Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL183W37737016840.0
KLLA0D01639g38137112471e-172
YMR272C (SCS7)38437312181e-167
Kwal_27.1033237837111361e-155
Scas_696.3642637310971e-148
CAGL0F03399g38037210041e-135
CAGL0L03828g1211011374e-10
KLLA0F27577g172801395e-10
Kwal_47.18167227571401e-09
Scas_666.12121891331e-09
YNL111C (CYB5)120751322e-09
AFL223W165971272e-08
Kwal_26.8461123861242e-08
KLLA0F23672g123751145e-07
Scas_717.14189811151e-06
KLLA0B14795g556961191e-06
ADL085C273691162e-06
Kwal_26.8046198761106e-06
YML054C (CYB2)591511137e-06
KLLA0A12111g236961099e-06
Sklu_2258.5580471102e-05
Scas_571.1d609591102e-05
Kwal_23.2823560861092e-05
KLLA0D02640g589591048e-05
Kwal_14.807578471031e-04
KLLA0E18535g14882971e-04
CAGL0K10736g593541012e-04
Scas_571.2602491012e-04
Sklu_2444.3564861012e-04
YGL055W (OLE1)5101001003e-04
CAGL0K03069g19471910.001
Scas_563.649774930.002
AAR153C47872920.002
Sklu_2299.348072920.002
CAGL0I00418g49072910.003
Sklu_2032.352273900.004
KLLA0C05566g47772850.018
Kwal_14.184528872810.044
Kwal_23.569351373800.071
AAL078W59246770.15
KLLA0C10692g520102770.17
YMR073C20164720.44
CAGL0L03674g62984682.3
AER342C63142672.5
Kwal_27.11714762108654.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL183W
         (370 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...   653   0.0  
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...   484   e-172
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...   473   e-167
Kwal_27.10332                                                         442   e-155
Scas_696.36                                                           427   e-148
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...   391   e-135
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    57   4e-10
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...    58   5e-10
Kwal_47.18167                                                          59   1e-09
Scas_666.12                                                            56   1e-09
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    55   2e-09
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    54   2e-08
Kwal_26.8461                                                           52   2e-08
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    49   5e-07
Scas_717.14                                                            49   1e-06
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    50   1e-06
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...    49   2e-06
Kwal_26.8046                                                           47   6e-06
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    48   7e-06
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    47   9e-06
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        47   2e-05
Scas_571.1d                                                            47   2e-05
Kwal_23.2823                                                           47   2e-05
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    45   8e-05
Kwal_14.807                                                            44   1e-04
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    42   1e-04
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    44   2e-04
Scas_571.2                                                             44   2e-04
Sklu_2444.3 , Contig c2444 10960-12654                                 44   2e-04
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    43   3e-04
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    40   0.001
Scas_563.6                                                             40   0.002
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    40   0.002
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         40   0.002
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    40   0.003
Sklu_2032.3 , Contig c2032 4286-5854                                   39   0.004
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    37   0.018
Kwal_14.1845                                                           36   0.044
Kwal_23.5693                                                           35   0.071
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    34   0.15 
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    34   0.17 
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    32   0.44 
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    31   2.3  
AER342C [2843] [Homologous to ScYOR275C (RIM20) - SH] (1264670.....    30   2.5  
Kwal_27.11714                                                          30   4.7  

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/370 (87%), Positives = 325/370 (87%)

Query: 1   MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV
Sbjct: 1   MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60

Query: 61  LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPENLDTTTFVKELP 120
           LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPENLDTTTFVKELP
Sbjct: 61  LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPENLDTTTFVKELP 120

Query: 121 AEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFG 180
           AEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFG
Sbjct: 121 AEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFG 180

Query: 181 NFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFL 240
           NFLEPLSKT                 TRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFL
Sbjct: 181 NFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFL 240

Query: 241 FHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEYX 300
           FHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 
Sbjct: 241 FHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEYC 300

Query: 301 XXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYWDKV 360
                      YVCYDVTHYFLHHHKLPPFMR                GFGVTSWYWDKV
Sbjct: 301 ACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKV 360

Query: 361 FGTYLASNSP 370
           FGTYLASNSP
Sbjct: 361 FGTYLASNSP 370

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score =  484 bits (1247), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/371 (63%), Positives = 271/371 (73%), Gaps = 3/371 (0%)

