaps = 122/433 (28%)

Query: 246 GREEFVK--KVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR---- 299
            RE+ +K      W   +    +     +GA  DW R   T D        +AFVR    
Sbjct: 196 AREDVIKFADAQHWLTYFPPLCEEDCTAIGARVDWRRAYITTD---MNQYYDAFVRWQMN 252

Query: 300 -LHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAY 358
            L E G +    R   +S +   A  + + ++ E  G T     G   K+E     + A 
Sbjct: 253 KLREAGKVKFGERYTIYSERDGQACMDHDRQSGE--GVTPQEYVGI--KIEVLEFAAEAQ 308

Query: 359 PVVDSDE-------KLIIATTRPETMFGDTAIAIHP---------DDPRY---------- 392
            ++D+           I AT RPETM+G T   + P          D  Y          
Sbjct: 309 EIIDNSGLDKSKKIHFIAATLRPETMYGQTCCFVSPTLQYGVFDAGDSYYITTERAFKNM 368

Query: 393 --------------------KHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPG 432
                               K   G  VQ P    K   +   E V    GT  V   P 
Sbjct: 369 SYQKLTPQRGYYKPLFTIEGKKFVGSKVQPPLSVYKEVRILPMENVIASKGTAVVTCVPS 428

Query: 433 HDQNDYNTGKRH--------------DLEIINILT----DDGLLNENC------------ 462
           +  +DY T +                D EI+ I++     D +    C            
Sbjct: 429 NSPDDYMTTQELKNKPEYYGIKPEWIDFEILPIISTEKYGDFIAKAICEEMKIRSPRDII 488

Query: 463 ---------------------GPEWQGMKRFDARKRVIEKLQELG-LFVSQQDNEMVIPT 500
                                GP  +G K   A+  V ++L   G  F+  +   +VI  
Sbjct: 489 PLAEAKKLAYKEDFYNGVMIYGP-LKGTKVAQAKNLVRDQLIAEGKAFIYNEPESVVI-- 545

Query: 501 CSRSGDVIEPILKPQWWVSQGEMA-KEAINAVKDGRITITP--KSSASEYFHWLENIQDW 557
            SRSGD     L+ QW++  GE   K+      +      P  K+       WL+N   W
Sbjct: 546 -SRSGDECIVSLEDQWYLDYGEPTWKKQAEECLEEMCLFAPEVKNHFEGVLDWLKN---W 601

Query: 558 CISRQLWWGHRCP 570
            +SR    G R P
Sbjct: 602 AVSRTYGLGTRLP 614

>KLLA0D06105g complement(522480..525767) highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine--tRNA
           ligase, cytosolic singleton, start by similarity
          Length = 1095

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/361 (20%), Positives = 117/361 (32%), Gaps = 107/361 (29%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK-----QIWA 236
           P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  +K     +++ 
Sbjct: 71  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPIGFHCTGMPILACADKLKREAELFG 130

Query: 237 NE------------------------------------KKTRHDY----------GREEF 250
           N+                                    K+ R  Y           RE+ 
Sbjct: 131 NDYSNVPAEDAEEEQEAKPAAQSDDVTKFKAKKSKAAAKQGRGKYQFEIMLQLGIAREDV 190

Query: 251 VK--KVWDWKEVYHAKIKSQVQRLGASYDWSREAFT--LDPELSRSVTEAFVRLHEEGVI 306
           +K      W   +    ++     GA  DW R   T  L+P   + +     +L + G I
Sbjct: 191 IKFADASYWLTYFPPLTETDCTSFGARIDWRRSFITTDLNPYYDQFIKWQMKKLKDLGKI 250

Query: 307 YRASRLVNWSVKLNTAISNLEVENKE-IAGKTLLSVPGYDEKVEFGVLTSFAYPVV---- 361
               R   +S K      + + ++ E +  +  L +     K+E       A  +V    
Sbjct: 251 KFGERYTIYSEKDGQPCMDHDRQSGEAVTPQEYLGI-----KIEVTEFAEEAKKIVAEST 305

Query: 362 -DSDEKL--IIATTRPETMFGDTAIAIHPD---------DPRY----------------- 392
            D  +K+  + AT RPETM+G T   + P          D  Y                 
Sbjct: 306 LDHSKKIYFVAATLRPETMYGQTCCFVSPTINYGIFDAGDCYYITTERAFKNMSYQKLTP 365

