Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL182W1231120860230.0
Kwal_14.24351247121132400.0
YJL074C (SMC3)1230122231790.0
Scas_711.391227121431760.0
KLLA0A00286g1280121030810.0
CAGL0H02805g1219122328520.0
Kwal_55.20421117012914755e-48
AGR236W11707734417e-44
Scas_565.611707114079e-40
YFR031C (SMC2)11707053792e-36
KLLA0D16005g11707093693e-35
CAGL0D05258g11707463657e-35
Sklu_2249.210832152664e-23
CAGL0L12188g13987802522e-21
YLR086W (SMC4)14187232451e-20
Kwal_56.2382513967642192e-17
KLLA0F19085g13721981913e-14
AGR089C1370791762e-12
Scas_681.41409791752e-12
Scas_707.2312232461663e-11
CAGL0F02079g12232211627e-11
Kwal_23.504312252421592e-10
YFL008W (SMC1)1225861582e-10
AGL023W12222211573e-10
KLLA0D07502g1243701483e-09
KLLA0F07997g11192231466e-09
AER044W11034131271e-06
Kwal_26.720411172121271e-06
YOL034W (SMC5)10932171215e-06
Scas_643.1110952241117e-05
Scas_719.610961651063e-04
CAGL0H05071g11101591054e-04
AEL337C10971991036e-04
CAGL0F01155g11053501010.001
YLR383W (RHC18)1114246980.003
Kwal_26.93801102208960.004
CAGL0K10934g599214910.017
KLLA0E05247g1098161860.070
Scas_653.20859262800.30
Scas_636.1460880790.37
CAGL0G08041g60782780.51
YDR091C60880780.55
ADL022C3392219770.76
CAGL0H06919g62751770.76
Kwal_33.13526129851761.1
CAGL0J07788g130551761.1
YDL040C (NAT1)854128751.2
YNL250W (RAD50)131251751.3
Kwal_56.2342953953741.4
KLLA0F08063g289147731.5
ADR400W796103741.6
AGR125W60753741.6
Scas_706.21130451722.7
KLLA0C01991g70656723.1
CAGL0J00693g1884198723.4
AGL335W69149713.5
Kwal_26.948071949713.9
Scas_688.22187686714.2
YNL239W (LAP3)45447687.3
KLLA0F22451g451165687.4
KLLA0C17556g60782688.2
KLLA0B10956g69092689.2
Scas_702.435463679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL182W
         (1208 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  2324   0.0  
Kwal_14.2435                                                         1252   0.0  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  1229   0.0  
Scas_711.39                                                          1228   0.0  
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  1191   0.0  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  1103   0.0  
Kwal_55.20421                                                         187   5e-48
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...   174   7e-44
Scas_565.6                                                            161   9e-40
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...   150   2e-36
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...   146   3e-35
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...   145   7e-35
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement         107   4e-23
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...   101   2e-21
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    99   1e-20
Kwal_56.23825                                                          89   2e-17
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    78   3e-14
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    72   2e-12
Scas_681.4                                                             72   2e-12
Scas_707.23                                                            69   3e-11
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    67   7e-11
Kwal_23.5043                                                           66   2e-10
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...    65   2e-10
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...    65   3e-10
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...    62   3e-09
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    61   6e-09
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    54   1e-06
Kwal_26.7204                                                           54   1e-06
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    51   5e-06
Scas_643.11                                                            47   7e-05
Scas_719.6                                                             45   3e-04
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    45   4e-04
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    44   6e-04
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    44   0.001
YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved i...    42   0.003
Kwal_26.9380                                                           42   0.004
CAGL0K10934g complement(1067851..1069650) similar to sp|Q04322 S...    40   0.017
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    38   0.070
Scas_653.20                                                            35   0.30 
Scas_636.14                                                            35   0.37 
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    35   0.51 
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    35   0.55 
ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH] (6...    34   0.76 
CAGL0H06919g complement(685736..687619) similar to sp|Q03103 Sac...    34   0.76 
Kwal_33.13526                                                          34   1.1  
CAGL0J07788g complement(757051..760968) similar to sp|P12753 Sac...    34   1.1  
YDL040C (NAT1) [824] chr4 complement(378871..381435) Protein N-a...    33   1.2  
YNL250W (RAD50) [4357] chr14 (175409..179347) Coiled-coil protei...    33   1.3  
Kwal_56.23429                                                          33   1.4  
KLLA0F08063g 756362..757231 some similarities with sp|P18410 Sac...    33   1.5  
ADR400W [2140] [Homologous to ScYAL047C (SPC72) - SH] complement...    33   1.6  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    33   1.6  
Scas_706.21                                                            32   2.7  
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    32   3.1  
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...    32   3.4  
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    32   3.5  
Kwal_26.9480                                                           32   3.9  
Scas_688.22                                                            32   4.2  
YNL239W (LAP3) [4368] chr14 (200568..201932) Aminopeptidase of c...    31   7.3  
KLLA0F22451g 2098204..2099559 similar to sp|P33895 Saccharomyces...    31   7.4  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    31   8.2  
KLLA0B10956g 958985..961057 similar to sp|P17119 Saccharomyces c...    31   9.2  
Scas_702.4                                                             30   9.7  

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 2324 bits (6023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1154/1208 (95%), Positives = 1154/1208 (95%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMINNKNASR 120
            RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMINNKNASR
Sbjct: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMINNKNASR 120

Query: 121  SDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQK 180
            SDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQK
Sbjct: 121  SDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQK 180

Query: 181  METTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTSM 240
            METTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTSM
Sbjct: 181  METTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTSM 240

Query: 241  VEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKDSELE 300
            VEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKDSELE
Sbjct: 241  VEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKDSELE 300

Query: 301  LAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIE 360
            LAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIE
Sbjct: 301  LAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIE 360

Query: 361  EAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSIS 420
            EAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSIS
Sbjct: 361  EAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSIS 420

Query: 421  EERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRS 480
            EERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRS
Sbjct: 421  EERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRS 480

Query: 481  EQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIK 540
            EQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIK
Sbjct: 481  EQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIK 540

Query: 541  ISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYP 600
            ISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYP
Sbjct: 541  ISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYP 600

Query: 601  SNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDKAD 660
            SNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDKAD
Sbjct: 601  SNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDKAD 660

Query: 661  SRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIK 720
            SRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIK
Sbjct: 661  SRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIK 720

Query: 721  KSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTE 780
            KSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTE
Sbjct: 721  KSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTE 780

Query: 781  DLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLKPQ 840
            DLSR                IAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLKPQ
Sbjct: 781  DLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLKPQ 840

Query: 841  AKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQE 900
            AKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQE
Sbjct: 841  AKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQE 900

Query: 901  EEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDSAD 960
            EEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDSAD
Sbjct: 901  EEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDSAD 960

Query: 961  KYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKESIE 1020
            KYHNM           INDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKESIE
Sbjct: 961  KYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKESIE 1020

Query: 1021 KLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXXX 1080
            KLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENE            
Sbjct: 1021 KLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPSKPSKRQQKKR 1080

Query: 1081 XXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALIL 1140
               ETEDVHF            IYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALIL
Sbjct: 1081 KRQETEDVHFNDDQDENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALIL 1140

Query: 1141 AIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200
            AIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV
Sbjct: 1141 AIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

Query: 1201 NFENKIST 1208
            NFENKIST
Sbjct: 1201 NFENKIST 1208

>Kwal_14.2435
          Length = 1247

 Score = 1252 bits (3240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1211 (51%), Positives = 863/1211 (71%), Gaps = 15/1211 (1%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            MYI+ V+I+GFKTY+N T +++FSPH NVV+G NGSGKSNFFAA+RFVLSDDY++LKREE
Sbjct: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGA----QDGGVIHIRRTVGLKKDEYMINNK 116
            R+ LI+QGT S+MS YVEIVFH   ++ ++ +     +  ++ +RRT+GLKKDEY +N K
Sbjct: 85   RQGLIHQGTGSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVNGK 144

Query: 117  NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
               +SD+ R+ ES GFS SNPYNIVPQGRIV++TNA+++ERL LLE+V+GA+SFE KL+E
Sbjct: 145  TCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKLRE 204

Query: 177  SLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNE 236
            S +KME T ++R KI  EL E++A+L ELDEER+ELEKY  L+R R++ QF LYDRELNE
Sbjct: 205  SSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQFVLYDRELNE 264

Query: 237  VTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKD 296
            VTS +E L+ EY N L  SE+YIQEL KRE+LI  LTK+++ + +ELK+KESTD QQ K 
Sbjct: 265  VTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQDKS 324

Query: 297  SELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQ 356
               E+ K  ADL ++YEE   Q + +  Q A   ++L  +  +I     QL RLSPR+EQ
Sbjct: 325  RLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRYEQ 384

Query: 357  LTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIAL 416
            L +E  A +A+    Q++QR++++KRG Y+QF N++ERDAWI +ELS LK +       +
Sbjct: 385  LKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKKNV 444

Query: 417  TSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQ 476
              +  E++ +  ++    + I ELNDS  GPGI++EL+D+Q  L  LK+++L KIDERK+
Sbjct: 445  EIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDERKE 504

Query: 477  LWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLG 536
            LWRSEQ++Q+V E+L+D VKR+E  LSETMDR+LA GLK V EI QRL LP G+V GPLG
Sbjct: 505  LWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGPLG 564

Query: 537  ELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSN 596
            ELIK++EKYK CAE VGG SL HVVVDTE TA++LM ELYN+K GRVTFIPLNR+   + 
Sbjct: 565  ELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDRNA 624

Query: 597  IVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDG 656
            + +P N +  CTPL+ KIKYD  FE+A++HVFG+TIVV+DL  G+KLA+ + L+A+TLDG
Sbjct: 625  VTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVTLDG 684

Query: 657  DKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELN 716
            D+AD+RGV+TGG+HD+HK+ RLD ++D+ S K++       L  V+ K+ +ID EID +N
Sbjct: 685  DRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEIDNVN 744

Query: 717  DKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLD 776
             ++K   +R++ IL  +E + +K+ K   +     E +  +  K  + K +  + ++K++
Sbjct: 745  GELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEEKIE 804

Query: 777  MYTEDLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSK 836
             Y +DL +                +A ++  L   +  TT+ALS + ++ID LK EL+ K
Sbjct: 805  KYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTELNVK 864

Query: 837  LKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLK 896
            L PQ ++LE++  E  S   +   +E ++ + DE K L  ++  +   +  ++E I TL 
Sbjct: 865  LNPQKRDLENRLEEEYSRDDLTTNRE-LEHMADELKKLAVKEQDLQTSLASLTEAIGTLS 923

Query: 897  SRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPD 956
              +   ++ LEKA+SQQRAL+KKLD +QKEAEKS+++K +L TRRDE+Q +I +IGLL +
Sbjct: 924  EERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQLRISEIGLLSE 983

Query: 957  DSADKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESK 1016
            +S +++ N+           +NDKISKM+N+N+RA+ENFKKF+DK++D+  RA+EL++SK
Sbjct: 984  ESLERHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEELEQSK 1043

Query: 1017 ESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXXXX 1076
            ESIEKL++ LKKQKVEAVE TF KV+ NFT +FEK+VP G G+L+IHR   +        
Sbjct: 1044 ESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQR 1103

Query: 1077 XXXXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAI 1136
                         +            +YSGVSI VSFNSK +EQ++VEQLSGGQKTVCAI
Sbjct: 1104 SP----------EYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAI 1153

Query: 1137 ALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADR 1196
            ALILAIQMVDPAPFYLFDEIDAALDKQYRT+VA T+K+LS+ AQFICTTFR DM+ VAD 
Sbjct: 1154 ALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADS 1213

Query: 1197 FYRVNFENKIS 1207
            FYRV FENKIS
Sbjct: 1214 FYRVKFENKIS 1224

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1222 (52%), Positives = 881/1222 (72%), Gaps = 28/1222 (2%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            MYIK+VII+GFKTY+N+T IDNFSPH NV++G NGSGKSNFFAAIRFVLSDDY+NLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 61   RRSLIYQGTS-SVMSGYVEIVFHGAENRTLLGAQDGGV-------IHIRRTVGLKKDEYM 112
            R+ LI+QG+  SVMS  VEIVFH  ++  +L +   GV       + IRRTVGLKKD+Y 
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPS---GVLSRGDDEVTIRRTVGLKKDDYQ 117

Query: 113  INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER 172
            +N++N ++ D+ R+LE+AGFS +NPYNIVPQG+IV+LTNA+++ERLQLLE+V+GAKSFE 
Sbjct: 118  LNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEV 177

Query: 173  KLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDR 232
            KLK SL+KME TE+ + +I  E+ E+ +KL+E+++ERKELEKYN L+R RK+ QF LYDR
Sbjct: 178  KLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDR 237

Query: 233  ELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQ 292
            ELNEV + +E+LDG+Y NT+  SEQYIQEL+KRE +I+ ++K L+ + + LK+K +TDLQ
Sbjct: 238  ELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQ 297

Query: 293  QAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSP 352
            QAK  E E+++ L ++NVK +++  Q  + +EQ   +S +L  I+S I  ++Q+L+++ P
Sbjct: 298  QAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILP 357

Query: 353  RFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCS 412
            R+++LT EEA  K +  +LQQ+QRDL+ K+G+Y++F++K ERD WI  E+  LK  +Q  
Sbjct: 358  RYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNL 417

Query: 413  SIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKID 472
            +   + +  +R SLR + + +D++I EL DS +GP    +LED   EL  LK+     +D
Sbjct: 418  NELESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLD 477

Query: 473  ERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVF 532
             RK+LWR EQK+Q+VLE+L+ DV + +  ++ETM RSLA G+ NV EI ++L +   SVF
Sbjct: 478  TRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVF 537

Query: 533  GPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVH 592
            G LGELIK+++KYK CAEV+GG SLFH+VVDTE TA L+M ELY  KGGRVTFIPLNR+ 
Sbjct: 538  GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 593  VDSNIVYPSN--DEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLN 650
            +DS++ +PSN   +   TPLIKKIKY+P+FE+A+KHVFGKTIVVKDL QG KLAK+ +LN
Sbjct: 598  LDSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLN 657

Query: 651  AITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQ 710
            AITLDGD+AD RGVLTGG+ D HK+ RL+S+++L   + + +    +L+ V+ +L+ ID 
Sbjct: 658  AITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDT 717

