Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL181C1221119952030.0
KLLA0C09394g118467111601e-138
Kwal_14.2421120566510641e-125
Scas_675.2413194377661e-83
YJL076W (NET1)11895037212e-78
CAGL0H02783g17854776267e-66
Scas_711.389984125422e-56
CAGL0B03179g9273623432e-32
YKR010C (TOF2)7712442233e-18
CAGL0E06644g103440689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL181C
         (1199 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...  2008   0.0  
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   451   e-138
Kwal_14.2421                                                          414   e-125
Scas_675.24                                                           299   1e-83
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   282   2e-78
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   245   7e-66
Scas_711.38                                                           213   2e-56
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   136   2e-32
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...    91   3e-18
CAGL0E06644g 664873..667977 tr|Q9Y7E9 Candida glabrata Flo1p-rel...    31   9.8  

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2) -
            SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score = 2008 bits (5203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1025/1199 (85%), Positives = 1025/1199 (85%)

Query: 1    MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60
            MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS
Sbjct: 1    MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60

Query: 61   ANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVTLQ 120
            ANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVTLQ
Sbjct: 61   ANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVTLQ 120

Query: 121  DVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTIYMKKRKLNTXXXXXXXXXXX 180
            DVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTIYMKKRKLNT           
Sbjct: 121  DVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTIYMKKRKLNTGAAGVPAAGGS 180

Query: 181  XXXXXLNVAKKRASIKTSALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKXXXXXXXXX 240
                 LNVAKKRASIKTSALRVSTPLANQIYPPPTKKQVNSDFEDDDVADK         
Sbjct: 181  VQAAVLNVAKKRASIKTSALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKSILPPPPPQ 240

Query: 241  XXXXXXXXGMDQKRINMNDNAVSKSETVDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTG 300
                    GMDQKRINMNDNAVSKSETVDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTG
Sbjct: 241  SPPIRISSGMDQKRINMNDNAVSKSETVDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTG 300

Query: 301  PTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSR 360
            PTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSR
Sbjct: 301  PTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSR 360

Query: 361  IPMKKPYNPSMQQDEDLXXXXXXTEDNVPAVPYENELERSGPTMATRQSSSTIADDQGSP 420
            IPMKKPYNPSMQQDEDL      TEDNVPAVPYENELERSGPTMATRQSSSTIADDQGSP
Sbjct: 361  IPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVPYENELERSGPTMATRQSSSTIADDQGSP 420

Query: 421  TKKSRFEKNNIGLVELPSPRKSSLEKKVSKLNKGLASDKGHEDSTGGITRKDHFSDEESE 480
            TKKSRFEKNNIGLVELPSPRKSSLEKKVSKLNKGLASDKGHEDSTGGITRKDHFSDEESE
Sbjct: 421  TKKSRFEKNNIGLVELPSPRKSSLEKKVSKLNKGLASDKGHEDSTGGITRKDHFSDEESE 480

Query: 481  ASQNGSVVVNRPETQREKSFQKSELLKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKP 540
            ASQNGSVVVNRPETQREKSFQKSELLKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKP
Sbjct: 481  ASQNGSVVVNRPETQREKSFQKSELLKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKP 540

Query: 541  YVTVLNKDIDNSSPDPRNIIPRRTQRHAAQKAAQSISSGTSRSNVFSGEEKNKYSEENQG 600
            YVTVLNKDIDNSSPDPRNIIPRRTQRHAAQKAAQSISSGTSRSNVFSGEEKNKYSEENQG
Sbjct: 541  YVTVLNKDIDNSSPDPRNIIPRRTQRHAAQKAAQSISSGTSRSNVFSGEEKNKYSEENQG 600

Query: 601  DNIASDDNEGVYVHESNALKKLNVHPLKESVVQDTLTGAQDINNPVSSRTVHPSISEHAV 660
            DNIASDDNEGVYVHESNALKKLNVHPLKESVVQDTLTGAQDINNPVSSRTVHPSISEHAV
Sbjct: 601  DNIASDDNEGVYVHESNALKKLNVHPLKESVVQDTLTGAQDINNPVSSRTVHPSISEHAV 660

