Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL179W36035314110.0
CAGL0G07667g2581355073e-62
Kwal_14.24103731314851e-57
Scas_711.372671284527e-54
YKR013W (PRY2)3291314551e-53
KLLA0D02442g3681324581e-53
YJL079C (PRY1)2991234512e-53
YJL078C (PRY3)8811324694e-52
Scas_675.272901364181e-48
Sklu_956.13191224113e-47
CAGL0F05137g2271393992e-46
KLLA0D02420g2121313772e-43
Kwal_14.24092381263774e-43
AAL178W2051373596e-41
KLLA0C01496g4561372986e-30
AFR700W4341392862e-28
Kwal_33.131927991462559e-24
YJR151C (DAN4)116158977e-04
YIR006C (PAN1)148059840.024
CAGL0J04818g65454710.88
YHR018C (ARG4)46344637.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL179W
         (353 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   548   0.0  
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   199   3e-62
Kwal_14.2410                                                          191   1e-57
Scas_711.37                                                           178   7e-54
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   179   1e-53
KLLA0D02442g complement(207613..208719) some similarities with s...   181   1e-53
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   178   2e-53
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   185   4e-52
Scas_675.27                                                           165   1e-48
Sklu_956.1 YJL079C, Contig c956 998-1957                              162   3e-47
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   158   2e-46
KLLA0D02420g complement(206544..207182) some similarities with s...   149   2e-43
Kwal_14.2409                                                          149   4e-43
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   142   6e-41
KLLA0C01496g complement(113533..114903) some similarities with s...   119   6e-30
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   114   2e-28
Kwal_33.13192                                                         102   9e-24
YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of...    42   7e-04
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    37   0.024
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    32   0.88 
YHR018C (ARG4) [2304] chr8 complement(140003..141394) Argininosu...    29   7.8  

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/353 (79%), Positives = 279/353 (79%)

Query: 1   MQIXXXXXXXXXXXXXXXXHQHDRKKPHLVVVYGDVYVSGTDTFTKYYSKMTDKLPASGS 60
           MQI                HQHDRKKPHLVVVYGDVYVSGTDTFTKYYSKMTDKLPASGS
Sbjct: 1   MQISAVALSGAALLACASAHQHDRKKPHLVVVYGDVYVSGTDTFTKYYSKMTDKLPASGS 60

Query: 61  DGXXXXXXXXXXXXXXXXXXEPSAEPTSTEPTNLPEVTSSPATPVQXXXXXXXXXXXXXX 120
           DG                  EPSAEPTSTEPTNLPEVTSSPATPVQ              
Sbjct: 61  DGWSYSWSTATSWTSDSVSTEPSAEPTSTEPTNLPEVTSSPATPVQPTSAPEETFEEPTE 120

Query: 121 XXXXXXXXXXXXVKSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEP 180
                       VKSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEP
Sbjct: 121 STSAEPTSSPEPVKSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEP 180

Query: 181 VKSPEPVKSPEPVKXXXXXXXXXXXXXXQRSRPAGGQNGASFEEEILRAHNSRRQLHKDT 240
           VKSPEPVKSPEPVK              QRSRPAGGQNGASFEEEILRAHNSRRQLHKDT
Sbjct: 181 VKSPEPVKSPEPVKSAEPTSSPEPTGSPQRSRPAGGQNGASFEEEILRAHNSRRQLHKDT 240

Query: 241 KPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPEKAVKAWYDEISDYSY 300
           KPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPEKAVKAWYDEISDYSY
Sbjct: 241 KPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPEKAVKAWYDEISDYSY 300

Query: 301 SHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPAGNFLRRFG 353
           SHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPAGNFLRRFG
Sbjct: 301 SHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPAGNFLRRFG 353

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  199 bits (507), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 107/135 (79%), Gaps = 1/135 (0%)

Query: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENL 277
           N + F + +L  HN +R LH+DT PLTWS+ELA++A+++AN YDCSG LVHS  PYGENL
Sbjct: 117 NLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENL 176

Query: 278 AVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDY 337
           A+GY +P  +V AWYDEI DY+Y++P FS STGHF+Q+VWK +  +GCAVK CGG  GDY
Sbjct: 177 AIGY-SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDY 235

Query: 338 LICSYDPAGNFLRRF 352
           +ICSYDPAGNFL  F
Sbjct: 236 VICSYDPAGNFLGEF 250

>Kwal_14.2410
          Length = 373

 Score =  191 bits (485), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 1/131 (0%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F   IL+AHN++R LHKDT  L+WS+ELA +A+D+A++YDCSG L HS  PYGENLAVGY
Sbjct: 236 FASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGY 295

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   +V AWY EI DY +S+P++S STGHF+Q+VWK +  LGC +K CGG  GDY+ICS
Sbjct: 296 STT-GSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICS 354

Query: 342 YDPAGNFLRRF 352
           Y  AGNFL  F
Sbjct: 355 YKTAGNFLGEF 365

>Scas_711.37
          Length = 267

 Score =  178 bits (452), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 98/128 (76%), Gaps = 2/128 (1%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFA-NQYDCSGRLVHSDSPYGENLAVG 280
           F+  +L  HN +R LH++T PLTWSEELA++A+ +A N Y+C G+L+HS  PYGENLA G
Sbjct: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187