Query: 711  EIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKL 770
            +ID++N  I+K  + RE +LT +E     L   K E+ +LEE++  +I K EK   N+  
Sbjct: 718  KIDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTF 777

Query: 771  LQDKLDMYTEDLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSLK 830
             Q+KL+ +  DL +                + K++    N LN T+DAL  +   IDSL 
Sbjct: 778  AQEKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLN 837

Query: 831  AELDSKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISE 890
            AEL+SKL PQ  +LE + +E+     I  LQ+ +  ++ E++++ ++      E+  +  
Sbjct: 838  AELESKLIPQENDLESKMSEV-GDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQR 896

Query: 891  IIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRD 950
             I++L + +   +K LEKAN+QQR LLKKLDN+QK  EK+M++K TL TRR+ELQQ+IR+
Sbjct: 897  EIESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIRE 956

Query: 951  IGLLPDDS-ADKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRA 1009
            IGLLP+D+  + + ++           +N +IS + NVNKRA ENFKKF++++KD+ +RA
Sbjct: 957  IGLLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERA 1016

Query: 1010 KELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEX 1069
             ELDESK+SI+ LI KLK+QKV AV++TF+KVSENF  +FE++VPRGT KL+IHR+ +  
Sbjct: 1017 SELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKND-- 1074

Query: 1070 XXXXXXXXXXXXXXETEDVHFXXXXXXXXX---XXXIYSGVSIEVSFNSKKDEQVHVEQL 1126
                          E+ DV                 +Y+GVSI VSFNSK++EQ+HVEQL
Sbjct: 1075 --------NANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQL 1126

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTF 1186
            SGGQKTVCAIALILAIQMVDPA FYLFDEIDAALDKQYRTAVA  +K+LS  AQFICTTF
Sbjct: 1127 SGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTF 1186

Query: 1187 RGDMIAVADRFYRVNFENKIST 1208
            R DM+ VAD+F+RV +ENKIST
Sbjct: 1187 RTDMLQVADKFFRVKYENKIST 1208

>Scas_711.39
          Length = 1227

 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1214 (51%), Positives = 871/1214 (71%), Gaps = 15/1214 (1%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            MYIK+V+I+GFKTY+N+T ID+FSPHHN+V+G NGSGKSNFF+AIRFVLSDDY+NLKREE
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 61   RRSLIYQGTS-SVMSGYVEIVFHGAENRTLLGA-----QDGGVIHIRRTVGLKKDEYMIN 114
            R+ LI+QG+  SVMS  VEIVFH  E++ +L +     ++   I IRRTVGLKKD+Y +N
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 115  NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKL 174
            ++N ++ DV R+LES GFS SNPYNIVPQG+I+SLTNA+++ERLQLLE+V+GAKSFE KL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 175  KESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDREL 234
            K SL+KME TE+ R +I  E++E+ +KL E+++ERKELEKYN+L++ RK+ QF LYDREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 235  NEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQA 294
            N++ + VE+LD +Y  T   SEQYI+EL+KRE +I  ++K+L+++ S LK+K +TDL QA
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 295  KDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRF 354
            K    EL   L +L V+ ++L  Q  A + Q+ S+ ++L  I  +I  +EQ+L+ +SP+F
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 355  EQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSI 414
            ++L+ EE   K ++  LQQRQRDLL K+G+Y++F +  ER+ WI  E+    + LQ    
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 415  ALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDER 474
                I  ERD +  K+ +LD+ I  LNDS  GP +  ELE +Q EL  LK  +   ID+R
Sbjct: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480

Query: 475  KQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGP 534
            K+LWR+EQKI++VL++L+++VK  E  ++ETMDRSLA G+K+V EIA +L LPE SVFG 
Sbjct: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540

Query: 535  LGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVD 594
            LGELI ++EKYK CAEVVGG SLFH+VVDTE TA ++M+ELY  KGGRVTFIPLNR+++D
Sbjct: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600

Query: 595  SNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITL 654
            +NI YP ND+   TPLI KIKYD +F++A++H+FGKTIVVKDL  G +++K+F+LN+ITL
Sbjct: 601  ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSITL 660

Query: 655  DGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDE 714
            DGD+AD RGVLTGG++D +KQ RLDS+  L     + +    +L  +K+ +  +D  ID 
Sbjct: 661  DGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNIDT 720

Query: 715  LNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDK 774
            LN+ I+K  + RE +L+ +E +  KL   K ++ LLEE++  L  K EK +IN ++  DK
Sbjct: 721  LNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADK 780

Query: 775  LDMYTEDLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELD 834
             + Y +D+S                  +  L ++E  L  TT+ L +V  +++SL AEL+
Sbjct: 781  KETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEMNSLNAELN 840

Query: 835  SKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDT 894
            SKL PQ +++  Q ++    + + +L+  +D++  + + +  + ++    V  I + I+ 
Sbjct: 841  SKLFPQKQDILSQMSQ-EGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIED 899

Query: 895  LKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLL 954
            LKS +   +K LEKANSQQR LLKKL+ +QK+ EK+M++K  L TRRDELQQKIR+IGLL
Sbjct: 900  LKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLL 959

Query: 955  PDDSADKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDE 1014
             +D+ + ++++           +++ IS + NVNKRA ENF+KFD+KQK++++RA ELDE
Sbjct: 960  AEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDE 1019

Query: 1015 SKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXX 1074
            SK SI+ LI +L++QKV AV++TF KV+ENF  +FEK+VP G  KL+IHR +N       
Sbjct: 1020 SKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETN 1079

Query: 1075 XXXXXXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVC 1134
                     + ++V              IY+GVSI VSFNSK++EQ+HVEQLSGGQKTVC
Sbjct: 1080 SNDDDVDMDQEDEV--------INNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVC 1131

Query: 1135 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVA 1194
            AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVA  +KQLS  AQFICTTFR DM+ VA
Sbjct: 1132 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVA 1191

Query: 1195 DRFYRVNFENKIST 1208
            DRF+RV +ENKIST
Sbjct: 1192 DRFFRVKYENKIST 1205

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 1191 bits (3081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1210 (50%), Positives = 858/1210 (70%), Gaps = 11/1210 (0%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            ++IK VII GFKTYKN+T ++NFSPHHNVVVG NGSGKSNFFAAIRFVLS++ +NLKRE+
Sbjct: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117

Query: 61   RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQ-DGGVIHIRRTVGLKKDEYMINNKNAS 119
            R+  IYQG   VMS +VEI+F   EN  L   + D G + IRRTVGLKKDEYMIN+KN++
Sbjct: 118  RKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVGLKKDEYMINDKNST 177

Query: 120  RSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQ 179
            R DV+R+LE+ GFSTSNPYNIVPQGRI+SLTNA++ ERL LLE+V+GAKSFE KLKESL+
Sbjct: 178  RQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKLKESLK 237

Query: 180  KMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTS 239
            KME  E++R KI  EL E++ +L+EL +E++ELEKYN+L+R RK+ QF LYDRELN++T+
Sbjct: 238  KMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDRELNDITN 297

Query: 240  MVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAKDSEL 299
             +E+L+GEY + +  S +Y+ ELEKRE L   L K +N L SE+K+K+STDL Q K S+L
Sbjct: 298  QIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQLKASKL 357

Query: 300  ELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTI 359
            E+A  LADL+ +  ++  Q +A +    SN + +  ++ QI +    +A + P+F++L+ 
Sbjct: 358  EVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKFQKLSN 417

Query: 360  EEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSI 419
            E   +K E + L +RQR+LL+K+GKY  FR   ER+ WI +++++L + L  S+I    +
Sbjct: 418  EAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQL 477

Query: 420  SEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWR 479
            + +  +L+  L  L+ +I +L DS +G G  A+ ED+Q ++T  KK +L KID+RKQLWR
Sbjct: 478  TSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQRKQLWR 537

Query: 480  SEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELI 539
            +EQ++Q++  SL +DVKR E  ++ET+DRSLA GL+NV++I  RLNL E  VFGP+GELI
Sbjct: 538  TEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLHE-HVFGPVGELI 596

Query: 540  KISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVY 599
            K+S+KYK CAEVVGG SLF+VVVD E TA+LL++EL+ +KGGRVTFIPLN++HVD+N  Y
Sbjct: 597  KVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHVDTNFTY 656

Query: 600  PSN-DEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITLDGDK 658
            P+N +++ CTPLIKKIKYD KFE+ IK VFG+T+VVK L  G  LAK+++LNAITLDGD+
Sbjct: 657  PNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDR 716

Query: 659  ADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDK 718
            ADS+GVL+GG+ D +K  RLD++RD K  K+E +  + +L+E+K+ L SI+QEID LN+ 
Sbjct: 717  ADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNV 776

Query: 719  IKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMY 778
            +K + + R+     +E    +L+    ++  +++++  L ++  K     +  +++ + +
Sbjct: 777  VKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAF 836

Query: 779  TEDLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELDSKLK 838
              D+S+                I+  +   E  LN     L+ +  K+D L AEL+SKL 
Sbjct: 837  AADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLL 896

Query: 839  PQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSR 898
            P+  ELE +P+   S   I  +   ++ V  E++T+   K  V++E+  +   I +L+  
Sbjct: 897  PKLHELERKPSSSHSL-QISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGE 955

Query: 899  QEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLLPDDS 958
            +   +K L+KANSQQR+L+K++ N+QK AEK +L+K TL++R++ELQQ IR++GLL ++S
Sbjct: 956  KATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEES 1015

Query: 959  ADKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKES 1018
              KY  +               +SKMTNVNKRA EN+ +F+DK+ ++  RA+ELDESK+S
Sbjct: 1016 LKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQS 1075

Query: 1019 IEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXXXXXX 1078
            IE LID+LK+QK+ A+E TF KV++NF+++F  +VPRG GKL+I+ R+N           
Sbjct: 1076 IENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKR 1135

Query: 1079 XXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIAL 1138
                 + ++                Y+GVSI+VSFNSKKDEQ+ VEQLSGGQKTVCAIAL
Sbjct: 1136 RRGARQEQN-------SAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIAL 1188

Query: 1139 ILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFY 1198
            ILAIQMVDPAPFYLFDEIDAALDKQYR AVA T+K LS  AQFICTTFR DMI VAD F+
Sbjct: 1189 ILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFF 1248

Query: 1199 RVNFENKIST 1208
            RV FENK+ST
Sbjct: 1249 RVKFENKVST 1258

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1223 (47%), Positives = 838/1223 (68%), Gaps = 41/1223 (3%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
            MYIK+VII+GFKTY+N+T I +FSPHHNVV+G NGSGKSNFFAA+RFVLSDDY+NLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 61   RRSLIYQGT-SSVMSGYVEIVFHGAENRTL--LGAQDGGV---IHIRRTVGLKKDEYMIN 114
            R+ LI+QG  +SVMS  VEIVFH  E+  +   G    G    + IRRTVGLKKD+Y +N
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 115  NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKL 174
            ++N ++ D+ R+LESAGF  SNPYNIVPQGRIVSLTNA+++ERLQLLEEV+GAKSFE KL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 175  KESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDREL 234
            K S+++M+ TE+ R +I  E+EE+E+KLNE+++ERKELEKYNSL+R RK+ ++ L+DREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 235  NEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQA 294
             ++ S +E LDG+Y +TL  S++YI ELEKRE++I+ + + +  L   LK+K + DL+QA
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 295  K---DSELELAKHLADLNVK-YEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARL 350
            K   +  LE ++ +  L +K  +E I QN   KEQ  ++ ++L  I   I  K+ +  ++
Sbjct: 301  KAILEESLERSEAIK-LQLKDIKEKIKQN---KEQHDNDRKNLKLITEIIDSKKSKRRKI 356

Query: 351  SPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQ 410
            SPRF+QL  EE  +K   K   ++Q + L K+G Y++F++K ERD WI+ ++  L E + 
Sbjct: 357  SPRFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESIN 416

Query: 411  CSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFK 470
                + T + E++ S+ +K+   ++ I EL DS +GPGI AE+ED+++EL  L++ +   
Sbjct: 417  TMKASTTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTAN 476

Query: 471  IDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGS 530
            ID RK+ WR EQK+Q + +SLV++VK  E +L+ETM RSLA G KNV EI +RLNL   S
Sbjct: 477  IDARKEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTES 536

Query: 531  VFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNR 590
            VFG +GELI+++EKYK CAEV+GG SLFHVVVDT+ TA++LM EL+  KGGRVTF+PLN+
Sbjct: 537  VFGTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNK 596

Query: 591  V-HVDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRL 649
            + + + NI YPS+    CTPLIKKIKYD +F+  +K VFG+ +VVKDL  G  ++KQ++L
Sbjct: 597  LKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKL 656

Query: 650  NAITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSID 709
            + ITLDGD+ D +GVLTGG+ +  K+ RL+ ++ +   K++     ++L E+K +L  +D
Sbjct: 657  SCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMD 716

Query: 710  QEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQK 769
             +ID  N  I+  M+R+E + + +     KL   + E   L++    +  K +   +N  
Sbjct: 717  NDIDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLG 776

Query: 770  LLQDKLDMYTEDLSRXXXXXXXXXXXXXXXXIAKKLPDLENLLNTTTDALSSVVVKIDSL 829
            +  +KL     DL++                ++K++ + +N LN T++ LS + V+ID++
Sbjct: 777  VSGEKLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTI 836

Query: 830  KAELDSKLKPQAKELE----DQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEV 885
             AEL+SKL PQ  +++    D  + I+    + + +    A E + +  +++++     +
Sbjct: 837  TAELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRA-----L 891

Query: 886  QKISEIIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQ 945
            Q I + I++ K+    +E+ LEKAN+QQR LLKKLD YQK+ +K+M++K TL+TR+ E++
Sbjct: 892  QSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIE 951

Query: 946  QKIRDIGLLPDDSADKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDV 1005
            QKIR++G++ +D+ DK+  +            N +IS M N+NKRA EN+KKF++KQ ++
Sbjct: 952  QKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSEL 1011

Query: 1006 MKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRR 1065
             +RA ELD+SK+SI+ LI KLK+QK+ AV+ TF KVS+NF  +FEK+VPRGT  L IHR 
Sbjct: 1012 RERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI 1071

Query: 1066 ENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQ 1125
              +                T                  Y GVSI VSFNSK+DEQ+ VEQ
Sbjct: 1072 NLQGTDDNSELFTQSNEHTTP-----------------YEGVSISVSFNSKQDEQLKVEQ 1114