Query: 661  TAAASGTLSSNPEYRVAPIVTPTLMSSAVPGKPEAILSKQGDPPASTALKPQLAPARKVE 720
            TAAASGTLSSNPEYRVAPIVTPTLMSSAVPGKPEAILSKQGDPPASTALKPQLAPARKVE
Sbjct: 661  TAAASGTLSSNPEYRVAPIVTPTLMSSAVPGKPEAILSKQGDPPASTALKPQLAPARKVE 720

Query: 721  STQKKQAGKKSDTNQPSRTNSKKTGLPADTAVPSSQKTVRARAAQIDAQIKQTATXXXXX 780
            STQKKQAGKKSDTNQPSRTNSKKTGLPADTAVPSSQKTVRARAAQIDAQIKQTAT     
Sbjct: 721  STQKKQAGKKSDTNQPSRTNSKKTGLPADTAVPSSQKTVRARAAQIDAQIKQTATSSQSP 780

Query: 781  XXXXXXXXLNSEEAVADKSEVDNNSSTQDKSLQQKTSKRKTPVKRTANADKKAVTLKRSS 840
                    LNSEEAVADKSEVDNNSSTQDKSLQQKTSKRKTPVKRTANADKKAVTLKRSS
Sbjct: 781  VAESQSSVLNSEEAVADKSEVDNNSSTQDKSLQQKTSKRKTPVKRTANADKKAVTLKRSS 840

Query: 841  NSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYQTPEFVESSDDERADAKTPLEKHSS 900
            NS                               VYQTPEFVESSDDERADAKTPLEKHSS
Sbjct: 841  NSKGKEKDTEKGKERIKEKEKEKEKEKEKEKEKVYQTPEFVESSDDERADAKTPLEKHSS 900

Query: 901  DRPKSGSPSKHENGQEKQDSFSGIILKKTAIEKDKVVANAPHKVNEKPMTADAGSTNLSP 960
            DRPKSGSPSKHENGQEKQDSFSGIILKKTAIEKDKVVANAPHKVNEKPMTADAGSTNLSP
Sbjct: 901  DRPKSGSPSKHENGQEKQDSFSGIILKKTAIEKDKVVANAPHKVNEKPMTADAGSTNLSP 960

Query: 961  SGKVSKLDELRSKFTKGRFPXXXXXXXXXXXXNTPKTSSKSIVPTVSDKFKPXXXXXXXX 1020
            SGKVSKLDELRSKFTKGRFP            NTPKTSSKSIVPTVSDKFKP        
Sbjct: 961  SGKVSKLDELRSKFTKGRFPQGSSQKQIQQQKNTPKTSSKSIVPTVSDKFKPMDSTSGAS 1020

Query: 1021 XXXXXXXXXXXXXXXXXXXXXISMKKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQS 1080
                                 ISMKKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQS
Sbjct: 1021 SDDSADDDDDDSMDSSTEDEGISMKKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQS 1080

Query: 1081 TQIPNEATNTAPLTKLLDHISPPSTAKTITSRGVTEXXXXXXXXXXXXXXXXXRGVPDVR 1140
            TQIPNEATNTAPLTKLLDHISPPSTAKTITSRGVTE                 RGVPDVR
Sbjct: 1081 TQIPNEATNTAPLTKLLDHISPPSTAKTITSRGVTESKGTSNRSLSSLSDLASRGVPDVR 1140

Query: 1141 EKGVNYKKTAPXXXXXXXXDESEQETXXXXXXXXXXXXXXXXXXXXXXXXXFISAKSAS 1199
            EKGVNYKKTAP        DESEQET                         FISAKSAS
Sbjct: 1141 EKGVNYKKTAPNVVNNSSSDESEQETNDGSDSSDSDNSDSDSSDSSDDGNNFISAKSAS 1199

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  451 bits (1160), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 295/671 (43%), Positives = 402/671 (59%), Gaps = 50/671 (7%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSI----AGGRGEFSSGI 56
           M+KLQVVLVP          GLP+ S ++S F     Q +                 +GI
Sbjct: 1   MFKLQVVLVPAGANRSF-NFGLPSVSSESSQFILPVQQQVLQQGGNAPQLANNIPAQNGI 59