Query: 393 -------------KHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYN 439
                        KH  G  +  P  P     +   + V    GTG V   P +  +DY 
Sbjct: 366 ERGNYKPVVSVLGKHFVGSKIHAPLTPYPELRILPMDTVIATKGTGVVTCVPTNSPDDYM 425

Query: 440 T 440
           T
Sbjct: 426 T 426

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 109/284 (38%), Gaps = 77/284 (27%)

Query: 488 FVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEM--AKEAINAVKDGRITITP--KSS 543
           FV  +   +VI   SRSGD     L+ QW+V  GE    K+AI  + +G     P  K++
Sbjct: 525 FVYNEPESVVI---SRSGDECIVSLEDQWYVDYGEEEWKKQAIECL-EGMELFAPEVKNA 580

Query: 544 ASEYFHWLENIQDWCISRQLWWGHRC---PVYFVNIEGKEQSRNEGTYWVSGRNLEEAQK 600
                 WL N   W +SR    G R    P Y V      +S ++ T + S   +     
Sbjct: 581 FESVLDWLRN---WAVSRSYGLGTRLPWDPKYLV------ESLSDSTIYQSFYTIAHLLF 631

Query: 601 K------------AAEKFPNEV--YTLEQDEDVLDTWFSSGLWPFSTLGWPDKTPDMSTF 646
           K             AE+  +EV  Y  +  ++V +T       P  +L    +  +   F
Sbjct: 632 KDYYGNEIGPLGIKAEQMTDEVFDYVFQHVDEVKNTDI-----PLESLQKLRR--EFEYF 684

Query: 647 YPFSMLETGWDI----LYFWVARMILL--------GIKLTGNVPFNEVFCHSLVRDAQGR 694
           YP  +  +G D+    L F++   + L        GI++ G++  N              
Sbjct: 685 YPLDVSISGKDLIPNHLTFFIYTHVALFPRKFWPKGIRVNGHLMLNNA------------ 732

Query: 695 KMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAG 738
           KMSKS GN +             LH  ++K   D   +  A AG
Sbjct: 733 KMSKSTGNFM------------TLHDMVTKFGADASRIALADAG 764

>Scas_650.7
          Length = 1119

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 232
           P   GALH GH  T++  +  + + RM GK  LF  GF   G+   +  +K
Sbjct: 95  PYANGALHAGHCFTLSKVEFSVGFERMNGKRALFPLGFHCTGMPILACADK 145

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 54/144 (37%), Gaps = 20/144 (13%)

Query: 257 WKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR-----LHEEGVIYRASR 311
           W   +   I+      GA  DW R   T D   +    +AF+R     L   G I    R
Sbjct: 223 WLTFFPPLIEKDCTSFGARIDWRRSFVTTD---ANPYYDAFIRWQMNKLKAAGKIKFGER 279

Query: 312 LVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL---- 367
              +S K   A  + + ++ E  G T     G   K+E       A  ++D    +    
Sbjct: 280 YTVYSEKDGQACMDHDRQSGE--GVTPQEYVGI--KIEATEFAEEAQKIIDETAAIDKSK 335

Query: 368 ----IIATTRPETMFGDTAIAIHP 387
               + AT RPETM+G T   + P
Sbjct: 336 KIYFVAATLRPETMYGQTCCFVSP 359

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 12/111 (10%)

Query: 465 EWQGMKRFDARKRVIEKLQELG-LFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQGEM 523
           +++G K   A+ +    L + G  FV  +   +V+   SRSGD     L+ QW+V  GE 
Sbjct: 526 KYKGEKVEIAKNKCKADLIDAGEAFVYNEPESLVM---SRSGDECIVSLEDQWYVDYGEE 582

Query: 524 A--KEAINAVKDGRITITP--KSSASEYFHWLENIQDWCISRQLWWGHRCP 570
           +  K+A+  + +G     P  K++      WL+N   W + R    G R P
Sbjct: 583 SWKKQAVECL-EGMELFAPEVKNAFEGVLDWLKN---WAVCRTYGLGTRLP 629

