Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL185W1018100048490.0
YML109W (ZDS2)9424375409e-57
Kwal_27.103189254335354e-56
KLLA0D01683g9443965302e-55
Scas_650.229936325107e-53
YMR273C (ZDS1)9151004536e-46
CAGL0F03421g8174394302e-43
CAGL0J06688g828984222e-42
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL185W
         (1000 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...  1872   0.0  
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   212   9e-57
Kwal_27.10318                                                         210   4e-56
KLLA0D01683g complement(148855..151689) some similarities with s...   208   2e-55
Scas_650.22                                                           201   7e-53
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   179   6e-46
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   170   2e-43
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   167   2e-42

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1) -
            SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score = 1872 bits (4849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 929/1000 (92%), Positives = 929/1000 (92%)

Query: 1    MKADYTARASKTRGGQKVGGVRRESAGQGMSMSEDEFQAAQVRQRRSKSCAGPLEGVQER 60
            MKADYTARASKTRGGQKVGGVRRESAGQGMSMSEDEFQAAQVRQRRSKSCAGPLEGVQER
Sbjct: 1    MKADYTARASKTRGGQKVGGVRRESAGQGMSMSEDEFQAAQVRQRRSKSCAGPLEGVQER 60

Query: 61   VLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVS 120
            VLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVS
Sbjct: 61   VLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVS 120

Query: 121  PSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSV 180
            PSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSV
Sbjct: 121  PSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSV 180

Query: 181  VPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQH 240
            VPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQH
Sbjct: 181  VPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQH 240

Query: 241  PNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLR 300
            PNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLR
Sbjct: 241  PNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLR 300

Query: 301  KSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLART 360
            KSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLART
Sbjct: 301  KSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLART 360

Query: 361  LGIGSQSADEHATFSECVPXXXXXXXXXXXXILAKNGLAIPARSSLRRSKFTTYRIRSAG 420
            LGIGSQSADEHATFSECVP            ILAKNGLAIPARSSLRRSKFTTYRIRSAG
Sbjct: 361  LGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIPARSSLRRSKFTTYRIRSAG 420

Query: 421  XXXXXXXXXXXXXXXLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQSPNSINDIY 480
                           LAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQSPNSINDIY
Sbjct: 421  SDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQSPNSINDIY 480

Query: 481  DHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASGEHCARNAHKISPIXXXXXXXXXX 540
            DHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASGEHCARNAHKISPI          
Sbjct: 481  DHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASGEHCARNAHKISPISVSQLSATSS 540

Query: 541  XXXXXXXXXXXXXXXXXXFDQKSPLRSITLNSSTKGHKISAEKKKGWSWFGNSRRPSSES 600
                              FDQKSPLRSITLNSSTKGHKISAEKKKGWSWFGNSRRPSSES
Sbjct: 541  SSTSPGSSKSAESTKSWTFDQKSPLRSITLNSSTKGHKISAEKKKGWSWFGNSRRPSSES 600

Query: 601  VLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPRRGNHSRNRHQTSSPEELEIGW 660
            VLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPRRGNHSRNRHQTSSPEELEIGW
Sbjct: 601  VLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPRRGNHSRNRHQTSSPEELEIGW 660

Query: 661  TETSLTTLDGDTEQDGKPQHPXXXXXXXXXXXXXXXXRSGTGLSQDTPNQGEESSLKATS 720
            TETSLTTLDGDTEQDGKPQHP                RSGTGLSQDTPNQGEESSLKATS
Sbjct: 661  TETSLTTLDGDTEQDGKPQHPKTKEKLEKKFMKIFKKRSGTGLSQDTPNQGEESSLKATS 720

Query: 721  RIRRSRESKRQTDEPSASLTTSVSLNNHNNGRKSVSISRPTWQRTESSYNGDKGKGSITS 780
            RIRRSRESKRQTDEPSASLTTSVSLNNHNNGRKSVSISRPTWQRTESSYNGDKGKGSITS
Sbjct: 721  RIRRSRESKRQTDEPSASLTTSVSLNNHNNGRKSVSISRPTWQRTESSYNGDKGKGSITS 780