Query: 57  G----NTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAE 112
           G    N S N  YLS  + +HI R + +KFL FTKPTN+LY+L+ EI++KC K+YP L+ 
Sbjct: 60  GALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLST 119

Query: 113 EPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-EAAGDR--TIY-MKKRKLN 168
           E EI TLQDV+ECDLDPDFVVKDVFN+ NTVRV+LRND+D E+  DR  ++Y  K+RKLN
Sbjct: 120 ELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSSKRRKLN 179

Query: 169 TXXXXXXXXXXXXXXXXLNVAKKR-ASIKTSALRVSTPLANQIYPPPTK---KQVNSDFE 224
                            + VAK+R  ++K SALR+STPLA+QIYPPP++   KQVNSD+E
Sbjct: 180 NGNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNSDYE 239

Query: 225 -----DDDVADKX-XXXXXXXXXXXXXXXXGMDQKRINMN--DNAVSKSETVDPNKSRQQ 276
                DD++ DK                   + QKR+ +N  ++ VSKSETVDP+K++QQ
Sbjct: 240 EDEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRLKINGSEDTVSKSETVDPSKAKQQ 299

Query: 277 RLPSGTPMRPVSMVETPNRVSLTGPTVLSESTVSQ---KSTATPIITNIRITSGMLRIPE 333
           RLPSGTPM+P++++ETPNR     P  L+    +Q   +  +TP++TN RITSGMLRIPE
Sbjct: 300 RLPSGTPMKPMNVIETPNR-----PGFLAMPQQAQHLLRINSTPVVTNKRITSGMLRIPE 354

Query: 334 PRLSEVEKELKEGPASPAVD-LPARPSRIPMKKPYNPSMQQDEDLXXXXXXTEDNVPAVP 392
           PR+SE+E+ + EG +SPA   LP + ++IPMKK Y P    + D         ++  +VP
Sbjct: 355 PRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPD---EHDSSSSEGEFTEDKESVP 411

Query: 393 YENELERSGPTMATRQSSSTIADDQGSPTKKSRFE---KNNIGLVELPSPRKSSLEKKVS 449
                +   P     ++ S+IADD GSPTKKS  +   + N+ + +LP  RKSSLE KV 
Sbjct: 412 VRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLPPQRKSSLEAKVE 471

Query: 450 KLNKGLASDKGHEDSTGGITRKDHFSDEESEASQNGS----VVVNRPETQREKSFQKSEL 505
           KL K  +        +   TRK+ FS+ ESE +++ +     V   P  + + SFQKSEL
Sbjct: 472 KLAKNASELVADNHLSSNTTRKEGFSESESENAESENEANDTVCIHPTDRMDGSFQKSEL 531

Query: 506 LKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQ 565
           L++    +FD+PP F+ +A   +    N+ R +KPY+TVLNKDIDNS PDPRNI+P +  
Sbjct: 532 LELLKGSKFDVPPAFRRAAGALQENDINK-RSRKPYLTVLNKDIDNSEPDPRNILPSKLP 590

Query: 566 RHAAQKAAQSISSGTSRSNVFSGEEKNK----YSEENQGDNIASDDNEGVYVHESNALKK 621
           R AAQKAAQ IS+GTSR  + S    +      SEE   D+    +N    + E N LK+
Sbjct: 591 RQAAQKAAQFISTGTSRRPLQSSSSSSSSSAVVSEEPSSDSDIETENSDNSMDEVN-LKR 649

Query: 622 LNVHPLKESVV 632
           LNVHPL+  +V
Sbjct: 650 LNVHPLRPVMV 660

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 54/115 (46%), Gaps = 10/115 (8%)

Query: 1045 KKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEATNTAPLTKLLDHISP-- 1102
            KK RRGIV  PKG + +  K      +S+LE  PQSTQ  N +    P+TK++++ SP  
Sbjct: 1005 KKTRRGIVDTPKGLIGSISKSAIDKGTSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTA 1064

Query: 1103 -PSTAKTI-----TSRGVTEXXXXXXXXXXXXXXXXXRGVPDVREKGVNYKKTAP 1151
              S+AK++     +                       RGVP+V+EK     KT P
Sbjct: 1065 NKSSAKSVLVSPPSKATKVNRQTLSRNSLSSLSDLVSRGVPEVKEKSA--AKTVP 1117