>CAGL0J03652g 346614..349895 highly similar to sp|P26637
           Saccharomyces cerevisiae YPL160w CDC60 leucine-tRNA
           ligase, hypothetical start
          Length = 1093

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 232
           P + G LH GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 69  PYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 119

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 123/578 (21%), Positives = 193/578 (33%), Gaps = 164/578 (28%)

Query: 257 WKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR-----LHEEGVIYRASR 311
           W   +    +     LG+  DW R   T D        +AF+R     L   G I    R
Sbjct: 197 WLTYFPPLCQRDCSSLGSRIDWRRSYITTD---ENPYYDAFIRWQMNKLKALGKIKFGER 253

Query: 312 LVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYPVVDSDEKL---- 367
              +SVK      + + ++ E  G T     G   K+E       A  ++D ++K+    
Sbjct: 254 YTIYSVKDGQPCMDHDRQSGE--GVTPQEYVGI--KIEATEFAPEAKKLIDENDKIDKSK 309

Query: 368 ----IIATTRPETMFGDTAIAIHPD---------DPRY---------------------- 392
               + AT RPETM+G T   + P          D  Y                      
Sbjct: 310 KIYFVAATLRPETMYGQTCCFVSPKIDYGIFDAGDSYYITTERAFKNMSYQKLTPVRGEY 369

Query: 393 --------KHLHGKFVQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRH 444
                   K   G  +  P  P K   +   E V    GTG V   P +  +DY T K  
Sbjct: 370 SPVAVINGKAFIGTKIHAPLTPYKELRILPMETVIATKGTGVVTCVPTNSPDDYMTVKDL 429

Query: 445 --------------DLEIINILTDD--GLLNENCGPE----------------------- 465
                         D+E+I ++  D  G L      E                       
Sbjct: 430 IKKSEYYGIDPTWIDMELIPVIKTDKYGDLTAKALCEELKIQSPNDTTKLAEAKKIAYKE 489

Query: 466 -----------WQGMKRFDARKRVIEKLQELG-LFVSQQDNEMVIPTCSRSGDVIEPILK 513
                      ++G K   A+ +V   +   G  FV  +   +V+   SRSGD     L+
Sbjct: 490 DYYSGVMIYGDYKGEKVEIAKAKVKADMIAKGEAFVYNEPEGLVM---SRSGDECIVSLE 546

Query: 514 PQWWVSQGE-----MAKEAINAVKDGRITITPKSSAS--EYFHWLENIQDWCISRQLWWG 566
            QW++  GE      A+E ++ ++       P+ + +      WL N   W +SR    G
Sbjct: 547 DQWYLDYGEEEWRKQAEECLSQME----VFAPEVNHAFKGVLGWLRN---WAVSRTYGLG 599

Query: 567 HRCP---VYFVNIEGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTW 623
            + P    Y V     + +  +  Y V+    ++   K  E  P  +   +  +DV D  
Sbjct: 600 TKLPWDDKYLVE-SLSDSTIYQAFYTVAHLLFKDYYGK--EIGPLNIKPEQMTDDVFDYI 656

Query: 624 FS-----SGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDI----LYFWVARMILL----- 669
           F          P  +L    +  +   FYP  +  +G D+    L F++   + L     
Sbjct: 657 FQHVDDVKSDIPLRSLQILRR--EFEYFYPLDVSISGKDLIPNHLTFFIYTHVALFPKKF 714

Query: 670 ---GIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVV 704
              GI+  G++  N              KMSKS GN +
Sbjct: 715 WPKGIRANGHLMLNNA------------KMSKSTGNFM 740

>YPL160W (CDC60) [5287] chr16 (246989..250261) Leucyl-tRNA
           synthetase, cytoplasmic [3273 bp, 1090 aa]
          Length = 1090

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 182 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK 232
           P + G +H GH  T++  +  I + RM GK  LF  GF   G+   +  +K
Sbjct: 66  PYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADK 116

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 61/156 (39%), Gaps = 22/156 (14%)

Query: 247 REEFVK--KVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR----- 299
           REE +K      W   +    +S    LGA  DW R   T D   +    +AF+R     
Sbjct: 182 REEIIKFADAKYWLTYFPPLCESDCTSLGARIDWRRSFVTTD---ANPYYDAFIRWQMNK 238