Query: 781  LQPAVSVTSSRDSHEQTRQDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTSHSRS 840
            LQPAVSVTSSRDSHEQTRQDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTSHSRS
Sbjct: 781  LQPAVSVTSSRDSHEQTRQDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTSHSRS 840

Query: 841  KLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHSLPPRK 900
            KLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHSLPPRK
Sbjct: 841  KLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHSLPPRK 900

Query: 901  LRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLKLSD 960
            LRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLKLSD
Sbjct: 901  LRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLKLSD 960

Query: 961  PKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDKNQGIQ 1000
            PKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDKNQGIQ
Sbjct: 961  PKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDKNQGIQ 1000

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  212 bits (540), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 163/437 (37%), Positives = 225/437 (51%), Gaps = 36/437 (8%)

Query: 67  RQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPR 126
           ++  EKRKS+VLIAA+SLD E+QNVKNLKR+SIGSMDL++DPE+EF++N      S S +
Sbjct: 42  KELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSK 101

Query: 127 NSLTEESLEWFQLSAEQ--EQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSE 184
            SL E   E   + +EQ  EQG E     E  DA ++   S D  + E L    ++   +
Sbjct: 102 ESLQESLHEENIIRSEQKEEQGSEDNDAYEEGDA-TNVDDSIDITQTEYLHDEETLEKEK 160

Query: 185 EL--SCSHPLSPPAAAKKSTLMSSRSKLGRQHT-DTTHTKQATGEPFSSNLLWVRADQHP 241
            +  + S   S      ++  +S    L      D  +   +     + NLLWV ADQHP
Sbjct: 161 IIRNASSSTSSSARVTSRNRRLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHP 220

Query: 242 NVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLRK 301
           NVKPENYLEL+ DTL N++I       ++ ++  N  V +    T    S+VR+ SRL+ 
Sbjct: 221 NVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVISNRKRTG---SVVRRPSRLKT 277

Query: 302 SFTEVEAIEESQFTDS-IGSEIPVGKR--------MRVSSLKEITEELTRISNNAGLTDS 352
           S+T+ +  +E    D     EI V KR        +R  SLKEITEELT+ISNNAGLTDS
Sbjct: 278 SYTKFD--DEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDS 335

Query: 353 DAITLARTLGIGSQSADEHATFSECVPXXXXXXXXXXXXILAKNGLAIPARSSLRRSKFT 412
           DA+TLAR+L +     +E    +                +  + GL IP RSSLRRSKF 
Sbjct: 336 DAVTLARSLSMSGSFTNESLHLN---GNHTENDNEFASNMFNETGLTIPERSSLRRSKFN 392

Query: 413 TYRIRSAGXXXXXXXXXXXXXXXLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQS 472
           TY+IR  G                     R++ SP         S+ ++  E  SL    
Sbjct: 393 TYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSP--------ASYTQVPQEQASL---- 440

Query: 473 PNSINDIYDHYNTSDTD 489
            N  ++I+DHY  + TD
Sbjct: 441 -NDFHEIFDHYRRTSTD 456

 Score =  175 bits (444), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (90%)

Query: 895 SLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLS 954
           +LPPRKL F+DV++P+  N+P+KFT SAFGFPLP +T STVIMFDHRL I VERAIYRLS
Sbjct: 816 TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLS 875

Query: 955 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991
           HLKLSDP RELRQQVLLSNFMYSYLNLVNH+LY++Q+
Sbjct: 876 HLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912

>Kwal_27.10318
          Length = 925

 Score =  210 bits (535), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 167/433 (38%), Positives = 223/433 (51%), Gaps = 53/433 (12%)

Query: 71  EKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSLT 130
           EKRKSEVLIAAQSLD ELQ+VKNLKR+S GSMDL +DPEMEFRM+ +    S+S      
Sbjct: 31  EKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSSSSDAVSL 90

Query: 131 EESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEELSCSH 190
           E   E  + + + +    L    +SI+   +A    +  RD  L   SSV  SE+     
Sbjct: 91  ESQAE--EPNQDDDSDDNLSYLNDSIEL--TAHEYLEEPRD-FLVERSSVSKSEDSHNGR 145