>Kwal_14.2421
          Length = 1205

 Score =  414 bits (1064), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 277/665 (41%), Positives = 374/665 (56%), Gaps = 70/665 (10%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAG--SLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGN 58
           MYKLQVVLVPP          LP    + DNS     +     ++ +   R E     G 
Sbjct: 1   MYKLQVVLVPPGFSG--VTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTG- 57

Query: 59  TSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVT 118
            S+N +++S     H    + RK LHFTKPTN+L+ LA+EIVE+C K+YP L    E++T
Sbjct: 58  -SSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLT 116

Query: 119 LQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGD--RTIY-MKKRKLNTXXXXXX 175
           LQD NECDLDPD++VKDVFN+DN VR +LRND+ E + D  +T+Y  K+R+LN+      
Sbjct: 117 LQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDI-ELSDDQSQTLYSAKRRRLNS-----S 170

Query: 176 XXXXXXXXXXLNVAKKRASI--KTSALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKXX 233
                     L++AKKR  +   +SA+RVSTPLANQIYPP T +QVNSD+EDDDV D+  
Sbjct: 171 LPNPSGQPNVLHIAKKRPHMLRNSSAMRVSTPLANQIYPPATGRQVNSDYEDDDVGDRSV 230

Query: 234 XXXXXXXXXXXXXXXGMDQ-KRINMNDNAVSKSETVDPNKSRQQRLPSGTPMRPVS--MV 290
                          G+   K+IN N++ VS+SE VDP+KSRQQRLPSGTPMR ++    
Sbjct: 231 LPPPQPQSQPIRISSGVGSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPMRHINNGTA 290

Query: 291 ETPNRVSLTGPTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASP 350
            TPNR+++   T L    V+ KS+ATP+ TN RITSGMLRIPEP++SE+E EL++GPASP
Sbjct: 291 TTPNRLNVLDGT-LQADEVTNKSSATPVATNKRITSGMLRIPEPKISEIENELRQGPASP 349

Query: 351 AVDLPARPSRIPMKKPYNPSMQQDEDLXXXXXXTEDNVPAVPYENE--LERSGPTMATRQ 408
           + +LP RP RIPMKK   P   Q +D         +N   +   N   LE      A+RQ
Sbjct: 350 SAELPPRPDRIPMKKQQFP---QSDDEEQSQSSGNENPTLMEKANNLILEHGSKPSASRQ 406

Query: 409 SSSTIADDQGSPTKKSRFEKNNIGLVELPS-----PRKSSLEKKVSKLNKGLASDKGHE- 462
           +S  IAD+ GSP K    +  N+ L ELP       RKSSLE KV  L K  A++   E 
Sbjct: 407 TS--IADNNGSPIKDGN-KIGNVNLAELPQVGRRITRKSSLESKVESLIKS-ATNLSEEA 462

Query: 463 --------DSTGGITRKDHFSDEESEASQ-----NGSVVVNRPETQREKSFQKSELLKIF 509
                   D++    RKD FS+E+    Q     N +V VN  +     SFQKSELL + 
Sbjct: 463 RGDLQRLKDNSNNAIRKDTFSEEDDMEGQLPEDPNDTVRVNHLDNSGNSSFQKSELLSML 522

Query: 510 NSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQRHAA 569
              +F++P  F   +           R    YV      I  +S D +N   +R QR AA
Sbjct: 523 KGNKFNIPSDFNKRS----------LRSNTGYVETGGNKISINSTDAKN---QRQQRGAA 569

Query: 570 QKAAQSISSGTSRSNVFSGEEKNKYSEENQGDNIASD--DNEGVYVHESNALKKLNVHPL 627
           +KA++ +SSG S+      +++     + +   I +D  +N  V V E+ AL+KLN+HPL
Sbjct: 570 RKASRLLSSGKSK------DQEESSESDEESSGIETDRSENGRVNVVENQALRKLNIHPL 623

Query: 628 KESVV 632
           KE V+
Sbjct: 624 KERVI 628

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 1045 KKPRRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEATNT------APLTKLLD 1098
            +K RRGIV  PKG++ +  K   +   S +E  PQSTQ  + +T+        P+T++++
Sbjct: 1020 RKSRRGIVDTPKGAIISLPKRGKKGDLSGVENAPQSTQQGHVSTSAEKTPAKVPVTRMME 1079