Query: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62
           S+ LPLYSK  L+KH D+  CWVS+  RKIY+V++FLDEHPGG +YILDYAG DIT V+K
Sbjct: 4   SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMK 63

Query: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPEN---LDTTTFVKEL 119
           D L HEH+E+AYEI+DESYLVGYLATEEEE KLLTN+ HV+EV  +     D+T FVKEL
Sbjct: 64  DVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFVKEL 123

Query: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179
           P E+ LS+ATD+  DY KH FLDLNKPLL QVL G FT+DFY+DQ+HRPRHYGKGSAPLF
Sbjct: 124 PTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLF 183

Query: 180 GNFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239
           GNFLEPLSKT                   AL NM    A+  FA GVFVWTLIEY LHRF
Sbjct: 184 GNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRF 243

Query: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299
           LFH DD +PE   AFT+HFLLHGVHHYLPMD++RLVMPP LFVVLC PFY+LVF++ P Y
Sbjct: 244 LFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYY 303

Query: 300 XXXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYWDK 359
                       YVCYD+THYFLHH +LPP+MR                GFGVTSW+WDK
Sbjct: 304 WACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDK 363

Query: 360 VFGTYLASNSP 370
           VFGTYL  N+P
Sbjct: 364 VFGTYLGENAP 374

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score =  473 bits (1218), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 228/373 (61%), Positives = 268/373 (71%), Gaps = 4/373 (1%)

Query: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61
            SKTL L+SK T+Q+H     CWV+  NRKIYDV++FL EHPGGD+ ILDYAGKDIT ++
Sbjct: 5   TSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIM 64

Query: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT----PENLDTTTFVK 117
           KD  +HEH+++AYEIL++ YL+GYLAT+EE  +LLTN+ H +EV         D+TTFVK
Sbjct: 65  KDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVK 124

Query: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177
           ELPAEE LS+ATD+  DY KH FLDLN+PLLMQ+LR +F +DFY+DQIHRPRHYGKGSAP
Sbjct: 125 ELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAP 184

Query: 178 LFGNFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237
           LFGNFLEPL+KT                   AL+NM    A   F  GVFVWTLIEY LH
Sbjct: 185 LFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLH 244

Query: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297
           RFLFHFDD +PESNIAF  HFLLHG HHYLPMDKYRLVMPP LFV+LCAPFY+LVF++ P
Sbjct: 245 RFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLP 304

Query: 298 EYXXXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYW 357
            Y            YVCYD  H+FLHH KLPPFMR                GFGVTSW+W
Sbjct: 305 LYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFW 364

Query: 358 DKVFGTYLASNSP 370
           D+VFGTYL  ++P
Sbjct: 365 DEVFGTYLGPDAP 377

>Kwal_27.10332
          Length = 378

 Score =  442 bits (1136), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 262/371 (70%), Gaps = 1/371 (0%)

Query: 1   MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           M +KTLPLYS + +Q+H     CWV++ NRKIYDV++FL++HPGG   I++YAGKDIT V
Sbjct: 1   METKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEV 60

Query: 61  LKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPEN-LDTTTFVKEL 119
           +KD  +H H+  AYE+LDE Y VGYLAT EEE KLL N KH +EV  E+  D+T FV E+
Sbjct: 61  MKDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEV 120

Query: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179
           PAEE LS+ TD+  DY +H FLDLN+PLLMQ+L  +FT++FY+DQ+HRPRHYG+GSAPLF
Sbjct: 121 PAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLF 180

Query: 180 GNFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239
           GNFLEPLSKT                   A+QNM    A+  F  G+FVWTLIEY +HRF
Sbjct: 181 GNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240

Query: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299
           LFH D  +P + +A+TVHFLLHGVHHYLPMD+YRLVMPP LF++LC PFY+LVF++ P Y
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYY 300

Query: 300 XXXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYWDK 359
                       YVCYD+THYFLHH KLP  ++                GFGVTSW WDK
Sbjct: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360

Query: 360 VFGTYLASNSP 370
           VFGTYLA N+P
Sbjct: 361 VFGTYLAENAP 371

>Scas_696.36
          Length = 426

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/373 (55%), Positives = 258/373 (69%), Gaps = 8/373 (2%)

Query: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61
           VSKTL L+SK  + KH     CWV+V +RKIYDVS+FL +HP GD+ IL +AGKDIT +L
Sbjct: 51  VSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELL 110