Query: 191 PLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEPFSSNLLWVRADQHPNVKPENYLE 250
            LS     ++  +     +L     D            + NL WV A+QHPNVKPENYLE
Sbjct: 146 NLS---GVRRGGMSKKPRELSNGGDDNV----------TQNLFWVPANQHPNVKPENYLE 192

Query: 251 LVHDTLNNLRIGA-------RHGRGDSP-VQQSNTPVANGESSTASARSLVRKQSRLRKS 302
           LV DTL+ L I +       +   G++P +  +NT  +      +   SLVR+ S LRKS
Sbjct: 193 LVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKS 252

Query: 303 FTEVEAIEESQFTDS------IGSEIP--VGKRMRV----SSLKEITEELTRISNNAGLT 350
           +TE+E + + +  DS        SE+   +  R R     SSLK+ITEELTRISN AG T
Sbjct: 253 YTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISNKAGFT 312

Query: 351 DSDAITLARTLGIGSQSADEHATFSECVPXXXXXXXXXXXXILAKNGLAIPARSSLRRSK 410
           D DA+ LARTL + S    E +  ++               IL KNGLAIPARSSLRRSK
Sbjct: 313 DGDAVCLARTLSMASSYDGEQSQANQSANTDHTPDSEYASTILTKNGLAIPARSSLRRSK 372

Query: 411 FTTYRIRSAGXXXXXXXXXXXXXXXLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAP 470
           F TYRIR+                   ++  R++  P  ++   +G    +   +   +P
Sbjct: 373 FNTYRIRTPNGSSV------------TSSSLRSTSLPNEERKDPEG---YIEKSDRLRSP 417

Query: 471 QSPNSINDIYDHY 483
            S N  N+IYDHY
Sbjct: 418 TSVNDFNEIYDHY 430

 Score =  195 bits (495), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 101/125 (80%), Gaps = 8/125 (6%)

Query: 883 GKSALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRL 942
           G   + P    ++LPPRKL F DV++PE+PNSPMKF+ S+FGFPLPPLT+STV+M DHRL
Sbjct: 798 GIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRL 857

Query: 943 PIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK------- 995
            I VERAIYRLSHLKL DPKRELRQQV+LSNFMY+YLNLVNHSLYLQQ+EED        
Sbjct: 858 TINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDNPADSASN 917

Query: 996 -NQGI 999
            NQG+
Sbjct: 918 DNQGV 922

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  208 bits (530), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/396 (38%), Positives = 212/396 (53%), Gaps = 66/396 (16%)

Query: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRN-- 127
           ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLLMDPE+E+R++    + +A+ ++  
Sbjct: 6   RDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRQGTGTATDQDTG 65

Query: 128 -------SLTEESLEWFQLSAEQEQGGE------LPLHAESIDAHSSAGGSSDTARDELL 174
                  S+  E+ +  Q   EQE G +      L   + S D  ++AG + +   D   
Sbjct: 66  TPYIATSSIKTETTKSEQ--GEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDD--- 120

Query: 175 TSASSVVPSEELSCSHPLSPPAAAK------------KSTLMSSRSKLGRQHTDTT---H 219
            S S    S +++ +  L   A A             +  ++S         T +T   +
Sbjct: 121 -SYSFTDDSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVLSGSISRSISGTSSTSDGN 179

Query: 220 TKQATGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPV 279
            +    E    NLLWVRADQHPNVKPENYLELV +TL N+ +G R    +    QS + +
Sbjct: 180 DESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGL 239

Query: 280 AN-GESSTASARSLVRKQSRLRKSFTEV-EAIEESQFTDS-IGSEIPVGKRMRVSSLKEI 336
               + S  S  SL R+ SRLR S+TE+ E  E+   TD  + +  P     R  SLK+I
Sbjct: 240 KTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDI 299

Query: 337 TEELTRISNNAGLTDSDAITLARTLGIGSQS-------------ADEHATFSECVPXXXX 383
           TEELT++SN AGLTD+DA+TLARTL +  +S             ADE   F+        
Sbjct: 300 TEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLSNNLADEEEEFAST------ 353

Query: 384 XXXXXXXXILAKNGLAIPARSSLRRSKFTTYRIRSA 419
                   +  K+G  +PAR SLRRSKF TYRI+S+
Sbjct: 354 --------MFTKSGFTVPARHSLRRSKFNTYRIQSS 381

 Score =  204 bits (518), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (90%)

Query: 886 ALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIY 945
           A G  E  + LPPRKL F DVL+P++PNSPMKFT SAFGFPLPPLT+STVIMFDHRLPI+
Sbjct: 814 AQGTLENQYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIH 873

Query: 946 VERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEED 994
           VERAIYRLSHLKLSDPKR LRQQVLLSNFMY+YLNLVNHSLYLQQIEE+
Sbjct: 874 VERAIYRLSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

>Scas_650.22
          Length = 993

 Score =  201 bits (510), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 198/632 (31%), Positives = 278/632 (43%), Gaps = 135/632 (21%)

Query: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSL 129
           ++KRKSEVLIAAQSLD E+Q+VKNLKR+SIGSMDLL+DPE+EFR+N    S  ++P  S 
Sbjct: 21  RDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDK-SNQSTPIGS- 78

Query: 130 TEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSAS------SVVPS 183
                  ++ S E  +    P   E+ ++  S   S +  + E L  AS      +V P 
Sbjct: 79  -------YERSNENLEQINEPEDNENDESSVSIDDSIELTQTEYLHDASVPQTNRTVTPE 131

Query: 184 EELSCSH-PLSPPAAAKKSTLMSSRSKL----------------------GRQHTDTTHT 220
           E    SH  +S   + K++    S+ KL                          + ++++
Sbjct: 132 E---PSHRSMSGAGSLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTSTSSSSSSSSNS 188

Query: 221 KQATGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRI-----GARHGRGDSPVQQS 275
             ++ +  + NLLWV A+QHPNVKPENYLELV DTL N+ +       +H    S   + 
Sbjct: 189 ASSSPDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKE 248

Query: 276 NTPVANGESS-------------------TASARSLVRKQSRLRKSFTEVE--------- 307
           N  ++    S                   T   RSLVR+ SRLR S+TE E         
Sbjct: 249 NIDISKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEE 308

Query: 308 ---AIEESQ----------FTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDA 354
                 ESQ          F D  G         R  SLK+ITEELT ISN AGLTDSDA
Sbjct: 309 SEAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDA 368

Query: 355 ITLARTLGIGSQSADEHATFSEC-VPXXXXXXXXXXXXILAKNGLAIPARSSLRRSKFTT 413
           ITLARTL + S  +D +    +  +             +  KNGL IP RSSLRRSKF T
Sbjct: 369 ITLARTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNT 428

Query: 414 YRIRSAGXXXXXXXXXXXXXXXLAAAYERNSRSPKMQKAAF----------KGSHPRLSG 463
           YRIRS                  ++   R   SP +Q ++F          + S    + 
Sbjct: 429 YRIRSTS----------------SSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTN 472

Query: 464 ENTSLA--PQSPNSINDIYDHYN----TSDTDDGSPELQGSPVTHTSDASFTSSPNIASG 517
            ++ LA    SP SI+D+YDHY     +   +D   E +   ++H   AS +   +  S 
Sbjct: 473 RDSYLATTTSSPGSISDLYDHYQDNAESKQGNDNDNEARQGDLSH---ASISQESSFLSN 529

Query: 518 EHCARNAHKISPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDQKSPLRSITLNSSTKGH 577
           E  + ++  + P+                             DQ +  +   LN +    
Sbjct: 530 E-SSNDSILVKPLGSKSMIHENLDNGQDHDD-----------DQPAYQKVSKLNPTIPDT 577

Query: 578 KISAEKKKGWSWFGNSRRPSSESVLLPGTDSE 609
             S  K+ GWSW GN      ++ +L  +  E
Sbjct: 578 SRSKHKRNGWSWSGNRANSEEDATVLVNSQDE 609

 Score =  181 bits (458), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/233 (44%), Positives = 132/233 (56%), Gaps = 63/233 (27%)

Query: 772 DKGKGSITSLQPAVSVTSSRDSH-------------EQTRQDPQPQSLVTKMDGSSSNGV 818
           D+   ++ SLQPAVSVTS+++ H             E   QD     L T++D S     
Sbjct: 763 DEAIEALPSLQPAVSVTSTKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNS----- 817