Query: 1099 HISPPS 1104
              SP S
Sbjct: 1080 MSSPVS 1085

>Scas_675.24
          Length = 1319

 Score =  299 bits (766), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 188/437 (43%), Positives = 247/437 (56%), Gaps = 49/437 (11%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQ-GHAQPISTSSIAGGRGEFSSGIGNT 59
           MYKLQVVLVPPS    L  +  PA   D+S F   G+   I   S+  G G+ S    N 
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60

Query: 60  SANAVYLSGLVG-AHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVT 118
             N + +  ++   +  +A+ +KFLHFTKPTNSL  L+DE++ KC KMYP L E+ EI+T
Sbjct: 61  --NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILT 118

Query: 119 LQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-EAAGDRTIY--MKKRKLNTXXXXXX 175
           LQD+N CDLDPDF VKD+FN+DN V VL++N+LD  +AG  +IY   K++KLN       
Sbjct: 119 LQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGGAQQL 178

Query: 176 XXX-XXXXXXXLNVAKKRASIKT----------SALRVSTPLANQIYPPPTKKQV-NSDF 223
                      L + KKR S  +          S LR+STPLANQIYP P  K   NSD 
Sbjct: 179 KTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMKMTNNSDD 238

Query: 224 EDDDVADKX-XXXXXXXXXXXXXXXXGMDQ-KRIN---MNDNAVSKSETVDPNKSRQQRL 278
           E DDV ++                  G++Q KRI    + ++ VS+S TVDP+KS+QQ +
Sbjct: 239 ERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEEDTVSRSGTVDPDKSKQQVM 298

Query: 279 PSGTPMRPVSMVETPNRVSLTGPTVLSESTVSQKSTAT------------------PIIT 320
             GT   P +   TPNRV+LTG  VLSE+  +  +                     P ++
Sbjct: 299 LPGT---PANYTMTPNRVTLTGQRVLSENYNTNGNNNGLIFVSSTQGPNKSQQGQQPTLS 355

Query: 321 NIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLXXX 380
             RITSGMLRIPEPR++E+E+EL EGP+SPA  LPA+  RIPMKKPY  +M+QD+     
Sbjct: 356 TPRITSGMLRIPEPRIAEIERELHEGPSSPASALPAKSDRIPMKKPYLETMEQDD---SD 412

Query: 381 XXXTEDN-VPAVPYENE 396
              T DN V  +P E E
Sbjct: 413 RESTSDNEVTPIPIEEE 429

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 42/109 (38%), Gaps = 5/109 (4%)

Query: 1048 RRGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQ-----IPNEATNTAPLTKLLDHISP 1102
            RR +V  PKG +S   K   Q+  S+LE +PQSTQ      P  A      T    H S 
Sbjct: 1133 RRLVVATPKGELSFIPKKPSQTDFSDLENMPQSTQPQQKSPPKLAKQPPKQTSDAAHKSE 1192

Query: 1103 PSTAKTITSRGVTEXXXXXXXXXXXXXXXXXRGVPDVREKGVNYKKTAP 1151
             +   +     + E                 RG+PDV+E   N   + P
Sbjct: 1193 SNVVVSKPVNDIKEASTTIKPSLSSLSDLVSRGIPDVKENKANKSNSKP 1241

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  282 bits (721), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 194/503 (38%), Positives = 272/503 (54%), Gaps = 83/503 (16%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60
           MYKLQVVLVPPS++  +P+           G+    A+   +S +   R   +   G+ S
Sbjct: 1   MYKLQVVLVPPSLQATMPI---------QFGYGPTIAE---SSQLLPNRTNMAQSAGDAS 48

Query: 61  ANAVYLSG----LVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEI 116
                L         ++  ++R RKFL FTKPTN+L  L+DEI++KC KMYP L E+ EI
Sbjct: 49  LQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEI 108

Query: 117 VTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRN--DLDEAAGDRTIY--MKKRKLNTXXX 172
           ++LQD + CDLDPDF+VKDVFN++N VRV+L+N  DLD++A   ++Y  +K+ KLN    
Sbjct: 109 LSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAP-VSLYKSVKRSKLNNGSP 167