Query: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV----TPENLDTTTFVK 117
           KD+ I + T+    +LD+ YL+GY+AT+ EE KLLTN+ H +EV    +    D+TTFVK
Sbjct: 111 KDEKIDQQTD----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166

Query: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177
           +LP E+ LS+ATD+  D  KH+FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYG+ SAP
Sbjct: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226

Query: 178 LFGNFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237
           LFGNFLEP +KT                   A +N+ A  A+  F  GV+VWT IEY +H
Sbjct: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286

Query: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297
           RFLFHFD+ +PE N A+ +HFLLHG HHYLPMDKYRLV+PP LF+ LCAPFY+LVF++ P
Sbjct: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346

Query: 298 EYXXXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYW 357
            Y            Y+CYD+ HYFLHH KLPPFMR                G+GVTSWYW
Sbjct: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYW 406

Query: 358 DKVFGTYLASNSP 370
           DK FGTYL+ +SP
Sbjct: 407 DKKFGTYLSPDSP 419

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score =  391 bits (1004), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 241/372 (64%), Gaps = 10/372 (2%)

Query: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPG-GDQYILDYAGKDITAVL 61
           SKTL L+ ++ L KH  +  CWVS   RKIYDVS++L +HP   D       GK  T + 
Sbjct: 8   SKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDIS 67

Query: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV---TPENLDTTTFVKE 118
           + +L         + + + YLVGYLAT +EE KLLTN+ H +EV        D+TTFVK+
Sbjct: 68  QMEL------TTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKD 121

Query: 119 LPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPL 178
           LP E+ LS+ TD+  DY KH FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYGKGSAPL
Sbjct: 122 LPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPL 181

Query: 179 FGNFLEPLSKTXXXXXXXXXXXXXXXXXTRALQNMPAHLALTCFAAGVFVWTLIEYSLHR 238
           FGNFLE  +KT                 T AL NM   LAL  F  G+FVWTLIEY LHR
Sbjct: 182 FGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHR 241

Query: 239 FLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPE 298
           FLFHFD+ +PE ++ F +HFLLHG HHYLPMD YRLV+PPALFVVLCAP Y+LVF+  P 
Sbjct: 242 FLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPY 301

Query: 299 YXXXXXXXXXXXXYVCYDVTHYFLHHHKLPPFMRXXXXXXXXXXXXXXXXGFGVTSWYWD 358
           Y            Y+CYD+ HYFLHH K+PPFMR                GFGVTSW+WD
Sbjct: 302 YWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 361

Query: 359 KVFGTYLASNSP 370
           KVFGTYL  ++P
Sbjct: 362 KVFGTYLGPDAP 373

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
           cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 8   LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
           +Y+   + +H     CW+ + +  +YDVS+FLDEHPGGD+ I ++ G D T    D    
Sbjct: 4   VYTYKQVSEHNKEGDCWIII-DGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDI--- 59

Query: 68  EHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVTPE 108
            H++ A +IL ++  +G +    E + +   E  +++ + E
Sbjct: 60  GHSDDALKIL-KTLKIGEVDPNSERVVIDNRESDMVQKSTE 99

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
          Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 7  PLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLI 66
          PL +   + +H+ R+ CW +V + K+YD++ FL +HPGG Q +L YAGKD T    D + 
Sbjct: 4  PLITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF-DDIG 61

Query: 67 HEHTEAAYEILDESYLVGYL 86
          H     AY+ LD   L G L
Sbjct: 62 HSMESLAYD-LDPGALKGTL 80

>Kwal_47.18167
          Length = 227

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 2  VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDIT 58
           S  LP  S   +  HTD   CW+S+ + K+YDVS +L +HPGG Q +L  AGKD T
Sbjct: 27 TSSQLPFISSDEVATHTDADDCWISI-HGKVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>Scas_666.12
          Length = 121

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 5/89 (5%)

Query: 8  LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
          +YS   + +H      W+ +   K+YDVS+FLDEHPGGD+ I + AG+D T    D    
Sbjct: 4  VYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDI--- 59

Query: 68 EHTEAAYEILDESYLVGYLATEEEEIKLL 96
           H++ A +IL     +G L  E + ++++
Sbjct: 60 GHSDDALQIL-RKLRIGELDKESKPVEVV 87

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 8  LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
          +YS   + +H    + W+ + + K+YDVSQF DEHPGGD+ I+D  G+D T    D    
Sbjct: 4  VYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDI--- 59

