Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL180C29729213740.0
KLLA0C09372g2943023069e-33
Kwal_14.24142932862455e-24
YKR011C3533142107e-19
Scas_675.263193082071e-18
CAGL0B03201g3181571276e-08
YJL194W (CDC6)513105690.93
YMR288W (HSH155)971109662.8
YBR093C (PHO5)46786653.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL180C
         (292 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...   533   0.0  
KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...   122   9e-33
Kwal_14.2414                                                           99   5e-24
YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...    86   7e-19
Scas_675.26                                                            84   1e-18
CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...    54   6e-08
YJL194W (CDC6) [2731] chr10 (69337..70878) Protein that regulate...    31   0.93 
YMR288W (HSH155) [4242] chr13 (845570..848485) U2 snRNP protein,...    30   2.8  
YBR093C (PHO5) [284] chr2 complement(429505..430908) Acid phosph...    30   3.2  

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/292 (89%), Positives = 262/292 (89%)

Query: 1   MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITG 60
           MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITG
Sbjct: 1   MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITG 60

Query: 61  NLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERG 120
           NLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERG
Sbjct: 61  NLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERG 120

Query: 121 GLPRELQGLREGLDMEYVWDCLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDCVTLRG 180
           GLPRELQGLREGLDMEYVWDCLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDCVTLRG
Sbjct: 121 GLPRELQGLREGLDMEYVWDCLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDCVTLRG 180

Query: 181 XXXXXXXXXXXXXSKRAVRSQLRAYDXXXXXXXXXXXXXXXXXESLLPADSRESSVSSVH 240
                        SKRAVRSQLRAYD                 ESLLPADSRESSVSSVH
Sbjct: 181 VVALAALQATVQTSKRAVRSQLRAYDRRVRAASTPASTRTSSPESLLPADSRESSVSSVH 240

Query: 241 YTYGLPATQLDANFKTYFRSMAENFELFEEPALALRGRVAKPRKKAAGRHGH 292
           YTYGLPATQLDANFKTYFRSMAENFELFEEPALALRGRVAKPRKKAAGRHGH
Sbjct: 241 YTYGLPATQLDANFKTYFRSMAENFELFEEPALALRGRVAKPRKKAAGRHGH 292

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score =  122 bits (306), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 146/302 (48%), Gaps = 34/302 (11%)

Query: 9   MEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGCDT 68
           M+++YVY+GEN P+V L  ++    +EE+  Y+ R+QD + L+L  VETITGNLKI  ++
Sbjct: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNS 60

Query: 69  HADCEAC---PFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLP-R 124
           H+D       PFYILEY      YSLWK+  ++W+L S +AT+Y G+         LP R
Sbjct: 61  HSDDTDDHDKPFYILEYCVAEDTYSLWKSR-SEWKLSSAIATLY-GSNT----LTDLPDR 114

Query: 125 ELQGLREGLDMEYVWDCLRRLNL-PLEQIDWAEFRELLESMLAAKRVADD-DCVTLRGXX 182
            ++ L++   +  V + L+  N+    +IDW      L     A+ +    D   L+   
Sbjct: 115 LVEALKDSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARELKKPIDPYELKTSM 174

Query: 183 XXXXXXXXXXXSKRAVRSQLRAYDXXXXXXXXXXXXXXXXXESLLPADSRESSVSSVHYT 242
                      +KR + S L +YD                        + ++      YT
Sbjct: 175 ALSLLRSMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSAS-----TKANKNITFQSDYT 229

Query: 243 YGLPATQLDANFKTYFRSMAENFELFEE-----------PALALR-----GRVAKPRKKA 286
           + +P+TQL +NF T+F+SMAENFE ++            P+ A       G+V KP +K 
Sbjct: 230 H-MPSTQLQSNFNTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKTPAGQVHKPARKG 288

Query: 287 AG 288
            G
Sbjct: 289 NG 290

>Kwal_14.2414
          Length = 293

 Score = 99.0 bits (245), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 129/286 (45%), Gaps = 19/286 (6%)

Query: 1   MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITG 60
           M S      +E+YV  G++   V+L L+  +  + +V  ++  VQD +++ L    TIT 
Sbjct: 1   MTSSDTHAAQEIYVPIGDDQ-SVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITD 59