Query: 173 XXXXXXXX--XXXXXLNVAKKR-----------ASIKTSALRVSTPLANQIYPPPTKKQV 219
                          L +AKKR            S    ++RVSTPLA QIYPPP+ K V
Sbjct: 168 QSVQPQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIV 227

Query: 220 --NSDFEDDDVADKX-XXXXXXXXXXXXXXXXGMDQ-KRIN---MNDNAVSKSETVDPNK 272
             NSD ED+D+ ++                  G+D  K+I    + ++ VS+S TVDP+K
Sbjct: 228 SNNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDK 287

Query: 273 SRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSE------------------------ST 308
           ++QQRL SGT   P+    TPNRV+LTG  V+SE                        + 
Sbjct: 288 TKQQRLLSGT---PIMSTMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAV 344

Query: 309 VSQKSTATPIITNIRITSGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYN 368
            +Q     P +T  RITSGML+IPEPR+SE+EKELKEGP+SPA  LPA+ ++IPMKKPY 
Sbjct: 345 TAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPY- 403

Query: 369 PSMQQDEDLXXXXXXTEDNVPAVPYENELERSGP--TMATRQSSSTIADDQGSPTKKSRF 426
             ++  E+       + +N        E   + P    + ++S S+IAD+ GSP K S  
Sbjct: 404 --LENGENYESDDSSSSEN-------QETPETEPHSKASLQRSQSSIADNNGSPVKNSPL 454

Query: 427 EK---NNIGLVELPSPRKSSLEK 446
                +N+ L ELP    +S+ K
Sbjct: 455 GDAMPHNVHLAELPKASNTSITK 477

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 83/160 (51%), Gaps = 33/160 (20%)

Query: 492 PETQREKSFQKSELLKIFNSKRFDLPPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDN 551
           P+     SF KS+L K+      DLP  FK   S     +S  S+  KPY TVLNKDIDN
Sbjct: 608 PQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSR----TSGNSKNSKPYTTVLNKDIDN 663

Query: 552 SSPDPRNIIPRRTQRHAAQKAAQSISSGTSRSNVFSGEEKNKYSEENQGD--NIASDDNE 609
           S PDPRNI+P+RT R AA++AAQ          + +G +KN+  +++  D  + AS D+E
Sbjct: 664 SKPDPRNILPQRTPRSAAKRAAQ----------LLAGAKKNEVPQKSTEDSSSAASTDDE 713

Query: 610 ---GVYVHES--------------NALKKLNVHPLKESVV 632
              G+    S              N  K +++H LK SVV
Sbjct: 714 SESGIETDFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVV 753

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  245 bits (626), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 184/477 (38%), Positives = 255/477 (53%), Gaps = 61/477 (12%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPI----STSSIAGGRGEFSSGI 56
           MYKLQV+LVPPSI+     +    G  +NS   Q    P     + ++   G+ +  S I
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60

Query: 57  G--NTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEP 114
               T +N+   S L   +  +   +KFLHFTK  N+L +L+DEI +KC  MYP L  + 
Sbjct: 61  FPVLTRSNS---SLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADL 117

Query: 115 EIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEA-----AGDRTIYMKKRKLN- 168
           +I++LQD N CDLDPDFVVKDVFN+DN VRV+L ++LD +     +  R+I  K+R+LN 
Sbjct: 118 DILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSI--KRRRLNP 175

Query: 169 -TXXXXXXXXXXXXXXXXLNVAKKRAS----IKTSA---LRVSTPLANQIYPPPTKKQ-V 219
            +                + V KKR S    IK  +    R+STPLA Q+YPP    +  
Sbjct: 176 ESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQ 235

Query: 220 NSDFEDDDVADKX-XXXXXXXXXXXXXXXXGMDQK------RINMNDNAVSKSETVDPNK 272
           NSD  D++VAD+                  G+D        RI   D  VS+S TVDP+K
Sbjct: 236 NSD--DEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQD-TVSRSATVDPDK 292