Query: 300 LHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYDEKVEFGVLTSFAYP 359
           L   G I    R   +S K   A  + + ++ E  G T     G   K+E       A  
Sbjct: 239 LKAAGKIKFGERYTIYSEKDGQACMDHDRQSGE--GVTPQEYIGV--KIEALEFADDAAK 294

Query: 360 VVDSDEKL--------IIATTRPETMFGDTAIAIHP 387
           ++DS   L        + AT RPETM+G T   + P
Sbjct: 295 IIDSSSDLDKSKKFYFVAATLRPETMYGQTCCFVSP 330

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 119/310 (38%), Gaps = 79/310 (25%)

Query: 463 GPEWQGMKRFDARKRVIEKLQELG-LFVSQQDNEMVIPTCSRSGDVIEPILKPQWWVSQG 521
           GP ++G K   A+ +V   +   G  FV  +    V+   SRSGD     L+ QW+V  G
Sbjct: 496 GP-YKGEKVEQAKNKVKADMIAAGEAFVYNEPESQVM---SRSGDDCIVSLEDQWYVDYG 551

Query: 522 EMA--KEAINAVKDGRITITP--KSSASEYFHWLENIQDWCISRQLWWGHRCP---VYFV 574
           E +  K+AI  + +G     P  K++      WL+N   W + R    G R P    Y V
Sbjct: 552 EESWKKQAIECL-EGMQLFAPEVKNAFEGVLDWLKN---WAVCRTYGLGTRLPWDEKYLV 607

Query: 575 NIEGKEQSRNEGTYWVSGRNLEEAQKK------------AAEKFPNEV--YTLEQDEDVL 620
                 +S ++ T + S   +     K            +A++  +EV  Y  +  +DV 
Sbjct: 608 ------ESLSDSTIYQSFYTIAHLLFKDYYGNEIGPLGISADQMTDEVFDYIFQHQDDVK 661

Query: 621 DTWFSSGLWPFSTLGWPDKTPDMSTFYPFSMLETGWDI----LYFWVARMILL------- 669
           +T       P   L    +  +   FYP  +  +G D+    L F++   + L       
Sbjct: 662 NTNI-----PLPALQKLRR--EFEYFYPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWP 714

Query: 670 -GIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLYVITGSSLEELHATLSKGNLD 728
            GI+  G++  N              KMSKS GN +             L  T+ K   D
Sbjct: 715 KGIRANGHLMLN------------NSKMSKSTGNFMT------------LEQTVEKFGAD 750

Query: 729 PREVEKAKAG 738
              +  A AG
Sbjct: 751 AARIAFADAG 760

>Kwal_26.8831
          Length = 916

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 61/157 (38%), Gaps = 24/157 (15%)

Query: 247 REEFVKKV--WDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVR----- 299
           REE VK      W   +    +      G+  DW R   T D        +AF+R     
Sbjct: 8   REEVVKFADPQYWLTYFPPLCEENCTSFGSRIDWRRSFITTD---MNPYYDAFIRWQMNK 64

Query: 300 LHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPGYD-EKVEFGVLTSFAY 358
           L E G I    R   +S K   A  + + ++ E  G T     G   E +EF      A 
Sbjct: 65  LKELGKIKFGERYTIYSEKDGQACMDHDRQSGE--GVTPQEYVGIKIEAIEFA---EAAQ 119

Query: 359 PVVDSDEKL--------IIATTRPETMFGDTAIAIHP 387
            ++DS E L        + AT RPETM+G T   + P
Sbjct: 120 KIIDSTESLDKSKKFHFVAATLRPETMYGQTCCFVSP 156

>AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH]
           complement(113951..115654) [1704 bp, 567 aa]
          Length = 567

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 175 FCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQI 234
           F I  P        H+GH  +  I D   R+ +++   VLF  G D  G+  Q+  E+Q 
Sbjct: 15  FHITTPIFYPNAKPHLGHLYSSLICDVQARWQKLRDSEVLFTTGTDEHGLKIQTASEQQG 74

Query: 235 WANEK 239
           +A+ K
Sbjct: 75  YASPK 79

>Kwal_33.15315
          Length = 583

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 18/138 (13%)