Query: 1126 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTT 1185
            LSGGQKTVCAIALILAIQMV+PAPFYLFDEIDAALDKQYR AVA T+ QLS+ AQFICTT
Sbjct: 1115 LSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTT 1174

Query: 1186 FRGDMIAVADRFYRVNFENKIST 1208
            FR DM+  A++FYRV +ENK S+
Sbjct: 1175 FRSDMVDAANKFYRVKYENKQSS 1197

>Kwal_55.20421
          Length = 1170

 Score =  187 bits (475), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 303/1291 (23%), Positives = 557/1291 (43%), Gaps = 210/1291 (16%)

Query: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
            M ++++II GFK+Y  +T I N+ P  N + G NGSGKSN   AI FVL     + ++  
Sbjct: 1    MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 60   ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGL-KKDEYMINNK 116
              + LIY+ G + V    V IVF  ++ N + +G +    I + R + L    +Y+IN  
Sbjct: 61   NLQDLIYKRGQAGVTKASVTIVFANSDKNNSPIGFESYPKISVTRQIVLGGTSKYLINGH 120

Query: 117  NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
             A +  V  L +S   + +NP  ++ QG+I  + N +  E L L+EE  G K FE + ++
Sbjct: 121  RAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTKMFEDRREK 180

Query: 177  SLQKMETTEKNREKIRIEL-EEVEAKLNELDEERK----------ELEK---------YN 216
            + + M   E   ++IR  L EEVE KLN+L  E++          +LE          ++
Sbjct: 181  AERTMNKKETKLQEIRSLLQEEVEPKLNKLRNEKRAFLDFQETQSDLENTSKIVNAFVFS 240

Query: 217  SLDRKRKMCQFALYDRE--LNEVTSMVEKLDGEYTNTL----VLSEQYIQE------LEK 264
            SL +KRK  + A  + E  ++E+T+ V++   E TN       +  Q   E      L K
Sbjct: 241  SLVQKRKNIENAFQNSESRISELTASVQQTKVELTNLEEDLDTIRTQKRNEMRKDGALSK 300

Query: 265  RESLIETLTKSLNQLGSELKMK-ESTDLQQAKDSELELAKHLADLNVKYEELISQNNALK 323
             E+L   L   +++L + L +  E+ + +  K   LE +      +++ +  IS+N    
Sbjct: 301  LEALETQLINEVSRLKTSLSLTIENINQENGKRESLERSIRGIQTSLQEKSAISKN---A 357

Query: 324  EQSASNSESLLA-IRSQIAVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKR 382
            E   +    L+  +  Q+  KE+ L+ L+          +   A+    + R  D    R
Sbjct: 358  ENEYNELHDLVQNLSQQLQTKEELLSTLTTGISSTGATNSGYSAQLSNTKARLND---AR 414

Query: 383  GKYSQFRNKAERDAWIDQELSILKEELQCSSIALT---SISEE-RDSLRIKLTTLDDQIM 438
             +  +F  K          ++ILK+EL  +   +    S+SEE +  + +      D  M
Sbjct: 415  IQVQRFEMK----------INILKKELAANEPKIVDAKSLSEEAKKQVEVTGIQCSDLKM 464

Query: 439  ELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRA 498
             L      P +   L++ +  L    K+ ++ +                +E L   V   
Sbjct: 465  HLEKLGFNPDLFKSLKEEESSL----KSKIYNLSND-------------MEGLRRKVANI 507

Query: 499  EGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLF 558
            +   S+  D+   T +K V+  AQ  +L E        E    +   + CA    G  LF
Sbjct: 508  DFAYSKPSDKFDPTSVKGVA--AQLFSLNE--------ENFSSATALQICA----GGRLF 553

Query: 559  HVVVDTENTAALLMQELYNSKGGRVTFIPLN-----RVHVDSNIVYPSNDEHHCTP---- 609
            +VVV+ E+TA+ L++     K  RVT IPLN     R+H D+      N      P    
Sbjct: 554  NVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDT-----VNFAKQLAPDSVE 606

Query: 610  -LIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGVLT 666
              +  I Y+ +  +A++ +FG +++ +D     K+    + R  +ITL GD  D  G L+
Sbjct: 607  LALNLIGYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGTLS 666

Query: 667  GGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIKKSMSRR 726
            GG  +++    +D  +               L E + KL  + + I + ++ ++K+ +  
Sbjct: 667  GGSRNNNSSILIDIQK--------YNAYSRNLSESEAKLADVTKRIKQYSEVLQKTKN-- 716

Query: 727  EMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDKLDMYTEDLSRXX 786
              +  ++     K   A  ER L     VQL+S+        K +QD++ M  E +    
Sbjct: 717  --LQNELNLATHKFHLA--ERNLANNPSVQLMSR-------NKEIQDEIQMCLESM---- 761

Query: 787  XXXXXXXXXXXXXXIAKKLPDLE-NLLNTTTDALSSVVVKIDSLKAEL-----DSKLKPQ 840
                          +  ++  +E ++L  + D  S    K+D LK E+     D + K  
Sbjct: 762  -----RSGSEDIKKLEAEVASVEKDMLEFSKDKGS----KLDELKREISHIRKDIEEKKI 812

Query: 841  AKELEDQPNEIMSTTAIQNLQEHIDAVEDE-------RKTLLERKSTVDNEVQKISEIID 893
              E++D  N+ +    ++ L   I A  DE        K L ++K +V+ ++++ +  + 
Sbjct: 813  VLEMKDDSNQSLQ-LEMEQLNSDILAARDEFKESVEAAKELEQKKHSVEQKLEETANQLQ 871

Query: 894  TLKSRQEEEEKSLEKANSQQRAL--LKKLDNYQKEAEKSMLRKMTLSTRR---------D 942
              K+   E++K L + + + + L  L +  + Q  +++  L +++  TR+         +
Sbjct: 872  DTKTEFSEQKKKLHEIDDEIKVLTDLLRTKSDQLRSDEVELARLSNETRKLKTNTSSVEE 931

Query: 943  ELQQKIRDIGLLPDDS-----ADKYHNMXXXXXXXXXXXINDKISKM-TNVNKRALENFK 996
            ++   ++D   L D+        +   +           +N+K S +   VN   +   +
Sbjct: 932  QITALLKDEDWLQDEGLVSSIVTQNQGINLEAYRQRADQLNEKFSALRRKVNPNIMSMIE 991

Query: 997  KFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRG 1056
              + K+  +      +++ K  I++ + KL + K E +  T++KV+ +F  +F  ++P  
Sbjct: 992  SVEKKESALKTMISTIEKDKRKIQETVAKLNEYKRETLIKTWEKVTVDFGNIFGDLLPNS 1051

Query: 1057 TGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSK 1116
              KLV                                         +  G+ +++   S 
Sbjct: 1052 FAKLV-----------------------------------PIEGKSVTEGLEVKIRLGSI 1076

Query: 1117 KDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLS 1176
              E +   +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +   +   +K   
Sbjct: 1077 WKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1177 SQAQFICTTFRGDMIAVADRFYRVNFENKIS 1207
              +QFI  + +  M   A+R +R  F++  S
Sbjct: 1135 KGSQFIVVSLKEGMFTNANRVFRTRFQDGTS 1165

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
           complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score =  174 bits (441), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 205/773 (26%), Positives = 360/773 (46%), Gaps = 111/773 (14%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I  + P  N + G NGSGKSN   +I FVL       ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGL-KKDEYMINNK 116
             + LIY+ G + V+   V IVF  ++ + +  G +    I + R + L    +Y+IN  
Sbjct: 61  NLQDLIYKRGQAGVIKASVTIVFDNSDPSSSPFGFETYPKISVTRQIILGGTSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
            A +  V  L +S   + +NP  ++ QG+I  + N +  E L L+EE  G + FE + ++
Sbjct: 121 RAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMFEDRREK 180

Query: 177 SLQKMETTEKNREKIR-IELEEVEAKLNELDEERKELEKY----NSLDRKRKMCQFALYD 231
           + + M   E   ++IR + LEE+E KLN L  E++   ++      L++  ++     Y 
Sbjct: 181 AEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLEKTSRIVNTYDYQ 240

Query: 232 RELNEVTSMVEKLDGEYTNTLVLSEQYIQEL----EKRESLIETLTKSLNQL--GSELKM 285
             + + +SM E+L  +        ++ I++L    EK    I TLT+    +    E ++
Sbjct: 241 TLVQKRSSMQERLQSD--------QKRIKDLEFSVEKYRDEISTLTEDFESIRRQKEKQL 292

Query: 286 KESTDLQ--QAKDSEL--ELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIA 341
           ++ T LQ  +AK++ L  EL++  A L +  ++L           A    +L A+   IA
Sbjct: 293 QKDTTLQTLEAKENSLSTELSRVTAALGITRDDL-----------ADEQRNLSALNLSIA 341

Query: 342 VKEQQLARLSPRFEQLTIEEAAMKAE---FKALQQRQRDLLA-----------KRGKYSQ 387
             EQ+L  LS  + +   E   + AE    K + + + +LL+             G Y+ 
Sbjct: 342 KSEQELTSLSKTYSETENEYVVLNAEIEKLKTICRNKEELLSTLTTGISSTGTTEGGYTA 401

Query: 388 FRNKAE---RDAWI-----DQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIME 439
             N A+    +A I     +  +++L++EL  +   L    +E +  R +L+        
Sbjct: 402 QLNNAKLQLNEAQIAVKKVEMRITMLRKELATNEPLLERAKKENEVKRAELS-------- 453

Query: 440 LNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRAE 499
             + +H       +E +Q+ LT    A  FK +  KQL + E ++++ L ++  D     
Sbjct: 454 -ENKSH-------VERLQESLT----ASGFKPELLKQLKQKEAELKTELYAISTD----- 496

Query: 500 GTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACA---EVVGGTS 556
              +E + R +A    + S  ++  N P+ SV G   ++  +SE+    A   +V  G  
Sbjct: 497 ---AEYLKRKVANLEFSYSPPSKEFN-PK-SVKGIAAQVFTLSEENFDSANALQVCAGGR 551

Query: 557 LFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSNDEHHCTP-----LI 611
           LF+V+VD E TA+ L++     K  RVT IPLN++          N      P      +
Sbjct: 552 LFNVIVDNEKTASQLLERGRLRK--RVTIIPLNKISARVINTDALNKAKSLAPGAVELAL 609

Query: 612 KKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGVLTGGF 669
             I Y+ +  RA++ +FG +++ +D     K+    Q R  +ITLDGD  D  G L+GG 
Sbjct: 610 NLIGYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEGTLSGGS 669

Query: 670 HDHHK------QKRLDSMRDLKSLKKE---QQGNKSQLEEVKEKLHSIDQEID 713
             H        QK  ++ + +  L+KE    Q N S+ E       S+  E++
Sbjct: 670 RSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHENASRMTKSLQNELN 722

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 103/221 (46%), Gaps = 37/221 (16%)

Query: 987  VNKRALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFT 1046
            VN   +   +  + K+  +    K +++ K  I + I+KL + K +A+  T++KV+ +F 
Sbjct: 982  VNPNIMSMIENVEKKEAALRTMIKTIEKDKMKIVETIEKLNEYKRDALVKTWEKVNVDFG 1041

Query: 1047 QLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSG 1106
             +F +++P    KL                       E +DV                +G
Sbjct: 1042 NIFAELLPNSFAKLA--------------------AIEGKDVT---------------AG 1066

Query: 1107 VSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRT 1166
            + ++V   +   E +   +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +  
Sbjct: 1067 LEVKVKLGTLWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQ 1124

Query: 1167 AVAATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFENKIS 1207
             +   +K     +QFI  + +  M   A+R ++  F++  S
Sbjct: 1125 NIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFKTRFQDGTS 1165

>Scas_565.6
          Length = 1170

 Score =  161 bits (407), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 188/711 (26%), Positives = 322/711 (45%), Gaps = 86/711 (12%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I ++ P  N + G NGSGKSN   AI FVL     T ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGLK-KDEYMINNK 116
             + LIY+ G + V    V IVF  ++   + +G  +   I + R + L    +Y+IN  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
            A +  V +L +S   + +NP  ++ QG+I  + N +  E L L+EE  G K FE + ++
Sbjct: 121 RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAAGTKMFENRREK 180

Query: 177 SLQKMETTEKNREKIRIEL-EEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELN 235
           + + M   E   ++ R  L EE+E KL +L  E            KR   +F     +  
Sbjct: 181 AERTMAKKETKLQESRTLLEEEIEPKLEKLRNE------------KRMFLEFQTTQADFE 228

Query: 236 EVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQA- 294
           +   +V   D  Y N +         LE  E+ +  L   + +   E+    + DL+Q  
Sbjct: 229 KTMKVVHAFD--YKNMINRHASVKDVLESSEARMAELKGLILRTAEEIG-SLNEDLEQVK 285

Query: 295 --KDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSP 352
             K+ EL+    L+ L  +  EL+++ + +K      S S+      I    +Q+ +L  
Sbjct: 286 IQKEKELDKDATLSRLEKEESELLNEVSRIK-----TSHSI--CNDNIKENNKQVEKLKS 338

Query: 353 RFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAER---------------DAW 397
             EQ  +        F++ ++  +++ A   K  +  +K E                D  
Sbjct: 339 DIEQFKLTLKEKSETFESTEKEYQEINASLAKIKETYSKKEELLSTLLTGITSTGDTDGG 398

Query: 398 IDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQ 457
              +L+I K +L  + +++  +S   D L  +L     ++ +           A++E+ +
Sbjct: 399 YSAQLTIAKNKLNDTEVSIKKLSMRIDILNKELVNNQPKLQQ-----------AKIENEK 447

Query: 458 QELTVLKKAHLFKIDERKQLWRS------EQKIQSVLESLVDDVKRAEGTLSETMDRSLA 511
               V K  H+  +D  +QL +S       +++++   SL  ++ R E T +E + R +A
Sbjct: 448 IRGNVEKHKHVC-LDLEQQLSKSGFDPLRTKELKTRENSLRQEIHRVE-TQNENLKRRVA 505

Query: 512 TGL----KNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACA---EVVGGTSLFHVVVDT 564
            GL     N SE     N    SV G   +L  +++ +   A   +V  G  L++VVVD 
Sbjct: 506 -GLDFNYTNPSE-----NFDARSVKGVAAQLFTLNKDHFDAASALQVCAGGRLYNVVVDN 559