Query: 273 SRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSES-------TVSQKSTATPIITNIRIT 325
           SRQQRL SGT   PV    TPNRV+LTG  V+SE        T + +    P  +  RIT
Sbjct: 293 SRQQRLLSGT---PVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSR-RIT 348

Query: 326 SGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLXXXXXXTE 385
           SGML+IPEP+++E+EKEL EGP+SP+  LP  P +IPMKKP+   ++ +         TE
Sbjct: 349 SGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPF---IETERYYSEDSSETE 405

Query: 386 DNVPAVPYENELERSGPTMATRQSSSTIADDQGSPTKKSRFEKNNIGLVELPSPRKS 442
            N   +  ++ L R           ++IAD+ GSP  ++ F    + L +LP  +KS
Sbjct: 406 SNSGEINAKSSLHR----------QTSIADNNGSPL-RTNFLNEAVHLADLPELQKS 451

>Scas_711.38
          Length = 998

 Score =  213 bits (542), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 230/412 (55%), Gaps = 57/412 (13%)

Query: 78  RGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVTLQDVNECDLDPDFVVKDVF 137
           + +KFL FTKPTN L+ L+ EIVEKC  MYP L+EE EI TL+D  +CDLDPDF+V++VF
Sbjct: 63  KNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEEVF 122

Query: 138 NMDNTVRVLLRNDLDEAAGDR-TIY--MKKRKLNTXXXX--XXXXXXXXXXXXLNVAKKR 192
           +  N V+V+L+ND+D  + ++ + Y  +K+RK NT                    + +K+
Sbjct: 123 SSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPRKQ 182

Query: 193 ----ASIKT---SALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKX-XXXXXXXXXXXX 244
               +S KT      R+STPLA QIYP   ++  N   ED + AD+              
Sbjct: 183 YLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENE--EDRNAADRSFLPPPAQPQSPQI 240

Query: 245 XXXXGMDQ-KRIN--MNDNAVSKSETVDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTGP 301
               G+D+ K+I+    D++VS+SE VDP+KS+QQRL  GT   P+    TPNRV+LTG 
Sbjct: 241 RVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGT---PIMTTMTPNRVTLTGQ 297

Query: 302 TVLSESTVS--------QKSTATPII---TNIRITSGMLR-IPEPRLSEVEKELKEGPAS 349
            V+SES  S         K  +T  +   +N R+ S +L+ IPEP+++EVEK LK GP+S
Sbjct: 298 RVVSESHTSNSLQFIPNNKENSTQRLSSNSNRRVNSAVLKNIPEPKITEVEKVLKAGPSS 357

Query: 350 PAVDLPARPSRIPMKKPYNPSMQQDEDLXXXXXXTEDNVPAVPYENELERSGPTMATRQS 409
           PA  LP +  R+PMK+P+   +            +++N+ +       + S  +  T Q 
Sbjct: 358 PASLLPEKSERLPMKRPFLTGV--------SSSYSDENISS-------DSSTHSRPTLQR 402

Query: 410 SSTIADDQGSPTKKSRFEKNN---IGLVELPSPRKSSLEKKVSKLNKGLASD 458
            S+IAD+ GSP K S  E+NN   + L ELP      L+K V+++   L S+
Sbjct: 403 QSSIADNNGSPVKNSPNEENNPDSMQLAELP------LDKNVARVQNDLLSE 448

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 104/202 (51%), Gaps = 34/202 (16%)

Query: 461 HEDSTGGITRKDHFSDEESEASQNGSVVVNRP----ETQREKSFQKSELLKIFNSKRFDL 516
           H++  G IT  +  +D+E EA  N +V +N P    +     S QK ++LKIF  +   +
Sbjct: 529 HQNRNGQITPSEE-TDDEDEA--NTTVRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKI 585

Query: 517 PPRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQRHAAQKAAQSI 576
           P   K S S        +S+++KPY TVL KDIDNS PDPRNI+P RT R AA++AAQ +
Sbjct: 586 PSWLKGSKS--------KSQRRKPYTTVLYKDIDNSKPDPRNILPERTPRSAAKRAAQLL 637

Query: 577 SSGTSRSN---------------VFSGEEKNKYSEENQG----DNIASDDNEGVYVHESN 617
           S      N               VF   E+ ++S +       +   S++ E V + E+N
Sbjct: 638 SGSQLARNQSKEGEEEQEESNEEVFDNSEQEEFSSDEDSSSGIETADSEEMERVMITENN 697