Query: 172 EGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVE 231
           + +F I  P        H+GH  +  + D   R++ M     LF  G D  G+  Q+  E
Sbjct: 13  KALFHITTPIFYPNAKPHLGHLYSSLLCDVSRRWHEMLTHQTLFTTGTDEHGLKIQTASE 72

Query: 232 KQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSR 291
           K+ +   K+   D    EFVK                     A+ D++R   T D +   
Sbjct: 73  KRGFETPKQFV-DVLYREFVK-----------------LDQAANIDYTRFIRTTDADHIH 114

Query: 292 SVTEAFVRLHEEGVIYRA 309
           +V   + R  E+G IY+ 
Sbjct: 115 AVQNIWNRCWEKGYIYKG 132

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 40/90 (44%), Gaps = 31/90 (34%)

Query: 693 GRKMSKSLGNVVDPL-------------YVITGSSL--------EELHATLSK-----GN 726
           G KMSKS+GNVVDPL             Y++  S +        E LHATL +     GN
Sbjct: 345 GTKMSKSVGNVVDPLDMISYYGCDPVRWYLLENSHIEADGDFREERLHATLEQIVSKWGN 404

Query: 727 LDPREVEKAKAGQKESYPNGIPQCGTDALR 756
           L  R       G K S    I +  +D+L+
Sbjct: 405 LLNR-----CCGGKFSISRSIARFTSDSLK 429

>KLLA0F14971g complement(1386169..1387875) similar to sp|P22438
           Saccharomyces cerevisiae YGR171c MSM1 methionyl-tRNA
           synthetase singleton, hypothetical start
          Length = 568

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 55/132 (41%), Gaps = 29/132 (21%)

Query: 655 GWDILYF----WVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPL--- 707
           G DI+ F    W A ++   + L   V    V  H L   + G KMSKSLGNVVDP+   
Sbjct: 304 GKDIIKFHTVYWPAFLLAAKLPLPNRV---VVHGHWL---SGGVKMSKSLGNVVDPIQII 357

Query: 708 ----------YVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTDALRF 757
                     Y++  S++E     + K   + RE+  +K G      N I +CG      
Sbjct: 358 SYYGADTTRWYLLENSNIESDGNFIEKNLWETRELLCSKLG------NLINRCGGKKFSL 411

Query: 758 ALCAYTTGGRDI 769
           A       G+ I
Sbjct: 412 ASGVELFSGKPI 423

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 29/65 (44%)

Query: 175 FCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQI 234
           F I  P        H+GH  +  + D   R+ ++ G+   F  G D  G+  Q   +++ 
Sbjct: 12  FHITTPIFYPNAKPHLGHLYSSLLCDVQNRWKKLAGQDTCFTTGVDEHGLKIQLAAQQKG 71

Query: 235 WANEK 239
           ++N K
Sbjct: 72  YSNPK 76

>Scas_620.7
          Length = 576

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 18/123 (14%)

Query: 189 HIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWANEKKTRHDYGRE 248
           H+GH  +  + D   R+N++ G   L   G D  G+  Q+  EK  +++ K         
Sbjct: 36  HLGHLYSSLLCDVFHRWNKLNGTPSLLTTGTDEHGLKIQAASEKNGFSDPKL-------- 87

Query: 249 EFVKKVWDWKEVYHAKIKSQVQRLGASYDWSREAFTLDPELSRSVTEAFVRLHEEGVIYR 308
            FV K+  +KE         +       D++R   T DP+   +V   +    + G IY+
Sbjct: 88  -FVDKL--YKEFVSLDTVFNI-------DFTRFIRTTDPDHIENVKLLWELCEKNGFIYQ 137

Query: 309 ASR 311
            + 
Sbjct: 138 GTH 140

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 8/48 (16%)

Query: 661 FWVARMILLGIKLTGNVPF-NEVFCHSLVRDAQGRKMSKSLGNVVDPL 707
           +W + ++  G+ L   V   N   C+       G KMSKSLGNVVDP+
Sbjct: 315 YWPSFLMAAGLPLPKQVVVHNHWLCN-------GVKMSKSLGNVVDPI 355