Query: 281 YPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLIC 340
           Y T   +V AWY+EIS+Y YS+P FS STGHF+QLVWKDT  +GCA+K C  + G YLIC
Sbjct: 188 Y-TLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246

Query: 341 SYDPAGNF 348
           SY+ AGNF
Sbjct: 247 SYNSAGNF 254

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  179 bits (455), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (72%), Gaps = 1/131 (0%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F   ++  HN++R LHKDT  LTWS+ LA +A+++A+ YDCSG LVHS  PYGENLA+GY
Sbjct: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   +V AWY+EI+ Y YS+P FS S GHF+Q+VWK T  +GC +K CGG  GDY+ICS
Sbjct: 252 GTT-GSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

Query: 342 YDPAGNFLRRF 352
           Y  AGN +  F
Sbjct: 311 YKAAGNVIGEF 321

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  181 bits (458), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 79/132 (59%), Positives = 99/132 (75%), Gaps = 1/132 (0%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F   +L  HN++R LHKDT  L+WS+ELA +A+++A+ YDCSG L HS  PYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   AV AWY EI DYS+S+P +S STGHF+Q+VWK T  +GC +K+CGG  GDY+ICS
Sbjct: 291 GTT-GAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICS 349

Query: 342 YDPAGNFLRRFG 353
           YDPAGN L  F 
Sbjct: 350 YDPAGNMLGTFA 361

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  178 bits (451), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 75/123 (60%), Positives = 96/123 (78%), Gaps = 1/123 (0%)

Query: 226 ILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPE 285
           +L  HN +R LHKDT  L+WS+ LA +A+D+A+ YDCSG L HS  PYGENLA+GY  P 
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGP- 224

Query: 286 KAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPA 345
            AV AWY+EIS+Y +S+P FS +TGHF+Q+VWK T  +GC +K CGG+ GDY+ICSYDPA
Sbjct: 225 AAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPA 284

Query: 346 GNF 348
           GN+
Sbjct: 285 GNY 287

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  185 bits (469), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 1/132 (0%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           FE ++L  HN  R LH DT PLTWS+ LA +A+++A+QYDCSG L HSD PYGENLA+GY
Sbjct: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   AV AWY EIS Y+YS+P FS STGHF+Q+VWK T  +GC  K CG +  +Y++CS
Sbjct: 85  -TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143

Query: 342 YDPAGNFLRRFG 353
           Y+P GN+L  F 
Sbjct: 144 YNPPGNYLGEFA 155

>Scas_675.27
          Length = 290

 Score =  165 bits (418), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 98/136 (72%), Gaps = 2/136 (1%)

Query: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENL 277
           N + F   +L  HN++R LH++T  L+WS++LA +A+++A+ YDCSG LVHS  PYGENL
Sbjct: 148 NLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENL 207

Query: 278 AVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGS-VGD 336
           A+GY     +V AWY+EIS Y YS+P FS + GHF+Q+VWK +  +GC +K C  +  G 
Sbjct: 208 ALGYDAV-GSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGS 266

Query: 337 YLICSYDPAGNFLRRF 352
           Y+ICSY+PAGNF+  F
Sbjct: 267 YVICSYNPAGNFIGEF 282

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 1/122 (0%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F   IL  HN +R LHKDT  LTWSE LA +A+ +A+ YDCSG L HS  PYGENLA+GY
Sbjct: 172 FASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALGY 231

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            +   AV AWY EIS Y +S+P++S STGHF+Q+VWK T  +GC +K C  S G Y+ICS
Sbjct: 232 -SATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICS 290

Query: 342 YD 343
           Y+
Sbjct: 291 YN 292

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  158 bits (399), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 95/139 (68%), Gaps = 4/139 (2%)

Query: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHS---DSPYG 274
           N + +++++L  HN +R+LHKDT  L W++ LA  A+ +A++YDCSG L H+       G
Sbjct: 83  NLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIG 142

Query: 275 ENLAVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSV 334
           ENLAVGY   + A+ AWYDEI  Y YS+P     T HF+QLVWKDTK++GCA K CGG +
Sbjct: 143 ENLAVGYDDID-AIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDL 201

Query: 335 GDYLICSYDPAGNFLRRFG 353
            +Y++C YDPAGN+   F 
Sbjct: 202 YNYIVCEYDPAGNWAGEFA 220

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  149 bits (377), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 90/131 (68%), Gaps = 2/131 (1%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F+ EIL  HNS R+ H+    L W+ ELA  A++FAN Y C+G+L HS  PYGENLA+GY
Sbjct: 76  FKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGY 134

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   AV AWY+E+  Y +++P F+ +TGHF+QLVWK+T  LGCA  +CG   G Y +C 
Sbjct: 135 NTTS-AVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193