Query: 68 EHTEAAYEILDESYL 82
           H++ A  +L   Y+
Sbjct: 60 GHSDEALRLLKGLYI 74

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 55/97 (56%), Gaps = 6/97 (6%)

Query: 5   TLP-LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKD 63
           T+P LY+   + +H      W+ + N K+YD ++F +EHPGGD+ ++D AG+D T    D
Sbjct: 39  TMPKLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFAD 97

Query: 64  KLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEK 100
                H++ A ++L+  Y VG L  + E +   + ++
Sbjct: 98  I---GHSDDAVKMLEGLY-VGDLDKDSEPVVSASEDR 130

>Kwal_26.8461
          Length = 123

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 5/86 (5%)

Query: 8  LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
          LYS   + +H      W+ + + K+YD ++F+DEHPGG++ ++D  G+D T    D    
Sbjct: 4  LYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADI--- 59

Query: 68 EHTEAAYEILDESYLVGYLATEEEEI 93
           H++ A ++L + Y VG +  + E +
Sbjct: 60 GHSDDAVKMLADLY-VGDVDKDSEPV 84

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 8  LYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
          L +   + +H      W+ + + K+YD ++F+DEHPGGD+ ++D  G+D T   +D    
Sbjct: 4  LLTYKEVSEHKTVDDLWMII-DGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDI--- 59

Query: 68 EHTEAAYEILDESYL 82
           H++ A ++L+  Y+
Sbjct: 60 GHSDDAIKLLEPMYV 74

>Scas_717.14
          Length = 189

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 10  SKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYIL-DYAGKDITAVLKDKLIHE 68
           + + LQ+HT RT CW ++   K+Y VS +L+ HPGG   I  + AGKD T +        
Sbjct: 114 NNSILQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN----QY 168

Query: 69  HTEAAYEILDESYLVGYLATE 89
           H+    E L E+ L+G    E
Sbjct: 169 HSWVNAEKLLETCLIGIFVNE 189

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 52/96 (54%), Gaps = 12/96 (12%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAA 73
           ++ H     CW+ + N ++YD+++FL +HPGG   ++++AG+D T    ++    H+ A 
Sbjct: 86  VKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDAT----ERFYQMHSSAT 140

Query: 74  YEILDE-----SYLVGYLATE--EEEIKLLTNEKHV 102
            E + E       L G    E  EEEI+++ ++  +
Sbjct: 141 LEKMKEHLVYIGKLKGAFDKELSEEEIRIIEHKAKI 176

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAA 73
           + +HT R  CW  +  R +YD++  L+ HPGG + +L YAG+D T    D + H      
Sbjct: 98  VSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPF-DDVGHSMESLI 155

Query: 74  YEILDESYL 82
           Y++   SYL
Sbjct: 156 YDMAPGSYL 164

>Kwal_26.8046
          Length = 198

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 6/76 (7%)

Query: 10  SKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGG-DQYILDYAGKDITAVLKDKLIHE 68
           +KA L +H     CW  + N+K+Y +S +LD HPGG D  +   AGKD T++        
Sbjct: 124 NKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN----KY 178

Query: 69  HTEAAYEILDESYLVG 84
           H    YE + E+ LVG
Sbjct: 179 HRWVNYEKVLETSLVG 194

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 10  SKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           S A + KH     CWV + N  +YD+++FL  HPGG   I   AGKD+TA+
Sbjct: 92  SPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAA 73
           ++ H     CW+ + +  +YD++ FL +HPGG   ++++AG+D T    ++    H+ A 
Sbjct: 86  VKSHNRIDDCWIVI-DGDVYDITGFLSKHPGGVTRLMEFAGRDAT----ERFHQMHSSAM 140

Query: 74  YEILDE-----SYLVGYLATE--EEEIKLLTNEKHV 102
            E + E       L G    E  EEEI+++  +  +
Sbjct: 141 LEKMKEHLTYIGKLKGAFDEELSEEEIRIMEQKSKI 176

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           + KH D   CWV + +  +YD+++F+  HPGG   I + AGKD+TA+
Sbjct: 86  VAKHNDPKDCWVVI-DGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>Scas_571.1d
          Length = 609

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           +S T    S   + KH     CW+ + N ++YD++ F+  HPGG   I   AGKD++A+
Sbjct: 88  LSSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>Kwal_23.2823
          Length = 560

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 12/86 (13%)

