Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL186W31931314770.0
Kwal_27.103143152634118e-48
YMR274C (RCE1)3152613865e-44
Scas_696.373222893865e-44
CAGL0F03443g3123013664e-41
KLLA0D01705g3212843491e-38
KLLA0D19228g70757740.34
Kwal_0.5746957653.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL186W
         (313 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH] complement(810...   573   0.0  
Kwal_27.10314                                                         162   8e-48
YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease ...   153   5e-44
Scas_696.37                                                           153   5e-44
CAGL0F03443g complement(339175..340113) similar to sp|Q03530 Sac...   145   4e-41
KLLA0D01705g complement(152307..153272) similar to sp|Q03530 Sac...   139   1e-38
KLLA0D19228g complement(1615062..1617185) some similarities with...    33   0.34 
Kwal_0.57                                                              30   3.6  

>AAL186W [1] [Homologous to ScYMR274C (RCE1) - SH]
           complement(8108..9067) [960 bp, 319 aa]
          Length = 319

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/313 (91%), Positives = 286/313 (91%)

Query: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60
           MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP
Sbjct: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60

Query: 61  WLQSRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGXXXXXXXX 120
           WLQSRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILG        
Sbjct: 61  WLQSRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGSLYAADLL 120

Query: 121 XXXXXXXXVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQPTISRA 180
                   VPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQPTISRA
Sbjct: 121 DSAAYYLLVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQPTISRA 180

Query: 181 MLLLATPMFFGVAHVHHARQLLATGHRPAQVALTSSFQILYTTLFGTFTNYIYYHTAGNL 240
           MLLLATPMFFGVAHVHHARQLLATGHRPAQVALTSSFQILYTTLFGTFTNYIYYHTAGNL
Sbjct: 181 MLLLATPMFFGVAHVHHARQLLATGHRPAQVALTSSFQILYTTLFGTFTNYIYYHTAGNL 240

Query: 241 WACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYRXXXXXXXXX 300
           WACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYR         
Sbjct: 241 WACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTYRLCLLCGLLA 300

Query: 301 XXDGIRTFSSSAG 313
             DGIRTFSSSAG
Sbjct: 301 FLDGIRTFSSSAG 313

>Kwal_27.10314
          Length = 315

 Score =  162 bits (411), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 144/263 (54%), Gaps = 8/263 (3%)

Query: 4   SSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIPWLQ 63
           S+  L+S Y + SYVAA++++        A R+DP+ I   M+ VG     NLL++PWLQ
Sbjct: 3   SAPFLISLYVSISYVAAIHMWSQPIGQFQARRDDPRVIKSRMRRVGLITSINLLLVPWLQ 62

Query: 64  SRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGXXXXXXXXXXX 123
           S  ++   +F+D F  LG++P  Y      ++D   +  DI+RAL ++            
Sbjct: 63  STFSAREITFMDAFLALGIIPAGYKS-DTFYFDVSNFVYDIVRALKLVCILYSGPLLDNV 121

Query: 124 XXXXXVPD---TSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLL--QPTIS 178
                VPD   T    DL   L    GLRNYVFGP TEEL YT M++ N+ L    P   
Sbjct: 122 LYYLLVPDVAVTEAFQDLKAELCSIWGLRNYVFGPATEELFYTCMLVNNFLLTSTDPVTY 181

Query: 179 RAMLLLATPMFFGVAHVHHARQLLATG-HRPAQVALTSSFQILYTTLFGTFTNYIYYHTA 237
           +A+LLL    F G+AH+HHA ++   G +   Q+A+T+  Q+ YTTLFG FTN++Y  T 
Sbjct: 182 KAILLLPPLFF-GLAHLHHAWEMSTVGIYSNVQIAITTLIQMTYTTLFGVFTNFVYLRTG 240

Query: 238 GNLWACILLHAVCNYLSFPSLSS 260
            N W C  +HA  NY+  P +S+
Sbjct: 241 QNFWCCFAIHAFANYMGLPKMSA 263

>YMR274C (RCE1) [4228] chr13 complement(814363..815310) Protease
           involved in ras and a-factor C-terminal proteolysis [948
           bp, 315 aa]
          Length = 315

 Score =  153 bits (386), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 134/261 (51%), Gaps = 9/261 (3%)

Query: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60
           M   S  L+  Y + SYV  LY          + R++P+ I   M+ +   +++NL ++P
Sbjct: 1   MLQFSTFLVLLYISISYVLPLYATSQPE---GSKRDNPRTIKSRMQKLTIMLISNLFLVP 57