Query: 618 ALKKLNVHPLKESVVQDTLTGA 639
            +K +  H LKE+VV   +T +
Sbjct: 698 KVKVIKAHALKEAVVPKLVTSS 719

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  136 bits (343), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 167/362 (46%), Gaps = 78/362 (21%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60
           MYKLQVVL+ P  + +L   G    S+D                            G+ S
Sbjct: 1   MYKLQVVLIQP--QNQLKANGY---SID----------------------------GDNS 27

Query: 61  ANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGL-AEEPEIVTL 119
            +    +   G HI R   RKFLHFTKP N+L +LADEI  +  K+Y  L  E  EI++L
Sbjct: 28  DDQTITTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSL 87

Query: 120 QDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-------------EAAGDRTIYMKKRK 166
           QD+N CDLD  ++VKDVF+MDNTV V+L+N+L+               AG  + Y   RK
Sbjct: 88  QDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRK 147

Query: 167 LNTXXXXXXXXXXXXXXXXLNVAKKRASIKTSA-----LRVSTPLANQIYPPP------- 214
             +                  +  KR+     A     LRV++PLAN+I           
Sbjct: 148 RRSSKAFGNSSRIEPQI----LVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVV 203

Query: 215 TKKQVNSDFEDD--DVADKX-XXXXXXXXXXXXXXXXGM-DQKRI---NMNDNAVSKSET 267
             + V++ F  +   + D+                  G+ D KRI   + N + VS+SE 
Sbjct: 204 INRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEV 263

Query: 268 VDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSES-----TVSQKSTATPIITNI 322
           VDP+KS+QQ +    P  P+  + TPNRV+L+G  V+SES       S+K   +PI  +I
Sbjct: 264 VDPDKSKQQLI---VPDIPMEFISTPNRVNLSGQRVISESQPKSLVFSKKRINSPINNHI 320

Query: 323 RI 324
            +
Sbjct: 321 DV 322

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 116/244 (47%), Gaps = 38/244 (15%)

Query: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDN----SGFAQ------GHAQPISTSSIAGGRG 50
           M++LQ+VLVPPS +    ++      L+     S   Q       H   I+  S      
Sbjct: 4   MWRLQIVLVPPSAQD---IITFLEARLNTPQSVSPMVQYNEDIITHNNSINNCSDPSPTS 60

Query: 51  EFSSGIGNTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGL 110
             S     ++ ++ +++ L          +KFLHFT   N+L +L++EI+ K  ++YP  
Sbjct: 61  PSSQNSIQSNRSSDFINYLPNC-------KKFLHFTDGDNTLLQLSNEILTKFDRLYPNF 113

Query: 111 AEEPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTIYM-----KKR 165
            E  EIV+LQD + CDLD +F++KDVF  D  V V+L+++LD +       +     ++R
Sbjct: 114 KESIEIVSLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRRR 173

Query: 166 KLN---TXXXXXXXXXXXXXXXXLNVAKK-------RASIKTSAL---RVSTPLANQIYP 212
           + N   T                 +++ K       ++S+K + +   RVSTPL N+I P
Sbjct: 174 QDNKPSTKSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILP 233

Query: 213 PPTK 216
             +K
Sbjct: 234 LASK 237

>CAGL0E06644g 664873..667977 tr|Q9Y7E9 Candida glabrata Flo1p-related
            lectin, identified start
          Length = 1034

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1071 SSELEGVPQSTQIPNEATNTAPLTKLLDHISPPSTAKTIT 1110
            +S++ G+   T+ PNE  N  P+TK + H+  P T  T T
Sbjct: 277  TSKIIGIDYHTETPNE--NLVPITKTIYHLGIPCTGTTTT 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.305    0.123    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,013,103
Number of extensions: 1457855
Number of successful extensions: 4996
Number of sequences better than 10.0: 232
Number of HSP's gapped: 5018
Number of HSP's successfully gapped: 269
Length of query: 1199
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1086
Effective length of database: 12,684,275
Effective search space: 13775122650
Effective search space used: 13775122650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 67 (30.4 bits)