Query: 17  HTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEI 76
           H     CW+ V N ++YDV+ F+  HPGG Q IL+ AG D T    +K    H+E     
Sbjct: 89  HNKLNDCWI-VLNDEVYDVTSFIAAHPGGVQRILEVAGSDAT----EKFYQIHSEDVLNK 143

Query: 77  LDESYL-VGYLATE------EEEIKL 95
           + E  + VG L  +      EEE+++
Sbjct: 144 MKEKLVYVGKLKGKFSKIVTEEELRI 169

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           V  T P  S   + KH+    CWV +    +Y+++ F+  HPGG   I + AGKD+T +
Sbjct: 83  VDMTKPKVSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>Kwal_14.807
          Length = 578

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           + KH+    CWV + N  +YD+S F+  HPGG   I   AGKD++A+
Sbjct: 84  VAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 10  SKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEH 69
           +K  L+ + D   C +   NRK+Y +  +L  HPGG+  +   AGKD+T++        H
Sbjct: 73  NKEALKANKDNFWCVI---NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFN----KYH 125

Query: 70  TEAAYEILDESYLVG-YLATEE 90
               YE L E+  +G Y+ + E
Sbjct: 126 RWVNYERLLETCFIGMYVGSAE 147

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 7   PLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           P  S + + KH     CWV + +  +YD++ F+  HPGG   I   AGKD+TA+
Sbjct: 88  PKISPSEVIKHNTPEDCWVVI-DGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>Scas_571.2
          Length = 602

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 12  ATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAV 60
           + + +H     CW+ + N  +YD++ F+  HPGG   I   AGKD+TA+
Sbjct: 92  SEVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 12/86 (13%)

Query: 17  HTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEI 76
           H +   CW+ V N  +YD+++F+  HPGG   +++ AG+D T    +K    H++   E 
Sbjct: 96  HNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDAT----EKFHMIHSDEVLEK 150

Query: 77  LDE-SYLVGYLATE------EEEIKL 95
           + E   LVG L  E      EEE+++
Sbjct: 151 MKEYITLVGKLEGEFSNEVSEEELRI 176

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ K T    +      V +    ++DVS ++ EHPGG+  I    GKD T       
Sbjct: 409 LPMWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 466

Query: 66  IHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV 105
           ++ H+ AA  +L +  +     ++   I++ +    + E 
Sbjct: 467 VYRHSNAAQNVLADMRVAVIKESKNSAIRMASKRGEIYET 506

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAA 73
           L +H     CW +V N K+Y +S +L  HPGG + ++D +    + VL ++    H   +
Sbjct: 124 LARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVLFNRY---HRWIS 179

Query: 74  YEILDESYLVG 84
            E + E+ LVG
Sbjct: 180 VEKMLETCLVG 190

>Scas_563.6
          Length = 497

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ K    +        V +    I+D+S ++ EHPGG+  I    GKD T   +   
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDATRAFQGG- 453

Query: 66  IHEHTEAAYEILDE 79
           ++ H+ AA  +L E
Sbjct: 454 VYRHSTAAQNVLSE 467

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ ++   + +   S  V +    ++DVS ++ EHPGG+  I    GKD T       
Sbjct: 378 LPVWDRSEFVRASRENSGLVVISG-IVHDVSGYITEHPGGETLIQAALGKDATRAFNGG- 435

Query: 66  IHEHTEAAYEIL 77
           ++ H+ AA+ IL
Sbjct: 436 VYMHSNAAHNIL 447

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ K    K        V V    ++DVS ++ EHPGG+  I   AGKD T       
Sbjct: 379 LPVWDKEEFMKSLKSNPGLVIVSG-IVHDVSGYITEHPGGETLIQAAAGKDATKAFNGG- 436

Query: 66  IHEHTEAAYEIL 77
           ++ H+ AA+ +L
Sbjct: 437 VYLHSNAAHNVL 448

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP ++K    +        V VG   ++DVS ++ EHPGG++ + +  GKD T       
Sbjct: 386 LPAWTKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDATKAFSGG- 443

Query: 66  IHEHTEAAYEIL 77
           ++ H+ AA+  L
Sbjct: 444 VYRHSNAAHNTL 455

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 32  IYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEILDESYLVGYLATEEE 91
           ++DV+ F+ +HPGG   +    GKD TA   +  ++ H+ AA  +L  +  +  L     
Sbjct: 419 VHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAVYSHSRAARNLL-ATMRIAVLRRGPM 476

