Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL184W1121105692e-77
KLLA0D01661g1121093626e-46
CAGL0J06666g1121093229e-40
Kwal_27.103281271083177e-39
YML108W1051053122e-38
Scas_650.23*1151092905e-35
Sklu_767.199992843e-34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL184W
         (110 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   223   2e-77
KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   144   6e-46
CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   128   9e-40
Kwal_27.10328                                                         126   7e-39
YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   124   2e-38
Scas_650.23*                                                          116   5e-35
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement            114   3e-34

>AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..13244)
           [339 bp, 112 aa]
          Length = 112

 Score =  223 bits (569), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE 60
           MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE
Sbjct: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE 60

Query: 61  ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSD 110
           ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSD
Sbjct: 61  ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSD 110

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w hypothetical protein
           singleton, start by similarity
          Length = 112

 Score =  144 bits (362), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (78%)

Query: 2   ATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEI 61
           AT+N YRM+ILLEEP  + + D +K +NA+H+FVDEL LPIQVD++++LN+WFDKFDE+I
Sbjct: 3   ATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKI 62

Query: 62  CIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSD 110
           CIPNEGHIKYEISSDGLIVLILDK I  ++  V  FV  N  + +   D
Sbjct: 63  CIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKEQD 111

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  128 bits (322), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 62/109 (56%), Positives = 84/109 (77%), Gaps = 3/109 (2%)

Query: 5   NFYRMMILLEEPHKQHST--DGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEIC 62
           N YRMM+LLEEP ++  T  D ++ +   H+F+DEL LP Q+D++++LN WFDKFD+EIC
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62

Query: 63  IPNEGHIKYEISSDGLIVLILDKEIS-EVIGLVRDFVAANQLDEDSSSD 110
           IPNEGHIKYEI+SDGLIVLILDKE+  E +G V+ FV  N ++++   D
Sbjct: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVEDEDEED 111

>Kwal_27.10328
          Length = 127

 Score =  126 bits (317), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (5%)

Query: 1   MATDNFYRMMILLEEPHKQHST-DGRKIEN-----ASHDFVDELLLPIQVDDLEVLNTWF 54
           M+ +  YRM++L+E+P K   T DG K EN     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74

Query: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           DKFD EICIPNEG IKYEISSDGL+VL+LD+   EV+  VR FV + +
Sbjct: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
           function [318 bp, 105 aa]
          Length = 105

 Score =  124 bits (312), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 3/105 (2%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57
           M+  N YRM++LLE+  K +  D + ++      H+FVDEL+LP  VD+L+ LNTWFDKF
Sbjct: 1   MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60

Query: 58  DEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           D EICIPNEGHIKYEISSDGLIVL+LDKEI EV+  V+ FV  N 
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105

>Scas_650.23*
          Length = 115

 Score =  116 bits (290), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 80/109 (73%), Gaps = 7/109 (6%)

Query: 1   MATDNFYRMMILLEEPHK------QHSTDGRKIE-NASHDFVDELLLPIQVDDLEVLNTW 53
           M+ DN YRM++LLEE  +        +TD +  E   +H+F++ELLLP +V +L+ LN W
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           FDKFDEEICIPNEGHIKYEISSDGLIVL+LDKEI  VI  V+ F+  NQ
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQ 109

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score =  114 bits (284), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 76/99 (76%), Gaps = 1/99 (1%)

Query: 11  ILLEEPHKQHSTDGRK-IENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHI 69
           +LLEE     S +  +     SH+FVDEL+LPIQVD++++LN WFDKFDE+ICIPNEG+I
Sbjct: 1   MLLEEAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYI 60

Query: 70  KYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSS 108
           KYEISSDGLIVLIL+KE  EV+  VR FV  +Q+ ++ +
Sbjct: 61  KYEISSDGLIVLILNKEREEVVDKVRRFVEEHQVQDEEA 99

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,973,299
Number of extensions: 169085
Number of successful extensions: 450
Number of sequences better than 10.0: 12
Number of HSP's gapped: 446
Number of HSP's successfully gapped: 12
Length of query: 110
Length of database: 16,596,109
Length adjustment: 80
Effective length of query: 30
Effective length of database: 13,826,669
Effective search space: 414800070
Effective search space used: 414800070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)