Query: 565 ENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSNDEHHCTP-----LIKKIKYDPK 619
           E TA+LL+++    K  RVT IPLN++   +             P      +  I YD +
Sbjct: 560 EKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGKVELALNLIGYDDE 617

Query: 620 FERAIKHVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGVLTGG 668
             RA++ +FG ++V +D N   K+    Q R  +ITLDGD  D  G L+GG
Sbjct: 618 VSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEGTLSGG 668

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 113/249 (45%), Gaps = 57/249 (22%)

Query: 960  DKYHNMXXXXXXXXXXXINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDESKESI 1019
            +K+H M           IN  I  M       +EN +K +   K VM R  E D+ K  I
Sbjct: 973  EKFHEMRRK--------INPNIMSM-------IENVEKKESALK-VMIRTIEKDKVK--I 1014

Query: 1020 EKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXX 1079
            ++ I KL + K + +  T++KV+E+F  +F  ++P    KLV                  
Sbjct: 1015 QETISKLNEYKRDTLIKTWEKVTEDFGHIFADLLPNSFAKLV------------------ 1056

Query: 1080 XXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSF-NSKKDEQVHVEQLSGGQKTVCAIAL 1138
                E +DV                 G+ + V   N  KD  V   +LSGGQ+++ A++L
Sbjct: 1057 --PSEGKDV---------------TEGLEVRVKLGNLWKDSLV---ELSGGQRSLVALSL 1096

Query: 1139 ILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFY 1198
            I+A+    PAP Y+ DE+DAALD  +   +   +K     +QFI  + +  M + A+R +
Sbjct: 1097 IMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFSNANRVF 1156

Query: 1199 RVNFENKIS 1207
            R  F+N  S
Sbjct: 1157 RTRFQNGTS 1165

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
           condensin protein complex required for chromosome
           condensation and segregation, coiled-coil protein of the
           SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 183/705 (25%), Positives = 325/705 (46%), Gaps = 74/705 (10%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I ++ P  N + G NGSGKSN   AI FVL     + ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGL-KKDEYMINNK 116
             + LIY+ G + V    V IVF   + + + +G  +   I + R V L    +Y+IN  
Sbjct: 61  SLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
            A +  V +L +S   + +NP  ++ QG+I  + N +  E L L+EE  G K FE + ++
Sbjct: 121 RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREK 180

Query: 177 SLQKMETTEKNREKIRIEL-EEVEAKLNELDEERKELEKYNS----LDRKRKMCQFALYD 231
           + + M   E   ++ R  L EE+E KL +L  E++   ++ S    L++  ++     Y 
Sbjct: 181 AERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKTERIVVSYEYY 240

Query: 232 RELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDL 291
              ++ TS+ E L+   T   +L+E   +  E+ +SL E + +   Q   EL  + +   
Sbjct: 241 NIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISK 300

Query: 292 QQAKDSEL--ELAKHLADLNVKYEEL---ISQNNALKEQSASNSESLLAIRSQIAVKEQQ 346
            + K++ L  E+++    L++K E L     ++ AL+ + AS+S  L+  +S  A  E+ 
Sbjct: 301 LENKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKD 360

Query: 347 LARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKY-----SQFRNKAERDAWIDQE 401
              +    EQL+               +QRDL  ++ +      +   +    D   + +
Sbjct: 361 YKMVQ---EQLS---------------KQRDLYKRKEELVSTLTTGISSTGAADGGYNAQ 402

Query: 402 LSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELT 461
           L+  K EL   S+A+   S + + L+ +L T++ +   L ++     +N +     QE  
Sbjct: 403 LAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPK---LKEATKDNELNVKHVKQCQETC 459

Query: 462 VLKKAHL----FKIDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNV 517
              +A L    F     K L + E K++S       +        SE + R +     N 
Sbjct: 460 DKLRARLVEYGFDPSRIKDLKQREDKLKSHYYQTCKN--------SEYLKRRVTNLEFNY 511

Query: 518 SEIAQRLNLPEGSVFGPLGELIKISE---KYKACAEVVGGTSLFHVVVDTENTAALLMQE 574
           ++     N     V G +G+L +I     +Y    +   G  LF+VVV    TA  L++ 
Sbjct: 512 TKPYP--NFEASFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLER 569

Query: 575 LYNSKGGRVTFIPLNRVH---VDSNI------VYPSNDEHHCTPLIKKIKYDPKFERAIK 625
               K  RVT IPL++++   + S +      + P   E      I  I++D    +A++
Sbjct: 570 GRLRK--RVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELA----INLIRFDESITKAME 623

Query: 626 HVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGVLTGG 668
            +FG +++ +D     K+    + R  +ITL GD  D  G L+GG
Sbjct: 624 FIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGG 668

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 102/221 (46%), Gaps = 37/221 (16%)

Query: 987  VNKRALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFT 1046
            VN   +   +  + K+  +    K +++ K  I++ I KL + K E +  T++KV+ +F 
Sbjct: 982  VNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFG 1041

Query: 1047 QLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSG 1106
             +F  ++P    KLV                      E +DV                 G
Sbjct: 1042 NIFADLLPNSFAKLV--------------------PCEGKDVT---------------QG 1066

Query: 1107 VSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRT 1166
            + ++V   +   E +   +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +  
Sbjct: 1067 LEVKVKLGNIWKESLI--ELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQ 1124

Query: 1167 AVAATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFENKIS 1207
             +   +K     +QFI  + +  M A A+R +R  F++  S
Sbjct: 1125 NIGHLIKTRFKGSQFIVVSLKEGMFANANRVFRTRFQDGTS 1165

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
           Saccharomyces cerevisiae YFR031c SMC2 chromosome
           segregation protein, start by similarity
          Length = 1170

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 181/709 (25%), Positives = 325/709 (45%), Gaps = 88/709 (12%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I ++ P  N + G NGSGKSN   AI FVL       ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGLKK-DEYMINNK 116
             + LIY+ G + V    V IVF+ ++ + + +G +    I I R + L    +Y+IN  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFNNSDTSNSPIGFESHAKISITRQIILGGVSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
            A +  V +L +S   + +NP  ++ QG+I  + N + +E L L+EE  G + FE + ++
Sbjct: 121 RAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQEILSLIEEAAGTRMFEDRREK 180

Query: 177 SLQKMETTEKNREKIRIEL-EEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDRELN 235
           + + M   E   ++IR  L EE+E KL     E            KR   +F     +L 
Sbjct: 181 AERTMAKKETKLQEIRTLLTEEIEPKLERFRNE------------KRTYLEFQETQSDLE 228

Query: 236 EVTSMVEKLDGEYTNTLVLSEQYIQE--------LEKRESLIETLTKSLNQLGSELKMKE 287
            V  +V     E++  L   +++I+E        LE+ E  I  L   +  LGS+L    
Sbjct: 229 NVMRVVNAF--EFSQ-LSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLGSDLDA-- 283

Query: 288 STDLQQAKDSELELAKHLADLNVKYEEL--------ISQNNALKEQSASNSESLLAIRSQ 339
              L++ +  E++L   +++L  K  E+         S N AL E S      +  ++  
Sbjct: 284 ---LKEQRHKEVQLGGRMSELETKESEISNELSRVQTSLNIAL-EDSGEEKVRISNLKKN 339

Query: 340 IAVKEQQLAR----LSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERD 395
           I   +QQ          ++++  I+   ++ E KA+ + +++LL+               
Sbjct: 340 IERWKQQHQEKKTLYDSKYKEYNIQNKKLE-ELKAIHKEKQELLSTLTTGISSTGTTANG 398

Query: 396 AWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELED 455
              + +LS +KE+LQ + I +     E + L+ +L +   +I             AE E 
Sbjct: 399 --YNFQLSTIKEKLQNTRIEIREKEMEVEMLKEELNSNTPKI---------SAAKAEKEK 447

Query: 456 VQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLK 515
             +E+  ++  H   ++++ + +  +  +   L+     +K     LS+  + SL   + 
Sbjct: 448 YDKEIQNMQH-HCNNLEKQLEQYGYDPILLKNLKDNERSLKHTHYQLSQETE-SLHRKVS 505

Query: 516 NV--SEIAQRLNLPEGSVFGPLGELIKISEK---YKACAEVVGGTSLFHVVVDTENTAAL 570
           N+  + +    N    SV G +G+L  + E      A  +V  G  LF+VVVD E TA+ 
Sbjct: 506 NLDFNYVPPSKNFDVSSVKGVVGQLFTLDEANIDSSAALQVCAGGRLFNVVVDNERTASQ 565

Query: 571 LMQELYNSKGGRVTFIPLNRV---HVDSNIVYPSNDEHHCTP-----LIKKIKYDPKFER 622
           L++  +     RVT IPLN++    ++ +I++ + +     P      I  I ++ +  R
Sbjct: 566 LLE--HGRLRKRVTIIPLNKISSRRINESILHLAKE---LAPGKVELAINLIGFEEEVTR 620

Query: 623 AIKHVFGKTIVVKDLNQGTKLAKQFRLN------AITLDGDKADSRGVL 665
           A++ +FG + + +D     + AKQ   N      +ITL GD  D  G L
Sbjct: 621 AMEFIFGTSFICRD----AETAKQITFNPRIRSRSITLQGDVYDPEGTL 665

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 102/221 (46%), Gaps = 37/221 (16%)

Query: 987  VNKRALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFT 1046
            VN   +   +  + K+  +    K +++ K+ I++ I+KL + K E +  T++KVS +F 
Sbjct: 982  VNPEVMSMIESVEKKETALKTMIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFG 1041

Query: 1047 QLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSG 1106
             +F  ++P    KL                       E +DV                 G
Sbjct: 1042 NIFGDLLPNSFAKL--------------------EPSEGKDV---------------TEG 1066

Query: 1107 VSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRT 1166
            + ++V       E + VE LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +  
Sbjct: 1067 LEVKVKLGKIWKESL-VE-LSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQ 1124

Query: 1167 AVAATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFENKIS 1207
             +   +K     +QFI  + +  M   A+R +R  F++  S
Sbjct: 1125 NIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTS 1165

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
           cerevisiae YFR031c SMC2 chromosome segregation protein,
           start by similarity
          Length = 1170

 Score =  145 bits (365), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 194/746 (26%), Positives = 337/746 (45%), Gaps = 113/746 (15%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I ++ P  N + G NGSGKSN   AI FVL       ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGL-KKDEYMINNK 116
             + LIY+ G + V    V IVF   + + T +G  +   I + R + L    +Y+IN  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFE---RK 173
            A +  V +L +S   + +NP  ++ QG+I  + N +  E L L+EE  G K FE    K
Sbjct: 121 RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILSLIEEAAGTKMFEDRKEK 180

Query: 174 LKESLQKMETT-EKNREKIRIELEEVEAKLNELDEERKELEKYNS----LDRKRKMCQFA 228
            + ++QK ET  ++NR  ++   EE++ +L +L  E++   ++ +    L+   K+    
Sbjct: 181 AERTMQKKETKLQENRTLLK---EEIDPQLEKLRNEKRLFLEFQTIQADLETTEKVVIAT 237

Query: 229 LYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKES 288
            Y + LN   S+           L  S   + EL+K+  L+     +LN+          
Sbjct: 238 DYQKMLNSRDSI--------KTVLETSNSKMDELQKKIDLVNREISNLNE---------- 279

Query: 289 TDLQQA---KDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQ 345
            DLQQ    K  ELE   ++  +  K ++L+S+   LK     N +++L  +       Q
Sbjct: 280 -DLQQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNILDGK-------Q 331

Query: 346 QLARLSPRFE---QLTIEEAAMKAEFKALQQRQRDLLAKRGKY-SQFRNKAERDAWIDQE 401
           +  RL+ + E   QL   ++ +  + K+   + R+  A   +  S F+ K E  + +   
Sbjct: 332 KQKRLTVKIEKSKQLLDSKSQLLEDSKS---KSRNCEADLTRLNSIFKQKEELLSVLSTG 388

Query: 402 LSILKE-----ELQCSS----IALTSISEERDSLRIKLTTLDDQIMELNDSAHGPG---I 449
           +S         E Q SS    I   SI  E++ ++I+L  L  + ME N+   G     +
Sbjct: 389 ISSTGGTEGGYEAQISSVNDKINDNSIEIEKNKMKIEL--LKKEFME-NEEKIGKSQLQV 445

Query: 450 NAELEDVQQELTVLKK------AHLFKIDERKQLWRSEQKIQSVL-------ESLVDDVK 496
              +++ +Q   + KK      +H F+ +  K+L   E ++   +       E L   V 
Sbjct: 446 ETHMKERKQLTEICKKLEEDIFSHGFRPEAFKELKNREYELDQAIYKTNRDCEGLRRRVA 505

Query: 497 RAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTS 556
             E   S+  +      +K V+  A+  ++PE ++            KY    ++  G  
Sbjct: 506 GIEFQYSKPFESFDPNSVKGVT--AELFSIPEQNM------------KYVIGLQICAGGR 551

Query: 557 LFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSNDE-----HHCTP-- 609
           L++V+VD E T + L+Q+    K  RVT IPL++V     I  P N           P  
Sbjct: 552 LYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKV-----ISRPLNQNKLKLAKQLAPGK 604

Query: 610 ---LIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGV 664
               +  I Y  +  +A++ +FG +++  D     K+      R  +ITL+GD  D  G 
Sbjct: 605 VELALNLIGYSDEVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEGT 664

Query: 665 LTGGFHDHHKQKRLDSMRDLKSLKKE 690
           L+GG  ++     +D ++   +LKKE
Sbjct: 665 LSGGTRNNTNTLLVD-IQQYNTLKKE 689

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 37/196 (18%)

Query: 1012 LDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEXXX 1071
            +++ K+ IE  I KL + K E +  T+KKV+++F  +F  ++P  + KLV          
Sbjct: 1007 IEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLLPNSSAKLV---------- 1056

Query: 1072 XXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYSGVSIEVSFNSKKDEQVHVEQLSGGQK 1131
                        E +D               I  G+ ++V   +   E +   +LSGGQ+
Sbjct: 1057 ----------PCEGKD---------------ITEGLEVKVKLGNLWKESLV--ELSGGQR 1089

Query: 1132 TVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMI 1191
            ++ A++LI+A+    PAP Y+ DE+DAALD  +   +   +K     +QFI  + +  M 
Sbjct: 1090 SLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMF 1149