Query: 61  WLQSRLAS--DGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGXXXXXX 118
           +LQS+L+S     SF D F  LG++PG YA      W    +  D+ + +++L       
Sbjct: 58  FLQSQLSSTTSHISFKDAFLGLGIIPGYYAALPN-PWQFSQFVKDLTKCVAMLLTLYCGP 116

Query: 119 XXXXXXXXXXVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQP--T 176
                      P +S + D           RN++F PITEE+ YTSM+L  Y  L P   
Sbjct: 117 VLDFVLYHLLNPKSSILEDFYHEFLNIWSFRNFIFAPITEEIFYTSMLLTTYLNLIPHSQ 176

Query: 177 ISRAMLLLATPMFFGVAHVHHARQLLATGHRP-AQVALTSSFQILYTTLFGTFTNYIYYH 235
           +S   L     +FFG+AH HHA + L  G      + LT+ FQILYTTLFG  T +++  
Sbjct: 177 LSYQQLFWQPSLFFGLAHAHHAYEQLQEGSMTTVSILLTTCFQILYTTLFGGLTKFVFVR 236

Query: 236 TAGNLWACILLHAVCNYLSFP 256
           T GNLW CI+LHA+CN + FP
Sbjct: 237 TGGNLWCCIILHALCNIMGFP 257

>Scas_696.37
          Length = 322

 Score =  153 bits (386), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 143/289 (49%), Gaps = 16/289 (5%)

Query: 12  YAATSYVAALYVF-PGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIPWLQS-----R 65
           Y + SYVA +Y      R Y    R+DP  I   ++ V      N++++P+LQ      R
Sbjct: 12  YISISYVAVIYASSKDARQYPVLGRDDPAVIKRRIRKVLMLTAFNIVLVPFLQCLIKNLR 71

Query: 66  LASDG-FSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGXXXXXXXXXXXX 124
            ++D   S +     LG+VPG   H+R  HWD  +Y  DI+  + ++             
Sbjct: 72  DSTDSSISVIGAIMNLGIVPG---HYRDGHWDISSYYYDIISGIWVVTLLYVGPLMDLFL 128

Query: 125 XXXXVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQP--TISRAML 182
                   +  VD  D  S    LRNY+F PITEE+ YTSM+L  Y +L P  ++S   L
Sbjct: 129 FYVFTKGKTLYVDYKDEFSNIYCLRNYIFAPITEEIFYTSMLLNTYLMLCPIESLSLKTL 188

Query: 183 LLATPMFFGVAHVHHARQLLATGHRP-AQVALTSSFQILYTTLFGTFTNYIYYHTAGNLW 241
           L    +FFG+AH+HHA     TG +    + + +  Q  YTTLFG FTN+I+  T GNLW
Sbjct: 189 LWQPSLFFGLAHIHHAYGSFRTGDQNLITILMNTIIQFGYTTLFGAFTNFIFLRTGGNLW 248

Query: 242 ACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMRLLHAWGYTY 290
           AC+  H+ CN + FP  S          +   ++  W+ +L+ AW  +Y
Sbjct: 249 ACMFAHSFCNIMGFPGRSR---LSLHFTMIEEVKGDWRRKLIAAWNKSY 294

>CAGL0F03443g complement(339175..340113) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of
           RAS2P, hypothetical start
          Length = 312

 Score =  145 bits (366), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 147/301 (48%), Gaps = 13/301 (4%)

Query: 14  ATSYVAALYVFPGRRIYGH-ASRNDPKAIWYGMKAVGCGVLANLLIIPWLQSRLASDGFS 72
           + SYVA LY+   + I  + A R+DP+ I   +K V    + N  I+P L S +     S
Sbjct: 13  SLSYVAVLYI-TSKGIENYPARRDDPRVIKRRLKNVLMVSILNTAIVPLLHSIIVPQ-LS 70

Query: 73  FVDCFFRLGLVPGAYAHFRGLHWDTLAYATDILRALSILGXXXXXXXXXXXXXXXXVPDT 132
           + + F  +G++PG + H          Y   IL+ L ++                   ++
Sbjct: 71  YKEAFLNIGIIPGYHQHGSS---QIKLYIGTILKNLCLVMLLYIGPLTDMVLYYISNKES 127