Query: 61  NLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERG 120
           NLKI C +H  C +CP YILE+++V+  Y+LWK+   DW L  ++ ++Y    G  R   
Sbjct: 60  NLKIQCVSHRACNSCPLYILEFDDVSQGYALWKSP-GDWALGIMLTSLYATKNGARRVHP 118

Query: 121 GLPREL-QGLREGLDMEYVWDCLRRLNLPLEQIDW-AEFRELLESMLAAKRVADD----- 173
            L   + + +    D  ++ + L++LN+  + ID   +F   L+ +  A  +        
Sbjct: 119 TLKALVAEQVSSKHDAPFLMETLQKLNVDWDNIDTRFDFTLFLKLLEEALELEIGTRDYS 178

Query: 174 ---DCVT---LRGXXXXXXXXXXXXXSKRAVRSQLRAYDXXXXXX----XXXXXXXXXXX 223
              D VT    +              SKR +   L  YD                     
Sbjct: 179 SYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLS 238

Query: 224 ESLLPADSRESSVSSVHYTYGLPATQLDANFKTYFRSMAENFELFE 269
           +S++ + S  +S       Y L + QL  NF+ +FR+MAE FE F+
Sbjct: 239 DSIVHSRSPSTSAPVPDDEYLLSSKQLVTNFQNHFRNMAETFETFD 284

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 131/314 (41%), Gaps = 53/314 (16%)

Query: 8   EMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGC- 66
           ++E +Y+Y+GE  PRV+L  ++    + +V  +V  +Q+ Y + L T ETIT NLKI C 
Sbjct: 3   KLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDCA 62

Query: 67  DTHADCEACP-FYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLPRE 125
             +      P FYILEY E++  + +WK +D  W+L+ + A +Y        +       
Sbjct: 63  PAYLKPNCIPHFYILEYEEISDTFFIWK-SDGRWQLNKLSALLYVDNDANVVKNTSWKEV 121

Query: 126 LQGLREGLDME---YVWDCLRRLNLPLEQID----WAEFRELLESMLAAKRVADDDCV-- 176
            Q  +   + +   ++ +CL ++N  L +++    W+++ ++ +S+   K+  +   +  
Sbjct: 122 FQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNMEV 181

Query: 177 --TLRGXXXXXXXXXXXXXSKRAVRSQLRAYDXXXXXXXXXXXXXXXXX----------- 223
               +              +KR + + L+ Y                             
Sbjct: 182 FDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEPS 241

Query: 224 -------------ESLLPAD-SRESSVSSVHYTYGLPATQ--------------LDANFK 255
                         SL P+  S +    S  Y Y  P ++              + +NF+
Sbjct: 242 ASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNFE 301

Query: 256 TYFRSMAENFELFE 269
           +YF+ MAE++E F+
Sbjct: 302 SYFKLMAEDYETFD 315

>Scas_675.26
          Length = 319

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 130/308 (42%), Gaps = 46/308 (14%)

Query: 10  EELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGCDTH 69
           E +Y+Y G+N P+V+L  +R+++   ++  Y   +QD Y +     ETIT NLK+   + 
Sbjct: 5   ETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENLKLT--ST 62

Query: 70  ADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLPRELQGL 129
           +     P +I+EYNE+   + +WK ++  W +  IV  +Y     P + +   P    G 
Sbjct: 63  SSLATSPTFIIEYNEIYDSFYVWK-SEGKWEMTDIVTQIYNTQSQP-KAKTKTP---NGA 117

Query: 130 REGLDMEYVWD--------------CLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDC 175
            +  ++++  D               L  LN+    +D  EF   L+++        ++ 
Sbjct: 118 TKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMGNES 177

Query: 176 VTLRGXXXXXXXXXXXXXSKRAVRSQLRAYDXXXXXXXXXXXXXXXXXE--------SLL 227
            + +              +K+ ++  +  Y                  E        + L
Sbjct: 178 -SCKSFIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAIEDSPLADL 236