Query: 1192 AVADRFYRVNFENKIS 1207
              A+R +R  F++  S
Sbjct: 1150 TNANRVFRTRFQDGTS 1165

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 115/215 (53%), Gaps = 5/215 (2%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLS-DDYTNLKRE 59
           M ++++II GFK+Y  +T I N+ P  N + G NGSGKSN   +I FVL       ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 60  ERRSLIYQ-GTSSVMSGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTVGLK-KDEYMINNK 116
             + LIY+ G + V    V IVF   + + + +G +    I + R + L    +Y+IN  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNTDKSSSPIGFESYPKISVTRQIILGGTSKYLINGH 120

Query: 117 NASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKE 176
            A +  V  L +S   + +NP  ++ QG+I  + N +  E L L+EE  G + FE + ++
Sbjct: 121 RAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTRMFEDRREK 180

Query: 177 SLQKMETTEKNREKIRIEL-EEVEAKLNELDEERK 210
           + + M   E   ++IR  L EE+E KL +L  +++
Sbjct: 181 AEKTMAKKETKLQEIRTLLEEEIEPKLEKLRNQKR 215

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
           cerevisiae YLR086w Stable Maintenance of Chromosomes,
           start by similarity
          Length = 1398

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 177/780 (22%), Positives = 356/780 (45%), Gaps = 87/780 (11%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
           ++I ++++  FK+Y  +  I  F    + +VG NGSGKSN   ++ FV       ++++ 
Sbjct: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187

Query: 61  RRSLIYQGTS--SVMSGYVEIVFHGA----ENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114
              LI++  +   + S  VE+ F       +  T +    G ++  R+       +Y +N
Sbjct: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247

Query: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167
            K ++ ++V  LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307

Query: 168 KSFERKLKESLQKMETTEKNREKIRIELEE----VEAKLNELDEERKELEKYNSLDRKRK 223
                K KES++K+    ++  +I +E E     VE + N L+  ++E  ++ + +++  
Sbjct: 308 S----KYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELV 363

Query: 224 MCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRE--SLIETLTKSLNQLGS 281
           + +  LY   L +    ++ +  + TN  V  EQ  QE E R+  S I  +T SLN L +
Sbjct: 364 LEKSKLYQYNLMQDNKKLDDVLNKKTN--VQQEQTKQEDEFRKANSHISDITASLNVLKA 421

Query: 282 ELK--MKESTDLQQAK----DSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLA 335
           +L+    E  +L + K    + ++E  + + +L+ K +E   Q+  L+++  S  + +  
Sbjct: 422 DLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQT 481

Query: 336 IRSQIAVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERD 395
           I  + +   +    LS     L IE+  ++     L+++   L  +  +Y +     E  
Sbjct: 482 IIEEQSSLAEGTTVLST---NLDIEKEKLENIKLKLREKTEHLTIQIAEYEK-----ELS 533

Query: 396 AWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELED 455
            W +Q    LK+E++ +   L+ I E R  L   +  L++ I+             +LE 
Sbjct: 534 PWNEQSQQ-LKKEIKITESELSIIEENRKGLENDIAGLENAIL---------SQKRDLEV 583

Query: 456 VQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVK---------RAEGTLSETM 506
            +QE+  L +     I ER+   R  +  Q+ L ++ + V+         R+  + +E  
Sbjct: 584 QEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENN 643

Query: 507 DRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTEN 566
           ++ L+  L+   + + RLN       G LG+L  I  KY   A       L  +VVDT  
Sbjct: 644 NKVLSALLR--LQKSGRLN----GFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVE 696

Query: 567 TAALLMQELYNSKGGRVTFIPLNRVHV-DSNIVYPSNDEHHCTPLIKKIKYDPKFERAIK 625
           +    ++ L  +K G   FI L++++  ++N +   +       LI  +K + +F  A  
Sbjct: 697 SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLI-TVK-EKRFNNAFY 754

Query: 626 HVFGKTIVVKDLNQGTKLA---KQFRLNAITLDGDKADSRGVLTGGFHDHHK-------- 674
            V   T+V +++ Q  ++A   K++R+  +TLDG+  D  G +TGG  +  K        
Sbjct: 755 SVLRDTLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGGGRNVSKGLMKLSKS 812

Query: 675 ---QKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDK---IKKSMSRREM 728
                   S  ++++++ E    ++Q +   +  H +++E+  L D+   I   +S++EM
Sbjct: 813 SSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEM 872

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1299 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1358

Query: 1182 ICTTFRGDMI 1191
            I  + R +M 
Sbjct: 1359 IVISLRNNMF 1368

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
           protein complex required for proper chromosome
           condensation and segregation, coiled-coil protein of the
           SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 167/723 (23%), Positives = 317/723 (43%), Gaps = 107/723 (14%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
           ++I ++++  FK+Y  K  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213

Query: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114
              LI++        S  ++ + + V   +   + +  +  G+I  R+       +Y IN
Sbjct: 214 LSDLIHKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYIN 273

Query: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167
            K +S ++V +LL++ G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 274 EKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333

Query: 168 KSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQF 227
            +++  ++E + ++E                   LNE+      LEK N         +F
Sbjct: 334 ANYKPLIEERMGQIEN------------------LNEVC-----LEKEN---------RF 361

Query: 228 ALYDRELNEVTS----MVEKLDGEYTNTLVLSEQY----IQELEKRESLIETLTKSLNQL 279
            + DRE N + S     +E L+ E   TL+ S+ +    +Q   K  S +E ++ S   L
Sbjct: 362 EIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDL 421

Query: 280 GSE-LKMKES-TDLQQAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIR 337
             E +K +ES   + + K    E+   ++  + K + L+ +   L+    S  E    + 
Sbjct: 422 EDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNLV 481

Query: 338 SQIAVKEQQL-------ARLSPRFEQLTIEEAAMKAEFKALQQ---RQRDLL-------- 379
           S++   E+ L       +      E+L  ++   + E K L Q   ++R +L        
Sbjct: 482 SKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLK 541

Query: 380 --AKRGKYSQFRNKAERDAWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQI 437
              K       R++ E + W D +L   + ++Q +   L+ + E +  L+  + TL+++I
Sbjct: 542 DKTKNISAEIIRHEKELEPW-DLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 438 MELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSE-------QKIQSVLES 490
             L    H   +   + D++++L  LK       DER Q  ++        +++Q VL +
Sbjct: 601 --LAKKTHKQELQDLILDLKKKLNSLK-------DERSQGEKNFTSAHLKLKEMQKVLNA 651

Query: 491 LVDDVKRAEGTLSETMDRS-LATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACA 549
                  A  +LS+  ++S + T L  + + + R+N       G LG+L  I + +   A
Sbjct: 652 HRQRAMEARSSLSKAQNKSKVLTALSRLQK-SGRIN----GFHGRLGDLGVIDDSFD-VA 705

Query: 550 EVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSNDEHHCTP 609
                  L  VVVDT   A   +  L  +K G   FI L+R+   +  + P +   +   
Sbjct: 706 ISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFN--LQPISTPENVPR 763

Query: 610 LIKKIKY-DPKFERAIKHVFGKTIVVKDLNQGTKLA---KQFRLNAITLDGDKADSRGVL 665
           L   +K  +PKF  A   V   T+V ++L Q   +A   K+FR+  +T+DG   D  G +
Sbjct: 764 LFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRV--VTVDGKLIDISGTM 821

Query: 666 TGG 668
           +GG
Sbjct: 822 SGG 824

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1319 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1378

Query: 1182 ICTTFRGDMIAVADRFYRV 1200
            I  + R +M  +A +   V
Sbjct: 1379 IVISLRNNMFELAQQLVGV 1397

>Kwal_56.23825
          Length = 1396

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 175/764 (22%), Positives = 321/764 (42%), Gaps = 110/764 (14%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
           + I ++++  FK+Y     +  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186

Query: 61  RRSLIYQGT--SSVMSGYVEIVFHGAENR----TLLGAQDGGVIHIRRTVGLKKDEYMIN 114
              LI++      + S +V+I F   ++     T +  Q   ++  R+       +Y +N
Sbjct: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLN 246

Query: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167
            K +S + + +LL   G    +   ++ QG + S+   + +         L+ LE++IG 
Sbjct: 247 GKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGT 306

Query: 168 KSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKE----LEKYNSLDRKR- 222
             ++  ++ +L ++       E+     E VE + + L++ + E    LEK  +L   R 
Sbjct: 307 AQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRS 366

Query: 223 KMCQFALYDRE--LNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLG 280
           K+ Q+ L+  E  LN     + K   + +       ++ +E+   ++ +++L   L  LG
Sbjct: 367 KLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLG 426

Query: 281 SELKMKESTDLQQAKDSELELAKHLADLN-VKYEELISQNNALKEQSASNSESLLAIRSQ 339
              K             +L L K   D + V  EE +     L ++   +S SL +I S 
Sbjct: 427 ESEK-------------KLTLEKRACDRDRVSLEEKLKN---LTQKEVKSSRSLQSITSS 470

Query: 340 IAVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWID 399
           I+              Q  +EE A   E     Q ++DLL   G   + + K      +D
Sbjct: 471 ISTT------------QAKMEELANDQE-----QHEKDLLELNGTMKEEKEK------LD 507

Query: 400 QELSILKEELQCSSIALTSISEERDSLRIKL------TTLDDQIMELNDSAHGP------ 447
           +  S LK+++   S  +  I +E +   +KL        L++  + +   +H        
Sbjct: 508 EIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDII 567

Query: 448 GINAELEDVQQELTVLKKAHLFKID-ERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETM 506
            +N  +++++ ++   ++  +F ++ E+  + R     QS  ++ V  +K  +G L+   
Sbjct: 568 LVNKGIDELRNKMNE-QRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHR 626

Query: 507 DR------SLATGLKNVSEIAQRLNLPE----GSVFGPLGELIKISEKYKACAEVVGGTS 556
            R      SL+T       +A  L L          G LG+L  I +KY   A       
Sbjct: 627 QRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYD-VAISTACPR 685

Query: 557 LFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVD--SNIVYPSNDEHHCTPLIKKI 614
           L  +VV+T       ++ L  +K G   FI L+++     S I  P N      P +  +
Sbjct: 686 LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPEN-----VPRLYDL 740

Query: 615 --KYDPKFERAIKHVFGKTIVVKDLNQGTKLA--KQFRLNAITLDGDKADSRGVLTGGFH 670
               +PKF  A   V   T+V KDL +  K+A  KQ R   +TLDG   D  G ++GG  
Sbjct: 741 VRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGG-- 797

Query: 671 DHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDE 714
                    + +    +K EQQ N +      E++  ID+E+ E
Sbjct: 798 --------GNFKARGMMKSEQQSNSAF---TAEEVQQIDKELSE 830

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 53/84 (63%), Gaps = 1/84 (1%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356

Query: 1182 ICTTFRGDMIAVADRFYRVNFENK 1205
            I  + R +M  +A +   V ++NK
Sbjct: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
           cerevisiae YLR086w SMC4 Stable Maintenance of
           Chromosomes, start by similarity
          Length = 1372

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 98/198 (49%), Gaps = 17/198 (8%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
           + I K+++  FK+Y    EI  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182

Query: 61  RRSLIYQGT--SSVMSGYVEIVFH------GAENRTLLGAQDGGVIHIRRTVGLKKDEYM 112
              LI++     S+ S  V+I FH        E + L  A  G ++  RR       +Y 
Sbjct: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA--GTMVVERRAFKNNSSKYY 240

Query: 113 INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVI 165
           +N K ++ ++V RLL+  G    +   ++ QG + S+   + +         L+ LE++I
Sbjct: 241 VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII 300

Query: 166 GAKSFERKLKESLQKMET 183
           G   F+ ++++ L+++ET
Sbjct: 301 GTAKFKPQIEKCLEEIET 318

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1273 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1332

Query: 1182 ICTTFRGDMIAVADRFYRVNFENKIS 1207
            I  + R +M  +A     +   N ++
Sbjct: 1333 IVISLRNNMFELAQNLVGIYKNNNMT 1358

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..905555)
            [4113 bp, 1370 aa]
          Length = 1370

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330

Query: 1182 ICTTFRGDMIAVADRFYRV 1200
            I  + R +M  +A R   +
Sbjct: 1331 IVISLRNNMFELAQRLVGI 1349

>Scas_681.4
          Length = 1409

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1306 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1365

Query: 1182 ICTTFRGDMIAVADRFYRV 1200
            I  + R +M  +A +   +
Sbjct: 1366 IVISLRNNMFELAQQLVGI 1384

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 155/334 (46%), Gaps = 43/334 (12%)

Query: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60
           ++I K+ +  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208

Query: 61  RRSLIYQGT--SSVMSGYVEIVFHGA----ENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114
              LI++      + S  V++ F  A    +  T +      ++  R+       +Y IN
Sbjct: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYIN 268

Query: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167
            K ++ +DV +LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 269 GKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 328

Query: 168 KSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLD-------- 219
             +++ +++ L ++E+      +I I   E E +   +D E+  LE   +L         
Sbjct: 329 SKYKQLIEKDLIEIESL----NEICI---EKENRFEIVDREKNSLESGKNLALEFLEKEK 381

Query: 220 ----RKRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKS 275
                K K+ Q+ L+    +++T+ ++K+         L+E+Y  E  K ++L   + ++
Sbjct: 382 QLTLSKSKLLQYNLWQNN-SKLTNTLQKISA-------LNEEYNVEKSKNQTLQNEINRT 433

Query: 276 ---LNQLGSELKMKESTDLQQAKDSELELAKHLA 306
              LN+  S++K+ E  + QQ K   +   +H++
Sbjct: 434 KQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVS 467

>Scas_707.23
          Length = 1223

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 114/246 (46%), Gaps = 39/246 (15%)

Query: 8   IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
           +  FK+Y+  T+I     +   ++G NGSGKSN   AI FVL    ++L+    + LIY+
Sbjct: 9   LSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLIYR 68

Query: 68  GT--------------SSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKD-EYM 112
           G                   S YV+  +            DG V+ + RT+ +  D  Y 
Sbjct: 69  GVIRDFSEEDPEDGEEQHPTSAYVKAFYE----------MDGKVVELMRTININGDTTYK 118

Query: 113 INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER 172
           I+NK  S       LE           +V QG +  + +    +  +L EE+ G+  +++
Sbjct: 119 IDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSALDLSKLFEEISGSIQYKK 178

Query: 173 K---LKESLQKM--ETTE--KNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKM- 224
           +   LK+ L+K+   TTE  +NR +I  EL+  +  +++ DEE K     N++++K+K  
Sbjct: 179 EYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISK-DEEYK-----NNVEKKKKYE 232

Query: 225 CQFALY 230
             F L+
Sbjct: 233 MYFTLW 238

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 4/86 (4%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSS-QAQF 1181
            +E LSGG+KTV A+AL+ AI    P+PF++ DE+DAALD      +AA +++  +   QF
Sbjct: 1124 MEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQF 1183

Query: 1182 ICTTFRGDMIAVADRF---YRVNFEN 1204
            I  + +  M   +D     YR   EN
Sbjct: 1184 IVISLKNTMFEKSDALVGVYRQQQEN 1209

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
            cerevisiae YFL008w SMC1 chromosome segregation protein,
            start by similarity
          Length = 1223

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 101/221 (45%), Gaps = 42/221 (19%)

Query: 988  NKRALENFKKFDDKQKDVMKRAKELDESKESIE----KLID---KLKKQKVEAVENTFKK 1040
            N RA+E   +FDD +     R  E+D+  E ++    K+ D   K+K+++ E  EN F+K
Sbjct: 1016 NARAVE---RFDDAKS----RFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEK 1068

Query: 1041 VSENFTQLFEKMVPRGTGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXX 1100
            ++E+   ++ ++              N                E ED  F          
Sbjct: 1069 INEHLDAIYSELT------------RNVNSTSILGGGSASMTIEDEDEPFN--------- 1107

Query: 1101 XXIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAAL 1160
                +G+    +   K+ + +  E LSGG+KTV A+AL+ AI   +P+PF++ DE+DAAL
Sbjct: 1108 ----AGIRYHATPPMKRFKDM--EYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAAL 1161

Query: 1161 DKQYRTAVAATVKQLSS-QAQFICTTFRGDMIAVADRFYRV 1200
            D      +AA +++  +   QFI  + +  M   +D    V
Sbjct: 1162 DISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGV 1202

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 139/314 (44%), Gaps = 46/314 (14%)

Query: 8   IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
           +  FK+YK    +D    +   ++G NGSGKSN   AI FVL    ++L+    + LIY+
Sbjct: 9   LYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLIYR 68

Query: 68  GTSSVMSGYVEIVFHGAE-----NRT----LLGAQDGGVIHIRRTVG-LKKDEYMINNKN 117
              S      E    GA+     NRT         DG V+ + R +  L    Y ++   
Sbjct: 69  DIIS-----RENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLISRLGDTSYKLDGNT 123

Query: 118 ASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER---KL 174
            +  +  + LES          +V QG +  + +       +L+EEV G+  +++   +L
Sbjct: 124 VTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEEVSGSMQYKKEYEEL 183

Query: 175 KESLQKM--ETTE--KNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALY 230
           K+   K+   +TE  K R +I  EL+  +  ++  +E RK ++K     +KR     +L+
Sbjct: 184 KDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQK-----KKRVQTNLSLW 238

Query: 231 ----------------DRELNEVTSMVEKLDGEYTNTLVLSEQYIQE---LEKRESLIET 271
                           +   N+V  + EKL+ E  N  V  +   +E   L K+++ I +
Sbjct: 239 QLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALSKEAVLLTKKKNHIRS 298

Query: 272 LTKSLNQLGSELKM 285
           ++K   +  S+LK+
Sbjct: 299 ISKEKEKAESDLKV 312

>Kwal_23.5043
          Length = 1225

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 112/242 (46%), Gaps = 29/242 (11%)

Query: 8   IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
           +  FK+YK K  I     +   ++G NGSGKSN   AI FVL     +L+      LIY+
Sbjct: 9   LNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLIYR 68

Query: 68  GTSS--------------VMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDE-YM 112
           GT S                S YV+  +  + N       +  V+ + RTV   ++  Y 
Sbjct: 69  GTLSEEEASSADFESENHPNSAYVKAFYSPSNN-------EDDVVELSRTVTRSQESTYR 121

Query: 113 INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER 172
           I+ K        + LES          +V QG +  +   + +E   L E+V G+  +++
Sbjct: 122 IDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQELTDLFEQVSGSLQYKQ 181

Query: 173 ---KLKESLQKM--ETTE--KNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMC 225
              +++E L++   ET++  ++R++  I L+  +  +++ +E RK LE  N+L ++  + 
Sbjct: 182 DYDRIREELERARSETSDCIQSRKRAHIGLKSFKEGVDKDEEYRKHLEDRNNLQQQLIVW 241

Query: 226 QF 227
           Q 
Sbjct: 242 QL 243

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATV-KQLSSQAQF 1181
            +E LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD      VA+ + ++  +  QF
Sbjct: 1126 MEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQF 1185

Query: 1182 ICTTFRGDMI 1191
            I  + +  M 
Sbjct: 1186 IVISLKNTMF 1195

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 4/86 (4%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-LSSQAQF 1181
            +E LSGG+KTV A+AL+ AI    P+PF++ DE+DAALD      +AA +++  +   QF
Sbjct: 1126 MEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQF 1185

Query: 1182 ICTTFRGDMIAVADRF---YRVNFEN 1204
            I  + +  M   +D     YR   EN
Sbjct: 1186 IVISLKNTMFEKSDALVGVYRQQQEN 1211

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 117/266 (43%), Gaps = 34/266 (12%)

Query: 8   IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
           +  FK+Y+  T++     +   ++G NGSGKSN   AI FVL     +L+    + LIY+
Sbjct: 9   LSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYR 68

Query: 68  G----------------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKD-E 110
           G                +S+  S YV+  F+   N+         ++ + R +    D  
Sbjct: 69  GVLNDENSDDYDNEGAASSNPQSAYVK-AFYQKGNK---------LVELMRIISRNGDTS 118

Query: 111 YMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGA--- 167
           Y I+ K  S  D    LE+          +V QG +  +      E  ++ EEV G+   
Sbjct: 119 YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQY 178

Query: 168 --KSFERKLKESLQKMETTE--KNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRK 223
             +  E K K        TE  KNR +I  EL+  +  +N+ +E RK+L+K N L + + 
Sbjct: 179 KKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQA 238

Query: 224 MCQFALYDRELNEVTSMVEKLDGEYT 249
           + Q    +++  E+T  +  L+ E +
Sbjct: 239 LWQLYHLEQQKEELTDKLSALNSEIS 264

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
            complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 103/221 (46%), Gaps = 33/221 (14%)

Query: 988  NKRALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQ 1047
            N +A+E F +  D+   V   + +L ES+   ++L  K+K++++      F  V +N  +
Sbjct: 1013 NSKAVERFDEARDQFNAVSGESDKLKESERKAKELYLKIKEKRINTFLACFNHVRDNIDR 1072

Query: 1048 LFEKMV--PRGTGKLVIHRRENEXXXXXXXXXXXXXXXETEDVHFXXXXXXXXXXXXIYS 1105
            ++ ++   P  T +L                       E ED  +               
Sbjct: 1073 IYRELTRNPGSTAELA--------------GGSASLTLEDEDEPY-------------LG 1105

Query: 1106 GVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1165
            G+    +   K+ +   ++ LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD    
Sbjct: 1106 GIRYHATPPMKRFKD--MDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNV 1163

Query: 1166 TAVAATVKQLSS-QAQFICTTFRGDMIAVADRFYRVNFENK 1205
              +AA +++ +S + QFI  + + ++ + ++    V F N+
Sbjct: 1164 ERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGV-FRNQ 1203

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 88/209 (42%), Gaps = 30/209 (14%)

Query: 8   IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
           ++ FK+YK    +     +   +VG NGSGKSN   AI FVL    ++L+      LIY+
Sbjct: 9   VKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLIYR 68

Query: 68  G--------------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMI 113
           G              ++ V + YV+    GAE R         VIH           Y +
Sbjct: 69  GRMEEGGSAHENNPKSAYVTAFYVKQDASGAERRMEFTR----VIH-----NTGDSTYKL 119

Query: 114 NNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFER- 172
           + K     +   +LE           +V QG +  + +    +  +L E+V G+  ++R 
Sbjct: 120 DGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDLTKLFEQVSGSVQYQRE 179

Query: 173 --KLKESLQKMET----TEKNREKIRIEL 195
             +LK+  +K       + K R K++I+L
Sbjct: 180 YERLKDDYEKASAEYNESLKARRKMQIDL 208

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
            Saccharomyces cerevisiae YFL008w SMC1 chromosome
            segregation protein, start by similarity
          Length = 1243

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-LSSQAQF 1181
            +E LSGG+KT+ A+AL+  I    P+PF++ DE+DAALD      +A  +K+  +  AQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1182 ICTTFRGDMI 1191
            I  + +  M 
Sbjct: 1203 IVISLKNAMF 1212

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 63/128 (49%), Gaps = 3/128 (2%)

Query: 543 EKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPSN 602
           EKY      + G +   ++VD+  TA   +  L   + G  +FIPL+ + V+   + P +
Sbjct: 560 EKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTIDVNPPSL-PVS 618

Query: 603 DEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVK--DLNQGTKLAKQFRLNAITLDGDKAD 660
           +   C   I  I+Y+   E+A+++V   +I+    DL +  K ++  +   +TL+G    
Sbjct: 619 NVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIH 678

Query: 661 SRGVLTGG 668
             G +TGG
Sbjct: 679 KAGQMTGG 686

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%)

Query: 8  IRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERRSLIYQ 67
          +  FK+YK+  ++     +   ++G NGSGKSN   AI FVL      L+      LIY+
Sbjct: 9  LHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLIYR 68

Query: 68 G 68
          G
Sbjct: 69 G 69

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
           Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 102/223 (45%), Gaps = 27/223 (12%)

Query: 3   IKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER- 61
           + K+ +  F TY   TE  + SP  N+++G NGSGKS F  AI   L+     + R ++ 
Sbjct: 60  VVKLKLTNFVTYA-LTEF-HLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 62  RSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQ------DGGVIHIRRTVGL--KKDEYMI 113
              I  GT     G +EI    +    LL +       D  V+H++R + +  KK +Y I
Sbjct: 118 EEYIKNGTD---EGVIEITLKNSS--ALLHSDFNMINTDDDVVHVKRVLSMEKKKSKYYI 172

Query: 114 NNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQ---LLEEVIGAKSF 170
           NNK  +   V+ ++        N    + Q R+          RL+   LL E I  +S 
Sbjct: 173 NNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFA------RLKPDTLLNETI--RSI 224

Query: 171 ERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELE 213
           E  L E L ++++ +    +++I+L   E KL EL   R  LE
Sbjct: 225 EAGLLEKLSELKSLQAEGNELQIDLGAKENKLKELTSSRAALE 267

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1107 VSIEVSFNSKKD-EQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDK 1162
            + I+V F    + +Q++    SGG++ V  +  ++A+Q    +PF + DEI+  +D+
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQ 1049

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 174/413 (42%), Gaps = 45/413 (10%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKRE-E 60
           Y+K++ ++ F  +++  E++ F P  N +VG NGSGKS    AI  V     ++  R   
Sbjct: 61  YMKRITLKNFMCHEH-FELE-FGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 61  RRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGV----IHIRRTVGLKKD----EYM 112
            +SLI +G  +     V +   G      LGA + GV    I I RT  LK+D     + 
Sbjct: 119 LKSLIREGCGTARIAIV-LANQG------LGAFEQGVYGSEITIERT--LKRDGQSSHFS 169

Query: 113 INNKNA-----SRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRE-------RLQL 160
           I ++N       + D+QR+++       NP   + Q    S   A   +       R  L
Sbjct: 170 IKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTASTPQDKFRHFMRGTL 229

Query: 161 LEEV-IGAKSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLD 219
           LEE+ +     E  L+ S   ++   +N + +R + E  +    E+       E+  +L 
Sbjct: 230 LEEIDMNLAKAEEILRSSKSNLDYHGENMKALREDYEHAKRLFKEIYSTHDWNERKKTLQ 289

Query: 220 RKRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQL 279
            K     +   +R L +     +K   E +  +V  ++ I E   R   IE      +  
Sbjct: 290 GKLCWLNYKENERRLRK----FKKRQEEISQKIVACDEKITE---RNLKIERYKADQDST 342

Query: 280 GSELKMKESTDLQQAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQ 339
             E+  K  T LQ  +    E  + L     K+E L  +   ++ + AS   SL A R Q
Sbjct: 343 HEEVDQK-MTSLQDHQIKFEEAEQELGQFREKHEVLKEERRKVEREIASLEVSLKAHRQQ 401

Query: 340 IAVKEQQLAR-LSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNK 391
           +   EQ+LA  L    EQ+  E+  +  E K L+    +L +   K+ Q R++
Sbjct: 402 VKQLEQELAEALGGSKEQMVTEKRQVDEEIKTLKG---NLPSLEDKFQQCRDR 451

>Kwal_26.7204
          Length = 1117

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 98/212 (46%), Gaps = 12/212 (5%)

Query: 3   IKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER- 61
           I K+ +  F TY + TE  + SP  N+++G NGSGKS F  A+   L+     + R +R 
Sbjct: 69  IVKLRLENFVTY-SLTEF-HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRV 126

Query: 62  RSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGL-KKDEYMINNKNASR 120
            S I  G +    G +E+       RT       G   + R + + KK EY +N++  S 
Sbjct: 127 DSFIKNGEN---RGLIEVTLKRDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYLNDEPVSE 183

Query: 121 SDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQK 180
             V+ L+        N    + Q R+      ++    +LL E +  +S    L ES + 
Sbjct: 184 LTVKNLMGELNIQLDNLCQFLSQERVEEFARLKSD---KLLMETV--RSVNVNLLESFKN 238

Query: 181 METTEKNREKIRIELEEVEAKLNELDEERKEL 212
           ++T ++ +     ELE   +KL +L+E R +L
Sbjct: 239 LKTLQEEQITEAKELELKTSKLRDLNETRDKL 270

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRTAVAATVKQLSSQ--AQFIC 1183
            SGG++ V  +  ++A+Q    APF + DEI+  +D +  R    A V+   ++  +Q+I 
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1184 TT 1185
             T
Sbjct: 1072 VT 1073

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 102/217 (47%), Gaps = 15/217 (6%)

Query: 3   IKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREERR 62
           I K+ ++ F TY   TE  N SP  N+++G NGSGKS F  A+   L+     + R ++ 
Sbjct: 42  IIKIRLQDFVTY-TLTEF-NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKV 99