Query: 819 TVSSQRAGFSKKGRSKTSHSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHP 878
            + ++R                 +  S D+  ++N   D++  +T               
Sbjct: 818 -MLAER----------------NVMNSSDLQSIENSSDDINTGNT--------------- 845

Query: 879 SLDPGKSALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMF 938
                        I H LP RKL F DV RP++PN+P++FT SAFGFPLP LTVSTVIMF
Sbjct: 846 -------------IEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMF 892

Query: 939 DHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991
           DHRL I VERAIYRLSHLKLSD KRELRQQVLLSNFMY+YLNLVNH+LY++Q+
Sbjct: 893 DHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQV 945

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  179 bits (453), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%)

Query: 896 LPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSH 955
           LPPRKL F DV +P+KPNSP++FT SAFGFPLP LTVSTVIMFDHRLPI VERAIYRLSH
Sbjct: 806 LPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSH 865

Query: 956 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK 995
           LKLS+ KR LR+QVLLSNFMY+YLNLVNH+LY++Q+  DK
Sbjct: 866 LKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHDK 905

 Score =  169 bits (428), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 150/465 (32%), Positives = 207/465 (44%), Gaps = 91/465 (19%)

Query: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPRNSL 129
           ++KRKSEVLIAAQSLD E+++VKNLKR+SIGSMDLL+DPE++ +  G             
Sbjct: 23  RDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGG------------- 69

Query: 130 TEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEELSCS 189
                                   ES    S +G +S +A    + S ++ V +   S  
Sbjct: 70  ------------------------ESSGRRSWSGTTSSSAS---MPSDTTTVNNTRYSDP 102

Query: 190 HPLSPPAAAKKSTLMSSR-----SKLGRQHTDTTHTKQATGEPFSSNLLWVRADQHPNVK 244
            PL        S + SS      + LG +    + +++        NLLWV A+QHPNVK
Sbjct: 103 TPLENLHGRGNSGIESSNKTKQGNYLGIKKGVHSPSRKLNANVLKKNLLWVPANQHPNVK 162

Query: 245 PENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASAR-------------- 290
           P+N+LELV DTL N+++       D    ++N    NGE   + +               
Sbjct: 163 PDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGL 222

Query: 291 ------SLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLKE-------IT 337
                 SL+R+ S LR+S+TE +  E+        SE       R+S +KE       IT
Sbjct: 223 SRHGNASLIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERISKIKERPVSLRDIT 282

Query: 338 EELTRISNNAGLTDSDAITLARTLGI-GSQS-----------ADEHATFSECVPXXXXXX 385
           EELT+ISN+AGLTD+DAITLARTL + GS S            DE               
Sbjct: 283 EELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDD 342

Query: 386 XXXXXXILAKNGLAIPARSSLRRSKFTTYRIRSAGXXXXXXXXXXXXXXXLAAAYERNSR 445
                 +   N +  P RSSLRRS+F TYRIRS                      +    
Sbjct: 343 GEFASNMPINNTMTWPERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKN 402

Query: 446 SPKMQ----KAAFKGSHPRLSGENTSLAPQSPNSINDIYDHYNTS 486
           + K++    K+ F+        EN S +P S     DIY+HY  S
Sbjct: 403 TIKVEIDPHKSPFRQQDE--DSENMS-SPGSIGDFQDIYNHYRQS 444

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 147/439 (33%), Positives = 211/439 (48%), Gaps = 87/439 (19%)

Query: 75  SEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEF--RMNGAAVSPSASPRNSLTEE 132
           SEV IAAQSLD EL++VKNLKR+SIGSMDLLMDPEM+     NG         RNS    
Sbjct: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDMLPYNNGY--------RNS---- 53

Query: 133 SLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELL-------TSASSVVPSEE 185
              W   S + EQG + PL  +S         +S   R E L         +       E
Sbjct: 54  ---W---STQLEQGDK-PL--KSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQVE 104