Query: 228 PADSR--ESSVSSVHYTYGLPAT---------QLDANFKTYFRSMAENFELFEEPALALR 276
           P +    ++S S+ HY+Y  P+T         Q+ +NF  +F+  AE++ELF+     L+
Sbjct: 237 PIEEEGLKTSSSNQHYSYHQPSTRDSKDIVAKQVFSNFNRHFKVTAEDYELFD-----LK 291

Query: 277 GRVAKPRK 284
            +   PRK
Sbjct: 292 TKAGIPRK 299

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 19/157 (12%)

Query: 10  EELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGC--- 66
           E +YV  GEN   VRL  +      +E+  Y   +QD   ++    ETI  NLK+     
Sbjct: 4   ETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFLG 62

Query: 67  DTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVA-----TMYTGAGGPARERGG 121
           +TH      PFYI+E+N+   E+S+W+ +D  W  D  V      T++       + +  
Sbjct: 63  NTHIKS-GMPFYIVEFNDSDEEFSVWR-SDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120

Query: 122 LPRELQG---LREGLDMEYVWDCLRRLNLPLEQIDWA 155
             RE  G   ++E  +   + + L++LN     +DW+
Sbjct: 121 DWREFVGTKRMQEHPNKIELENSLKKLN-----VDWS 152

>YJL194W (CDC6) [2731] chr10 (69337..70878) Protein that regulates
           initiation of DNA replication, binds to origins of
           replication at the end of mitosis, directing the
           assembly and disassembly of MCM proteins and the
           pre-replication complex, member of the AAA+ family of
           ATPases [1542 bp, 513 aa]
          Length = 513

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%), Gaps = 6/105 (5%)

Query: 74  ACPFYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLPRELQGLREGL 133
           A P    EY +V    +    A ++ R DS+  T   G G  A+    + ++ Q L   L
Sbjct: 77  ALPARTAEYEQV---MNFLAKAISEHRSDSLYITGPPGTGKTAQLDMIIRQKFQSLPLSL 133

Query: 134 DMEYVWDCLRRLNLPLEQIDWAEFRELLESMLAAKRVADDDCVTL 178
                 D LR  N  L+ + W    EL +  L +  V   +C++L
Sbjct: 134 STPRSKDVLRHTNPNLQNLSWF---ELPDGRLESVAVTSINCISL 175

>YMR288W (HSH155) [4242] chr13 (845570..848485) U2 snRNP protein,
           homolog of human SAP155 U2 snRNP protein [2916 bp, 971
           aa]
          Length = 971

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 23/109 (21%)

Query: 18  ENMPRVRLCLLRRYSCVEEV---------------EAYVGRVQ-DRYTLRLGTVETITGN 61
           + M +  L +L++ S VE +               + +V RV  DR   ++ T  T+T  
Sbjct: 451 DEMKKTILLVLQKCSAVESITPKFLREEIAPEFFQKFWVRRVALDRPLNKVVTYTTVTLA 510

Query: 62  LKIGCDTHADC-------EACPFYILEYNEVTTEYSLWKAADADWRLDS 103
            K+GC    D        EA PF  +  + VT   +L   AD D RL++
Sbjct: 511 KKLGCSYTIDKLLTPLRDEAEPFRTMAVHAVTRTVNLLGTADLDERLET 559

>YBR093C (PHO5) [284] chr2 complement(429505..430908) Acid
           phosphatase, repressible, requires glycosylation for
           activity [1404 bp, 467 aa]
          Length = 467

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query: 5   QAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKI 64
            AR+    Y Y  EN     +       C +  + ++  + D++ +   T++T++     
Sbjct: 148 HARDFLAQYGYMVENQTSFAVFTSNSKRCHDTAQYFIDGLGDQFNI---TLQTVSEAESA 204

Query: 65  GCDTHADCEACPFYILEYN-EVTTEY 89
           G +T + C +CP +  + N ++  EY
Sbjct: 205 GANTLSACNSCPAWDYDANDDIVNEY 230

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,964,706
Number of extensions: 296108
Number of successful extensions: 595
Number of sequences better than 10.0: 10
Number of HSP's gapped: 587
Number of HSP's successfully gapped: 11
Length of query: 292
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 191
Effective length of database: 13,099,691
Effective search space: 2502040981
Effective search space used: 2502040981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)