Query: 63  SLIYQGTSSVMSGYVEIVFHGAENRT---LLGAQDGGVIHIRRTV--GLKKDEYMINNKN 117
               +    V    +EI    + N T    + A+D   I I R +    ++ +Y+IN+  
Sbjct: 100 EDFIKNGQDV--SKIEITLKNSPNVTDIEYIDARD-ETIKITRIITRSKRRSDYLINDYQ 156

Query: 118 ASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKES 177
            S S V+ L+        N    + Q R+      ++   ++LL E I  +S +  L + 
Sbjct: 157 VSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS---VKLLVETI--RSIDASLLDV 211

Query: 178 LQKMETTEKNREKIRIELEEVEAKLNELDEERKELEK 214
           L ++   + N + ++ +L+  +AK+  L +E  +L K
Sbjct: 212 LDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRK 248

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1161
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMD 1021

>Scas_643.11
          Length = 1095

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 104/224 (46%), Gaps = 23/224 (10%)

Query: 3   IKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER- 61
           I K+ ++ F TY+  TE  N SP  N+++G NGSGKS F  A+   L+     + R +R 
Sbjct: 38  IVKIKLQNFVTYR-LTEF-NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 62  RSLIYQGTSSVMSGYVEIVFHGAENRT-----------LLGAQDGGVIHIRRTVGLK-KD 109
              I  G     +  +EI     E+ T           L G     V  + +  G K K 
Sbjct: 96  DDFIKNGED---TSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKCKS 152

Query: 110 EYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKS 169
           +Y IN+K  + + ++ L++       N    + Q R+      ++    +LL E +  +S
Sbjct: 153 DYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSD---KLLVETV--RS 207

Query: 170 FERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELE 213
            + +L + L  +++++ +   +  E++  + + NEL+ +R +LE
Sbjct: 208 IDAQLLQILDDLKSSQNDETTLENEVDIKQKRFNELETDRNKLE 251

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1161
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMD 1024

>Scas_719.6
          Length = 1096

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 72/165 (43%), Gaps = 26/165 (15%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER 61
           YIKKV +R F  ++N  E++   P  N +VG NGSGKS    AI   L    ++  R   
Sbjct: 63  YIKKVSLRNFMCHEN-FELE-LGPKLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 62  -RSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGV----IHIRRTV--------GLKK 108
            + LI +G     S  + +V    +     GA D G     I I RT+         LK 
Sbjct: 121 LKELIKEG---CYSAKITLVIENGKQ----GAYDQGTYGKEIIIERTLRRDGSPSFSLKS 173

Query: 109 DEYM-INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNA 152
           +  + I+NK   + D+Q +++      +NP   + Q    S   A
Sbjct: 174 ESGVEISNK---KRDIQTVVDFFSVPVNNPMCFLSQDAARSFLTA 215

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR----TAVAATVKQLSS 1177
            +V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    T V   +K L+ 
Sbjct: 993  NVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLAR 1052

Query: 1178 QAQFICTTFRGDMIAVAD 1195
                I T    D+  +AD
Sbjct: 1053 TQTIIITP--QDIGKIAD 1068

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 12/159 (7%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER 61
           YIKK+ +  F  ++N  +++   P  N +VG NGSGKS    AI   L    +   R   
Sbjct: 79  YIKKLTLHNFMCHRN-FDVE-LGPGLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 62  -RSLIYQGT-SSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDE-YMINNKNA 118
            + LI  G  SS ++ Y+     GA      G Q G  I I RT+       + + ++N 
Sbjct: 137 LKDLITAGCNSSRITIYLSNSGIGA--YVPKGKQYGDTIIIERTISRTSTAGFSLKSENG 194

Query: 119 S-----RSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNA 152
           +     + D+Q +L+      SNP   + Q    S   A
Sbjct: 195 TEISNKKRDLQEILDYFAIPISNPMCFLSQDSARSFLTA 233

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 95/199 (47%), Gaps = 17/199 (8%)

Query: 22  NFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER-RSLIYQGTSSVMSGYVEIV 80
           + SP  N+++G NGSGKS F  AI   L+     + R +R    I  GT+      +EI 
Sbjct: 63  HMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFIKNGTA---ESTIEIQ 119

Query: 81  FHGAENRT---LLGAQDGGVIHIRRTVGLK---KDEYMINNKNASRSDVQRLLESAGFST 134
              + N +   ++ A+D   I++ RTV +K   K  Y IN +  S + ++ L+       
Sbjct: 120 LRNSRNVSGLPMISAEDEA-INV-RTVLMKARRKCAYYINGEPVSENQMRALVSMLNIQL 177

Query: 135 SNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKLKESLQKMETTEKNREKIRIE 194
            N    + Q R+      +     +LLE+ +  +S +  L   L++++T+++    +  E
Sbjct: 178 DNLCQFLSQERVEEFARLKAD---KLLEQTV--RSVDASLLGLLEQLKTSQQEELSLNRE 232

Query: 195 LEEVEAKLNELDEERKELE 213
           +E  + KL +L   ++ LE
Sbjct: 233 VELGQKKLEKLMTHKESLE 251

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAV 1168
            SGG++ V  +  ++A+Q    APF + DEI+  +D +Y   V
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIV 1033

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
           Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/350 (23%), Positives = 159/350 (45%), Gaps = 50/350 (14%)

Query: 3   IKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER- 61
           I K+ +  F TY N TE  N SP  N+++G NGSGKS +  A+   L+     + R ++ 
Sbjct: 38  IVKIRLENFVTY-NYTEF-NLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQV 95

Query: 62  RSLIYQG--TSSVM-----SGYVEIVFHGAE-NRTLLGAQDGGVIHIRRTV--------G 105
              I  G  TS +         ++I F G+  +R        G++ I R +         
Sbjct: 96  EDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGRN 155

Query: 106 LKK---DEYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLE 162
           L+K    EY IN    + S+V+ L+        N    + Q R+      +     +LL+
Sbjct: 156 LEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRPE---KLLD 212

Query: 163 EVIGA------KSFERKLKESLQKME------TTEKNREKIRIELEEVEAKLNELDEERK 210
           E I A        FE   K  LQ++E      T   + +K++ + E  + ++  L+E ++
Sbjct: 213 ETIRAIDSELLSMFEVLKKLQLQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLLNEYQE 272

Query: 211 ELEKYNSLDRKRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEK-RESLI 269
            L+   +LD+ +K+  +        ++ +   +++G        +++ +QE +K RE  +
Sbjct: 273 TLD---TLDKHKKLLPYLKIQDHREKLLTYKRQVEG--------AKKQLQEFQKEREPYM 321

Query: 270 ETLTKSLNQLGSELKMKESTDLQQAKDSELELAKHLADLNVKYEELISQN 319
           + L  SLN+  ++L +++    ++   ++ +L K ++ LN   EE+  +N
Sbjct: 322 QVLA-SLNESDAQLNIEKENIEEKKVSTKRKLEKTVSKLNALREEIEKKN 370

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 1127 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ 1174
            SGG++ V  +  ++A+Q    APF + DEI+  +D  +   V   + Q
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQ 1047

>YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved in
           recombination repair, homologous to S. pombe rad18 [3345
           bp, 1114 aa]
          Length = 1114

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 105/246 (42%), Gaps = 43/246 (17%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER 61
           YIKKVI+R F  +++  E++      N +VG NGSGKS    AI   L    +   R   
Sbjct: 81  YIKKVILRNFMCHEH-FELE-LGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 62  -RSLIYQGTSSVMSGYVEIVFH------GAENRTLLGAQ---------DGGVIHIRRTVG 105
            + LI +G  S      +I+ H      GA  + + G +         DG      R+  
Sbjct: 139 LKDLIREGCYS-----AKIILHLDNSKYGAYQQGIFGNEIIVERIIKRDGPASFSLRSEN 193

Query: 106 LKKDEYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRE-------RL 158
            K+    I+NK   + D+Q +++      SNP   + Q    S   A   +       + 
Sbjct: 194 GKE----ISNK---KKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKYSHFMKG 246

Query: 159 QLLEEVIGAKSFERKLKESLQK-METTEKNREKIRIELEEVEAKLNELDE-----ERKEL 212
            LL+E+     +   + +S Q+ M    +N + ++ E E+ +  L EL++     ERK L
Sbjct: 247 TLLQEITENLLYASAIHDSAQENMALHLENLKSLKAEYEDAKKLLRELNQTSDLNERKML 306

Query: 213 EKYNSL 218
            +  SL
Sbjct: 307 LQAKSL 312

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 1108 SIEVSFNSKKDEQV-HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR- 1165
            S+E+   +  DE+  +V+ LSGG+K+   +AL+LA      +     DE D  +D+  R 
Sbjct: 1000 SLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRK 1059

Query: 1166 ---TAVAATVKQLSSQAQFICTTFRGDMIAVAD 1195
               T +   +K ++     I T    D+  +AD
Sbjct: 1060 IGTTLIVKKLKDIARTQTIIITP--QDIGKIAD 1090

>Kwal_26.9380
          Length = 1102

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 82/208 (39%), Gaps = 41/208 (19%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER 61
           +IKKV +R F  +++  E++   P  N +VG NGSGKS    AI   L    T+  R   
Sbjct: 69  FIKKVQLRNFMCHEH-FELE-LGPRLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 62  -RSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGV----IHIRRTV--------GLKK 108
            + LI +G     S  + IV     N    G  D G     I I RT+         LK 
Sbjct: 127 LKDLIREG---CQSSKISIVL----NNEGFGGYDQGTYGSEIRIERTIKRNGPATFSLKS 179

Query: 109 DEYMINNKNAS--RSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRE-------RLQ 159
           +    N K  S  + D+Q +++       NP   + Q    S   A           R  
Sbjct: 180 E----NGKEVSNKKRDLQVIVDYFAVPVMNPMCFLSQDAARSFLTASTPTDKYKHFMRGT 235

Query: 160 LLEEVIGAKSFERKLKESLQKMETTEKN 187
           LLE+       E  L ++LQ   T + N
Sbjct: 236 LLEDT------EMNLDQALQAATTAQNN 257

>CAGL0K10934g complement(1067851..1069650) similar to sp|Q04322
           Saccharomyces cerevisiae YMR192w, hypothetical start
          Length = 599

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 98/214 (45%), Gaps = 14/214 (6%)

Query: 308 LNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIEEAAMKAE 367
           L  K+E+++S    L   +  +SE +    + I +K + +      +E++   E   + +
Sbjct: 394 LRSKFEDILSIIKNLDPMAELSSEFITEAMASIELKPKAVIGYKYEYEEIHRLEREREEQ 453

Query: 368 FKALQQRQRDLLAKRGKYSQFRNKAERD-AWIDQELSILKEELQCSSIALTSISEERDSL 426
           F  ++ + ++L  K         K E D  ++++E   +  EL  S + +  IS + + L
Sbjct: 454 FDYVKNKNKNLQEKV-------KKLEHDYTFLNREHVTIANELVNSQLNIEQISVQNNEL 506

Query: 427 RIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDERKQLWRSEQKIQS 486
           RI+L  L  ++ EL          A  +D+++ELT +   +   + E  QL    Q   S
Sbjct: 507 RIELINLRKELAELTKQKDIETGKAVPDDMKKELTNILAKNSRVMTENLQL----QDKVS 562

Query: 487 VLESLVDDVKRA--EGTLSETMDRSLATGLKNVS 518
            LE   +D+KR   EG L E    S  TGLK +S
Sbjct: 563 ELEKTAEDIKRCTEEGKLYEDPSASSWTGLKKIS 596

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 17/161 (10%)

Query: 2   YIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREER 61
           +IK++ +  F  + N +      P  N +VG NGSGKS    AI   L    T   R   
Sbjct: 63  FIKEIKLTNFMCHSNFSL--RLGPRLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGTS 120

Query: 62  -RSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN------ 114
            + LI QG ++  S  V ++ +   N    G   G  I I RT+  +++ Y  +      
Sbjct: 121 LKDLIKQGCNT--SKIVIVLCNEGLNSFEPGVY-GKEIRIERTI--RREGYSGSFSIRSE 175

Query: 115 -NKNAS--RSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNA 152
            NK  S  + D++ +L+      +NP   + Q    S   A
Sbjct: 176 ANKEVSDKKRDLEVILDYFSIPVTNPMCFLSQDAARSFLTA 216

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATV-----KQLS 1176
            +V+ LSGG+K+   IAL+LA  +   +     DE D  +D+  R      +     K + 
Sbjct: 998  NVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDVK 1057

Query: 1177 SQAQFICTTFR--GDMIAVADRFYRVN 1201
            S  Q I  T +  G M  + D+++ ++
Sbjct: 1058 SDTQTIIITPQDIGKMANIDDKYFNIH 1084

>Scas_653.20
          Length = 859

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 125/262 (47%), Gaps = 52/262 (19%)

Query: 695 KSQLEEVKEKLH---SIDQEIDELNDKIKKSMSRREMILTQ---VEAVNIKLEKAKRERF 748
           K + E++K+K     S D+ +  L + ++    R E + +Q   +E +  +LE  ++ + 
Sbjct: 115 KFECEQIKQKTQYSKSTDESVGLLQETVEHLTLREEDLTSQNMELEGLKTQLE-GEKNKL 173

Query: 749 LLEETMVQ--LISKEEK-AKINQKLLQ----DKLDMYTEDLSRXXXXXXXXXXXXXXXXI 801
           L E ++++  L  +E   A+INQK++     DK+D+  E+                   +
Sbjct: 174 LQEVSLLKENLSCREATDAEINQKIIAGTNVDKIDLLREN-----------------TRL 216

Query: 802 AKKLPDLENLLNTTT---DALSSVVVKIDSLKAELDSKLKPQAKELEDQPNEIMSTTAIQ 858
            K + DLE  L  T    + L S    +    A L+  ++    +LE+      S   I+
Sbjct: 217 QKAIDDLERSLTDTIHDYEVLMSEYSDLIETNAVLEDSIQVLNTDLEN------SAIDIR 270

Query: 859 NLQEHIDAVEDERKTLLERKSTVDNEVQ----KISEIIDTLKSRQEEEEKSLEKANSQQR 914
           NLQ  +DA++D++K ++ER +T +NE+     K+   +  LK  + E E+ L+++N ++ 
Sbjct: 271 NLQREVDAIKDDKK-IVERVTTENNELSLKLAKLESKLKDLKKNKSEHERLLQESNDREE 329