Query: 133 SPVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLLQPTISRAMLLLATP-MFFG 191
           S +    +      GLRNY+F PITEEL YTS++L  Y  L+P   +   LL  P +FF 
Sbjct: 128 SILSAFREEFMNIWGLRNYIFAPITEELFYTSLLLNTYLTLEPRKPKLTTLLWQPSLFFS 187

Query: 192 VAHVHHARQLLATGH-RPAQVALTSSFQILYTTLFGTFTNYIYYHTAGNLWACILLHAVC 250
           +AH+HHA +    G+     + + + FQ+ YT +FG FTN+++  T GNLW+CILLH+ C
Sbjct: 188 IAHIHHAYEATLVGNFSTTSIIINTLFQMAYTGIFGAFTNFVFLRTGGNLWSCILLHSFC 247

Query: 251 NYLSFPSLSSDVFADYCA-KVPPALRALWKMRLLHAWGYTYRXXXXXXXXXXXDGIRTFS 309
           N + FPS  S+++  +   K P +L+      LL  W   Y            DG+   +
Sbjct: 248 NVMGFPS-GSELYEYFTVIKTPKSLKL---QHLLSIWNKVYYILLFMGILFFKDGLWRLT 303

Query: 310 S 310
           S
Sbjct: 304 S 304

>KLLA0D01705g complement(152307..153272) similar to sp|Q03530
           Saccharomyces cerevisiae YMR274c RCE1 modulator of RAS2P
           singleton, start by similarity
          Length = 321

 Score =  139 bits (349), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 136/284 (47%), Gaps = 12/284 (4%)

Query: 1   MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGMKAVGCGVLANLLIIP 60
           MF   A +++ Y + SYV A++            R+DPK I   MKAV      +L  IP
Sbjct: 1   MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKARMKAVIALSAFHLTTIP 60

Query: 61  WLQSRLASDGFSFVDCFFRLGLVPGAYAHFR-GL-HWDTLAYATDILRALSILGXXXXXX 118
            L   +  D  S  +   R GL+PG       GL  W    Y  D  R LS+        
Sbjct: 61  LLLKYMNGD--SIQNTLLRFGLLPGFLNETETGLPSWVPFNYFKDSSRHLSLAIVLYSTP 118

Query: 119 XXXXXXXXXXVPDTS---PVVDLVDRLSCTTGLRNYVFGPITEELVYTSMVLQNYRLL-- 173
                     +PD S    + D+    S   GLR+Y+FGPITEEL YTSM+L  Y  L  
Sbjct: 119 LLDSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPITEELFYTSMMLVAYLRLGD 178

Query: 174 QPTISRAMLLLATPMFFGVAHVHHARQLLATG-HRPAQVALTSSFQILYTTLFGTFTNYI 232
                   L L  P  FG+AHVHHA +  + G    A +   +  Q+ YT LFG+FTNY+
Sbjct: 179 SSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANIIFITLLQMSYTWLFGSFTNYL 238

Query: 233 YYHTAGNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRA 276
           + +++GNLW+CIL+H  CNY+  P    + F+   A VP   R+
Sbjct: 239 FLNSSGNLWSCILIHTFCNYMGLP--QGNTFSKAYALVPIEKRS 280

>KLLA0D19228g complement(1615062..1617185) some similarities with
           sgd|S0002392 Saccharomyces cerevisiae YDL233w
           hypothetical protein, hypothetical start
          Length = 707

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 45  MKAVGCGVLANLLIIP-WLQSRLASDGFSFVDC-------FFRLGLVPGAYAHFRGL 93
           M+A GC  +A L I+P  L++++ S+G  F +C       FF  G     + HF+G+
Sbjct: 421 MRAFGCSGVAKLEIVPHQLRAQVLSNGSIFFECPRCLLTYFFPDGSYMTNFTHFKGV 477

>Kwal_0.57
          Length = 469

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 34  SRNDPKAIWYGMKAVGCGVLANLLIIPWLQSRLASDGFSFVDCFFRLGLVPGAYAHF 90
           +RNDP +I Y +   G     NLL +P     L +   S V+C  R  L P  +  F
Sbjct: 296 ARNDPSSIIYKIVG-GYASHNNLLYVPQFPLSLLTPPKSLVECITRQPLTPVVFTAF 351

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,667,579
Number of extensions: 312647
Number of successful extensions: 757
Number of sequences better than 10.0: 8
Number of HSP's gapped: 752
Number of HSP's successfully gapped: 8
Length of query: 313
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 212
Effective length of database: 13,099,691
Effective search space: 2777134492
Effective search space used: 2777134492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)