>Sklu_2399.6 YGR171C, Contig c2399 15064-16788
          Length = 574

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 691 AQGRKMSKSLGNVVDPLYVITGSSLEELHATL---SKGNLDPREVEKAKAGQKE----SY 743
           + G KMSKSLGNVVDPL +I+    + +   L   S+   D   +E+   G +E     +
Sbjct: 345 SNGVKMSKSLGNVVDPLLMISYYGCDSMRWYLLENSRLETDCDFIEERLHGVRELLSSKW 404

Query: 744 PNGIPQCGTDALRFALCAYTTGGR 767
            N I +C       A    T   R
Sbjct: 405 GNLINRCCGPKFNLARGVSTFNNR 428

>CAGL0G02057g complement(181467..182291) similar to sp|P36025
           Saccharomyces cerevisiae YOR062c, hypothetical start
          Length = 274

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 64/152 (42%), Gaps = 20/152 (13%)

Query: 291 RSVTEAFVRLHEEGVIY--RASRLVNWSVKLNTAISNLEVENKEIAGKTLLSVPG--YDE 346
           + + E ++R+H+   +Y  ++S+  NW  + N        +++  +  TL  + G  +D+
Sbjct: 132 KQLLEDYIRIHDIAQMYAIKSSQQTNWQERFNRI-----HKSRANSSSTLPPMKGIKFDK 186

Query: 347 KV---EFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKFVQHP 403
            V   +  +   F    VD  +K    + RP        +       +  +L+      P
Sbjct: 187 LVLRRDIDIYGVFHESTVDIRDKGDATSLRPSHSVDGVYVV-----EQKHYLYDDRYLFP 241

Query: 404 FLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQ 435
           ++P + P+ CDA     +FGTG+       DQ
Sbjct: 242 YMPDEDPLECDAPK---DFGTGSFSTLEIDDQ 270

>Sklu_2208.4 YDR322W, Contig c2208 7462-8532
          Length = 356

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 782 FCNKIYQATKFALMRLGDDYVPPAEEQLSGNESLVEKWILHELSSTAKTVNEAFDKRDF 840
           + + I  A KF+   +  DY+PP  E+ +G +     W+  + +    ++  AFD++DF
Sbjct: 253 YNDNIVDARKFSEQNIVADYLPPVPEKNAGKQRFA-VWVFRQTNPYNNSI--AFDRQDF 308

>YOR195W (SLK19) [4991] chr15 (712866..715331) Protein involved with
           Kar3p in control of spindle dynamics, cleaved by Esp1p
           (separase) [2466 bp, 821 aa]
          Length = 821

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 235 WANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRL 272
            +N++K R D   +   K+V DWKE Y AK K   +RL
Sbjct: 710 LSNDQKDRDDEKIKSLGKQVQDWKEKYEAKEKDTNKRL 747

>YGR171C (MSM1) [2124] chr7 complement(840827..842554)
           Methionyl-tRNA synthetase, mitochondrial, member of
           class I family of aminoacyl-tRNA synthetases [1728 bp,
           575 aa]
          Length = 575

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 661 FWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPL 707
           +W + ++  G+ L   +    V  H L     G KMSKSLGNVVDP+
Sbjct: 313 YWPSFLLAAGLPLPRQIV---VHGHWL---CNGMKMSKSLGNVVDPI 353

>YGR136W (LSB1) [2093] chr7 (762431..763156) Protein with weak
           similarity to chicken growth factor receptor-binding
           protein, has an SH3 domain [726 bp, 241 aa]
          Length = 241

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 11/82 (13%)

Query: 443 RHDLEII---NILTDD--GLLNENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMV 497
           R++LE +   N+++ D   L+N     +W G +R        E ++ L  F +QQD ++ 
Sbjct: 14  RNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLS 73

Query: 498 IPTCSRSGDVIEPI--LKPQWW 517
           +    ++GD I+ +  + P W+
Sbjct: 74  L----KTGDKIQVLEKISPDWY 91

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,633,133
Number of extensions: 1525054
Number of successful extensions: 4732
Number of sequences better than 10.0: 58
Number of HSP's gapped: 4764
Number of HSP's successfully gapped: 101
Length of query: 1078
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 966
Effective length of database: 12,718,893
Effective search space: 12286450638
Effective search space used: 12286450638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)