Query: 915 ALLKKL-------DNYQKEAEK 929
            L K L       +NY  E +K
Sbjct: 330 ELKKSLKDSEIITENYNFELQK 351

>Scas_636.14
          Length = 608

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1175 -LSSQAQFICTTFRGDMIAV 1193
                +  FI  T+  D + V
Sbjct: 521  AFVVEHDFIMATYLADKVIV 540

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1175 -LSSQAQFICTTFRGDMIAVAD 1195
                +  FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1175 -LSSQAQFICTTFRGDMIAV 1193
                +  FI  T+  D + V
Sbjct: 521  AFIVEHDFIMATYLADKVIV 540

>ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH]
           (660330..670508) [10179 bp, 3392 aa]
          Length = 3392

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 106/219 (48%), Gaps = 31/219 (14%)

Query: 175 KESLQKMETTEKNREKIRIELEE---VEAKLNELDEERKELEKYNSLDRKRKMCQFALYD 231
           +++L  +   +K+R+ I + LEE   +EAKL ++ EE K LE+  S +   ++ Q  L +
Sbjct: 331 RQALSAVLGRDKDRD-IVLLLEEGNKLEAKLMQITEENKSLEQ-KSDELAGQVTQL-LSE 387

Query: 232 REL--NEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESL------IETLTKSLNQLGSE- 282
           +E+   +V  +  KL+        LSE+ ++  EK ++       I  LT  +N+L  E 
Sbjct: 388 KEILTEQVLDLHTKLEESEKTVTDLSEEVVKLREKADAGVVLQQQISALTNQVNELTFEN 447

Query: 283 --LKMKESTDLQQAKDSELELAKHLAD--------LNVKYEELISQNNALKEQSA----- 327
             L  K  T   Q  D +  + + + D        LN + EELI+QN  LK   A     
Sbjct: 448 EALTQKNLTLTTQLADQDATVGRSMGDSFKEKLSALNSQLEELITQNQTLKLSKAELAAK 507

Query: 328 -SNSESLLAIRSQIAVKEQQLARLSPRFEQLTIEEAAMK 365
            S  + ++A RS     ++Q++ L+ +   L+IE   +K
Sbjct: 508 LSKQQDIIASRSVDDNFQKQMSVLTNQLNDLSIENETLK 546

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 691 QQGNK--SQLEEVKEKLHSIDQEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERF 748
           ++GNK  ++L ++ E+  S++Q+ DEL  ++ + +S +E++  QV  ++ KLE++++   
Sbjct: 351 EEGNKLEAKLMQITEENKSLEQKSDELAGQVTQLLSEKEILTEQVLDLHTKLEESEKTVT 410

Query: 749 LLEETMVQLISKEEKAKINQK 769
            L E +V+L  K +   + Q+
Sbjct: 411 DLSEEVVKLREKADAGVVLQQ 431

>CAGL0H06919g complement(685736..687619) similar to sp|Q03103
            Saccharomyces cerevisiae YML130c ERO1, hypothetical start
          Length = 627

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 1011 ELDESKESI-EKLIDKLKKQKVEAVENTFKKVSEN--FTQLFEKMVPRGTG 1058
            +LDE+ ES  +K +DKL K ++ A+ NTF K+SE+  +   FEK+  R  G
Sbjct: 381  DLDEADESSKQKFVDKLTKYELIALFNTFDKLSESVEYINNFEKLYKRREG 431

>Kwal_33.13526
          Length = 1298

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 3  IKKVIIRGFKTY-KNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDD 52
          I K+ I+G +++  N+ E   F     ++VG NGSGK+     +++  + D
Sbjct: 4  IYKLSIQGIRSFDSNERETIEFGKPLTLIVGSNGSGKTTIIECLKYATTGD 54

>CAGL0J07788g complement(757051..760968) similar to sp|P12753
          Saccharomyces cerevisiae YNL250w RAD50 DNA repair
          protein, start by similarity
          Length = 1305

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 3  IKKVIIRGFKTY-KNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDD 52
          I K+ I+G +++  N  E   F     ++VG NGSGK+     +++  + D
Sbjct: 4  IYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIECLKYATTGD 54

>YDL040C (NAT1) [824] chr4 complement(378871..381435) Protein
           N-acetyltransferase subunit, mating functions are
           reduced in mutants due to derepression of silent mating
           type loci [2565 bp, 854 aa]
          Length = 854

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 22/128 (17%)

Query: 849 NEIMSTTA------IQNLQEHIDAVED---ERKTLLERKSTVD---NEVQKISEIIDTLK 896
           N+IM   A      +QN+ +H++ +E    ++  LLERK+T+     +++  S +  TL 
Sbjct: 209 NDIMYKAASDNQDKLQNVLKHLNDIEPCVFDKFGLLERKATIYMKLGQLKDASIVYRTLI 268

Query: 897 SRQEEEEK---------SLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQK 947
            R  +  K          ++  N  ++AL  KL+ +    E      +T    ++EL +K
Sbjct: 269 KRNPDNFKYYKLLEVSLGIQGDNKLKKALYGKLEQFYPRCEPPKFIPLTFLQDKEELSKK 328

Query: 948 IRDIGLLP 955
           +R+  +LP
Sbjct: 329 LREY-VLP 335

>YNL250W (RAD50) [4357] chr14 (175409..179347) Coiled-coil protein
          involved in recombinational DNA repair, required for
          resection at double-stranded breaks and for DNA repair
          during vegetative growth, involved in telomere addition
          and telomere rapid deletion [3939 bp, 1312 aa]
          Length = 1312

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 3  IKKVIIRGFKTY-KNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDD 52
          I K+ I+G +++  N  E   F     ++VG NGSGK+     +++  + D
Sbjct: 4  IYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIECLKYATTGD 54

>Kwal_56.23429
          Length = 539

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQL 1175
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  +++ 
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>KLLA0F08063g 756362..757231 some similarities with sp|P18410
           Saccharomyces cerevisiae YAL009w SPO7 meiotic protein
           singleton, hypothetical start
          Length = 289

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 22/147 (14%)

Query: 236 EVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQAK 295
            VT ++  L GEY  T+V+  +++              K + Q   +L   +ST LQ   
Sbjct: 146 SVTIVLFHLSGEYKRTMVIPRRFLVNAN----------KGMRQFNVKLVKVKSTWLQNYA 195

Query: 296 DSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFE 355
           D+   + + ++  N+K          L    A+N+ S+ A  S ++++   L RL     
Sbjct: 196 DTIRIIIRRVSKWNMK---------LLITMGATNT-SIYAFWSSLSIR--CLPRLGAVDV 243

Query: 356 QLTIEEAAMKAEFKALQQRQRDLLAKR 382
           +L +   A  AE +   +  RD   KR
Sbjct: 244 KLVLNAKAFSAEIREGWEIYRDEFWKR 270

>ADR400W [2140] [Homologous to ScYAL047C (SPC72) - SH]
           complement(1423241..1425631) [2391 bp, 796 aa]
          Length = 796

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 47/103 (45%), Gaps = 32/103 (31%)

Query: 640 GTKLAKQFRL--------------NAITLDGDKADSRGVLTGGFHDHHKQKRLDSM---- 681
           GTKL KQ +L              N  TL G K D    LT           LD +    
Sbjct: 419 GTKLTKQKQLLNKLARSVTDAESFNGATLPGAKGDP--YLTA----------LDDLTTRA 466

Query: 682 -RDL-KSLKKEQQGNKSQLEEVKEKLHSIDQEIDELNDKIKKS 722
            RDL +S +   +  K+ L+  K +LH  DQE+DEL D+++++
Sbjct: 467 SRDLSRSYQDHIEALKNMLDRYKSELHDKDQELDELKDRLRRA 509

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQL 1175
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  +++ 
Sbjct: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512

>Scas_706.21
          Length = 1304

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 3  IKKVIIRGFKTY-KNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDD 52
          I K+ I+G +++  N  E   F     ++VG NGSGK+     +++  + D
Sbjct: 4  IYKLSIQGIRSFDSNDRETIEFGKPLTLIVGSNGSGKTTIIECLKYATTGD 54

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 1125 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQ 1180
            QLSGGQK   A+A      ++DP+   + DE  +ALD Q    VA +++Q S++ +
Sbjct: 569  QLSGGQKQRIALARAF---LLDPS-ILILDEATSALDSQSEEVVAQSLQQRSARGK 620

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1, hypothetical start
          Length = 1884

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 98/198 (49%), Gaps = 28/198 (14%)

Query: 200  AKLNELDEERKELEKYNSLDRKRKMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYI 259
            +K+ EL+  R++LE+ N+     K    A   R+L    S +E   G+ T  + +  + +
Sbjct: 923  SKIQELELVRQKLEEKNN----EKDASIAELTRKL----SSLESEKGDITRQISMDTEVL 974

Query: 260  QELE----KRESLIETLT---KSLNQLGSELKMKESTDLQQAKDSELELAKHLADLNV-- 310
            ++LE    ++E +IE L+   K  + +  ELK KE       KD +++L     + NV  
Sbjct: 975  KKLENEKMEKERVIEKLSHDIKERDHIIDELKQKEHIS---NKDLDIKLQTLEKNCNVAL 1031

Query: 311  -KYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRFEQLTIEEAAMKAEFK 369
             K + L+++N  L+E+   N +       Q++ KE+++ RL  RF       A+ + E  
Sbjct: 1032 TKLKSLLNENAELREEVGKNKKLHANTIQQVSSKEKEIERLKARF-------ASNQGEIN 1084

Query: 370  ALQQRQRDLLAKRGKYSQ 387
             + +++  L+A+  K S+
Sbjct: 1085 EILKQRDSLMAENDKLSK 1102

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 854 TTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTLKSRQEEEEKSLEKANSQQ 913
           T  I+ L++ + AVE E+K    + + + NE+  +  ++D  K + +  E+ L K+N QQ
Sbjct: 838 TEKIKVLEQKLTAVETEKKIHTAKHNDLLNELNDVKNLLDVEKEKLKRNEQLLSKSNEQQ 897

Query: 914 RAL 916
           R +
Sbjct: 898 REI 900

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 1126 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ 1174
            +SGG+K   AIA +L    +  AP   FDE  +ALD     A+  T++Q
Sbjct: 572  ISGGEKQRLAIARVL----LKDAPLMFFDEATSALDTHTEQALLHTIQQ 616

>Kwal_26.9480
          Length = 719

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 1126 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ 1174
            +SGG+K   AIA +L    +  AP   FDE  +ALD     A+  T+K+
Sbjct: 600  ISGGEKQRLAIARVL----LKDAPIMFFDEATSALDTHTEQALLRTIKE 644

>Scas_688.22
          Length = 1876

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 45/86 (52%)

Query: 836 KLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDTL 895
           K+KP     +D       T  ++ L+  +  +E+ER +  E+ S    +++KI  I++  
Sbjct: 808 KIKPLVNSAQDITKTKQFTEQVKALEHKLQLIEEERDSAKEKSSRTSKDLEKIRSILEKE 867

Query: 896 KSRQEEEEKSLEKANSQQRALLKKLD 921
           ++  +E E +L K  ++QR L  +L+
Sbjct: 868 RNSLKENENTLIKVKNEQRTLQGRLE 893

>YNL239W (LAP3) [4368] chr14 (200568..201932) Aminopeptidase of
           cysteine protease family, homologous to rabbit bleomycin
           hydrolase [1365 bp, 454 aa]
          Length = 454

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 534 PLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKG 580
           P G+LIKI         V+GG ++ ++ VD E  + L+++ L N+K 
Sbjct: 278 PYGKLIKIDR----LGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKA 320

>KLLA0F22451g 2098204..2099559 similar to sp|P33895 Saccharomyces
           cerevisiae YOL069w NUF2 spindle pole body protein
           singleton, start by similarity
          Length = 451

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 36/165 (21%)

Query: 344 EQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYS------QF-RNKAERDA 396
           +QQ++RL    E L I+  A K+       R++ LL    K+       +F RNK E+ +
Sbjct: 192 DQQISRLKGLQETLNIDYNAYKS-------RKQSLLHDLEKFGFELIELEFERNKLEKHS 244

Query: 397 WID-QELSI----LKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINA 451
             D  EL++    L   L      L ++ ++   LRI + T                +  
Sbjct: 245 KTDFNELNLNIEKLSTLLATQQTNLNNLEQKHRKLRISMNTF-------------QTLTH 291

Query: 452 ELEDVQQELTV-LKKAHLFK---IDERKQLWRSEQKIQSVLESLV 492
           EL DV Q ++  L+++HL +   ID R+QL +++QK+ ++L S V
Sbjct: 292 ELYDVLQLISTDLQESHLREANLIDMREQLLQTDQKLNNILSSGV 336

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 13/82 (15%)

Query: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   +  +++        
Sbjct: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1175 -LSSQAQFICTTFRGDMIAVAD 1195
                +  FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>KLLA0B10956g 958985..961057 similar to sp|P17119 Saccharomyces
           cerevisiae YPR141c KAR3 kinesin-related protein, start
           by similarity
          Length = 690

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 11/92 (11%)

Query: 237 VTSMVEKLDGEYTNTLVLSEQYIQELEKRESLI----ETLTKSLNQLGSELKMKESTDLQ 292
           +  + E+LD +Y+N   L E+++ E +     I    +++ K +N+L  +++   + +L 
Sbjct: 213 INQLKEELDKKYSN---LKEKWMVEFQTEWKNITEANQSMIKDINKLSQDIENDMTNELD 269

Query: 293 QAKDSELELAKHLADLNVKYEELISQNNALKE 324
           Q+KD    L K LA    K EE +++ N  KE
Sbjct: 270 QSKDKRNILEKELA----KLEEKLNEKNVFKE 297

>Scas_702.4
          Length = 354

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 390 NKAERDAWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGI 449
           N    D WID  ++  + EL+   I + +  EER  + +        ++ +N+S  GP I
Sbjct: 181 NNGVLDNWIDAIIAKQRLELKSGLIQMAATKEERIGIPLP------DVVGMNESVLGPSI 234

Query: 450 NAE 452
           N E
Sbjct: 235 NIE 237

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,740,798
Number of extensions: 1581894
Number of successful extensions: 14781
Number of sequences better than 10.0: 908
Number of HSP's gapped: 13214
Number of HSP's successfully gapped: 1784
Length of query: 1208
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1095
Effective length of database: 12,684,275
Effective search space: 13889281125
Effective search space used: 13889281125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)