Query: 186 LSCSHPLSPPAAAKKSTL-MSSRSKLGRQHTDTTHTKQATG------EPFSSNLLWVRAD 238
            +   P SP +  ++  +  SSR  + R    + H+K ++       +  + NLLWVRAD
Sbjct: 105 NTKKQPGSPKSLTRRGAVNFSSRRPVDR----SNHSKNSSKINDTLPDEVAQNLLWVRAD 160

Query: 239 QHPNVKPENYLELVHDTLNNLRIGA--RHGRGDSPVQQSNTPVANGESSTASARS-LVRK 295
           QHPNVKPENY+ELV D L+N++I     H + +S      +   N  +  +   + LVR+
Sbjct: 161 QHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRR 220

Query: 296 QSRLRKSFTEVEAIEESQFTD--SIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSD 353
            S LRKS+TE + +++S   +  S  + +      +  +LK+ITEELTRISN AGLT++D
Sbjct: 221 PSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGLTNND 280

Query: 354 AITLARTLGIGSQSADEHATFSECVPXX---------XXXXXXXXXXILAKNGLAIPARS 404
           A+TLARTL + S + ++     +  P                     +L  + L     S
Sbjct: 281 AVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHS 340

Query: 405 SLRRSKFTTYRIRSAGXXXXXXXXXXXXXXXLAAAYERNSRSPKMQKAAFKGSHPRLSGE 464
           +L+RSK+ TY IR+                       +  + P +  +           +
Sbjct: 341 TLKRSKY-TYHIRT-----------------------QEDKDPTIPVST--------ESQ 368

Query: 465 NTSLAPQSPNSINDIYDHY 483
           +  +   SP SINDIYDHY
Sbjct: 369 HQDVIEASPGSINDIYDHY 387

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (87%)

Query: 898 PRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHLK 957
           P+KL FDDV +PE+ N+PM+FT SAFGFPLPPLT+STVIM DHRL I VERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 958 LSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDK 995
           LS+  RELRQQVLLSNFMY+YLNLV H+L +++ E+DK
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDK 793

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 132/371 (35%), Positives = 187/371 (50%), Gaps = 43/371 (11%)

Query: 75  SEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAA---VSPSASPRN-SLT 130
           SE L AAQSLD E+QNVKNLKR+SIGS+DL+ DPE+   + G      S  A   N S T
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFT 80

Query: 131 EESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSEE----- 185
           EE               +     +  DA  ++  S D  R E LTS  +   S       
Sbjct: 81  EE--------------DDTTTEIDGSDADETS-ASIDRTRVEYLTSYDNTQESSNESPKG 125

Query: 186 LSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQATGEP--FSSNLLWVRADQHPNV 243
           ++ +  L+    A  ++ +S + +  R     ++ K+   E    S  L WV A+QHPNV
Sbjct: 126 VARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNV 185

Query: 244 KPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASAR---SLVRKQSRLR 300
           KPENYLELV +TLN +R     G+       S   V+N E+   + R   S+VR+ S+LR
Sbjct: 186 KPENYLELVKETLNKIRDINTDGKE-KSENNSEEEVSNKENINENGRLRGSIVRRPSKLR 244

Query: 301 KSFTE-----VEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAI 355
           KS+TE     +E ++++   + I S        R+ SLKEIT EL + SN AGLTD +A+
Sbjct: 245 KSYTEFSSEDLELLDKALSNNRIISTRNTTNSKRL-SLKEITNELVKHSNKAGLTDDNAV 303

Query: 356 TLARTLGIGSQSADEHAT------FSECVPXXXXXXXXXXXXILAKNGLAIPAR-SSLRR 408
           TLARTL I S   +++ T       +E                +  N  ++ +  SSLRR
Sbjct: 304 TLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNTSSLRR 363

Query: 409 SKFTTYRIRSA 419
           SKF TYR+++ 
Sbjct: 364 SKFNTYRVKAG 374

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.124    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,907,594
Number of extensions: 1259757
Number of successful extensions: 5318
Number of sequences better than 10.0: 204
Number of HSP's gapped: 5299
Number of HSP's successfully gapped: 313
Length of query: 1000
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 889
Effective length of database: 12,753,511
Effective search space: 11337871279
Effective search space used: 11337871279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)