Query: 92  EIKLLTNEKHVME 104
           E++    EKH++E
Sbjct: 477 EVQQTVWEKHLLE 489

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ K    +     +  V +    ++DVS ++ EHPGG+  I    GKD T       
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVISG-IVHDVSGYITEHPGGETLIQASLGKDATKAFNGG- 436

Query: 66  IHEHTEAAYEIL 77
           ++ H+ AA+ IL
Sbjct: 437 VYLHSNAAHNIL 448

>Kwal_14.1845
          Length = 288

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 6   LPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKL 65
           LP++ K    ++  +T+  + + +  ++DVS ++ EHPGG+  I     KD T       
Sbjct: 187 LPVWDKQQFMENI-KTNPGLVIISGIVHDVSNYITEHPGGETLIKAALNKDATKAFNGG- 244

Query: 66  IHEHTEAAYEIL 77
           ++ H+ AA+ +L
Sbjct: 245 VYLHSNAAHNVL 256

>Kwal_23.5693
          Length = 513

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 32  IYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEILDESYLVGYLATEEE 91
           ++DV+ F+ +HPGG   +    GKD T    +  ++ H++AA  +L  +  +  L + + 
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARNLL-ATMRIAVLGSSQM 467

Query: 92  EIKLLTNEKHVME 104
            ++    EK ++E
Sbjct: 468 GLEPTIWEKQMLE 480

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 32  IYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEIL 77
           I+DV+ F+ +HPGG   ++   GKD T    +  ++ H+ AA  +L
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAF-NGAVYAHSTAARNLL 540

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 27  VGNRKIY--------DVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEILD 78
           + NRK Y        DV+ F+ +HPGG   +    GKD T    +  ++ H+ AA  +L 
Sbjct: 404 IKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLL- 461

Query: 79  ESYLVGYLATEEEEIKLLTNEKHVMEVTP--ENLDTTTFVKE 118
            +  V  +  +   I+  T E++ +       N+D    V+ 
Sbjct: 462 ATMRVAVITDQSSNIQRTTWEENSIANATHRNNMDRQDVVRN 503

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 1   MVSKTLPLY--------SKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDY 52
           ++ + +PLY        ++  ++KH         V N K+YD+S +L  HPGG   ++ +
Sbjct: 109 LLVQKIPLYKIMPPLRINRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKH 168

Query: 53  AGKD 56
              D
Sbjct: 169 RNSD 172

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 35/84 (41%), Gaps = 6/84 (7%)

Query: 108 ENLDTTTFVKELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYI----D 163
           ENLD    V++LP   +    T  GT      FL++ +PL     R   + D       D
Sbjct: 182 ENLDQDNAVEDLPISVLPGSKTKNGTAENLSQFLNIGRPLHKTQSRPYISLDMMTAGMKD 241

Query: 164 QIHRPRHYGKGSAPLFGNFLEPLS 187
            I  P  Y   S  L  N+L P++
Sbjct: 242 DILPPETYNTTS--LGDNYLSPIN 263

>AER342C [2843] [Homologous to ScYOR275C (RIM20) - SH]
           (1264670..1266565) [1896 bp, 631 aa]
          Length = 631

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 26  SVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIH 67
           S+GN ++ +  ++L E  G  QYIL    +++ +V+ +K I 
Sbjct: 124 SMGNDELKEACRYLQESAGCFQYILSAMERELESVIDEKTIR 165

>Kwal_27.11714
          Length = 762

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 25/108 (23%)

Query: 22  SCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAAYEILDESY 81
           SC VS  N  I+D  Q L E P                  + ++++EH +  + + DES 
Sbjct: 345 SCMVSEANDSIFDDLQSLPEKP-----------------RQLRVVNEH-KPNFVMNDESS 386

Query: 82  LVGYLATEEEEIKLLTNEKHVMEVTPENLDTTTFVKELPAEEVLSVAT 129
                 TE+E I L T E H +     N  T +F+ EL   +V +  T
Sbjct: 387 -----TTEDESISLSTEEMHAVPSGVAN--TASFIPELQKAQVSASPT 427

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,504,665
Number of extensions: 481568
Number of successful extensions: 1601
Number of sequences better than 10.0: 49
Number of HSP's gapped: 1619
Number of HSP's successfully gapped: 49
Length of query: 370
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 267
Effective length of database: 13,030,455
Effective search space: 3479131485
Effective search space used: 3479131485
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)