Query: 342 YDPAGNFLRRF 352
           YDP GN + +F
Sbjct: 194 YDPPGNVIGKF 204

>Kwal_14.2409
          Length = 238

 Score =  149 bits (377), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281
           F+ ++L  HN  R LH D   L WS +L  FA+ +AN Y+C+G L+HS SPYGENLA+G+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341
            T   A  AWYDE+  Y+Y  P FS  TGHF+QLVWK + HLGCA   CG   G Y ICS
Sbjct: 162 NTT-AAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICS 220

Query: 342 YDPAGN 347
           YDP GN
Sbjct: 221 YDPPGN 226

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 87/137 (63%), Gaps = 4/137 (2%)

Query: 211 SRPAGGQNGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSD 270
           SRP    N  +F   +L  HN  R+ H    PL W+  L   A+ +AN+  C+G LVHS 
Sbjct: 62  SRPTAVNN--TFASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSG 118

Query: 271 SPYGENLAVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKC 330
            P+GENLA+GY +P  AV AWYDEI++Y +S P FS +TGHF+QLVW+ T  +GCA   C
Sbjct: 119 LPHGENLALGY-SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMC 177

Query: 331 GGSVGDYLICSYDPAGN 347
           G   G Y+IC YDP GN
Sbjct: 178 GPCYGLYIICQYDPPGN 194

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  119 bits (298), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 80/137 (58%), Gaps = 14/137 (10%)

Query: 224 EEILRAHNSRRQLHKDTKPLTWSEELAKFARD-----FANQYD-CSGRLVHSDSPYGENL 277
           E +L AHN  R  H+ T PL W+EELA +A D     F +  D C+ +L HS  PYGENL
Sbjct: 299 ESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENL 358

Query: 278 AVGYPT-PEKAVKAWYDEISDYSYSHPS----FSFSTGHFSQLVWKDTKHLGCAVKKC-G 331
           A G  + P   V  WYDEI+ Y Y++ +         GHF+QLVW  +  +GC+V KC  
Sbjct: 359 AAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSS 418

Query: 332 GSVGDYLICSYDPAGNF 348
           GSV  YLIC Y PAGN 
Sbjct: 419 GSV--YLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  114 bits (286), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 83/139 (59%), Gaps = 15/139 (10%)

Query: 225 EILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYD------CSGRLVHSDSPYGENLA 278
           E+++AHN++R LH+DT+PL W+ +L+ FA  + ++        C+  L HS+ PYGEN+A
Sbjct: 273 ELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGENIA 332

Query: 279 VGY----PTPEKAVKAWYDEISDYSYSHPSFSF----STGHFSQLVWKDTKHLGCAVKKC 330
            G     P   + V +WY+EI DY Y+     +    + GHF+QLVW  ++ +GCAV  C
Sbjct: 333 SGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVVYC 392

Query: 331 GGS-VGDYLICSYDPAGNF 348
             +  G Y++C Y P GN 
Sbjct: 393 SNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score =  102 bits (255), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 78/146 (53%), Gaps = 18/146 (12%)

Query: 220 ASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYD------CSGRLVHSDS-- 271
           A+    IL+ HN +R LH +T  L W + L+ +A ++AN         CSG L HS +  
Sbjct: 629 AATASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRD 688

Query: 272 PYGENLAVGYPT-PEKAVKAWYDEISDYSYSHPSFSF----STGHFSQLVWKDTKHLGCA 326
             GEN+A G  + P + V  WYDEISDY Y   +  +      GHF+Q+VW  T+ +GCA
Sbjct: 689 NQGENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCA 748

Query: 327 VKKCG-----GSVGDYLICSYDPAGN 347
           V +C      G    YL+C Y  AGN
Sbjct: 749 VVQCDTMAKYGQNSIYLLCEYKDAGN 774

>YJR151C (DAN4) [3042] chr10 complement(712170..715655) Member of
           the seripauperin (PAU) family of possible cell wall
           mannoproteins [3486 bp, 1161 aa]
          Length = 1161

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%)

Query: 134 KSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPE 191
            S EPT S +   S EPT+  E   SVEP++S++   S EP    E   S EP++S +
Sbjct: 479 SSVEPTRSSQVTSSAEPTTVSEFTSSVEPIRSSQVTSSAEPTTVSEVTSSVEPIRSSQ 536

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%)

Query: 134 KSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEP 192
           +S++ TSS EP    E TSS EP +S +   SAEP    E   S EP++S +   S EP
Sbjct: 461 RSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPIRSSQVTSSAEP 519

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
           +E TSS EP +S + TSS EP    E   S EP++S +   S EP    E   S EP++
Sbjct: 475 SEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPIRSSQVTSSAEPTTVSEVTSSVEPIR 533

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%)

Query: 134 KSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEP 192
           +S++ TSS EP    E TSS EP +S +   SAEP    E   S EP +S +   S EP
Sbjct: 389 RSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEP 447

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
           +E TSS EP +S + TSS EP    E   S EP +S +   S EP    E   S EP++
Sbjct: 451 SEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPIR 509

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%)

Query: 134 KSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPE 191
            S EPT S +   S EPT+  E   SVEP +S++   S EP    E   S EP +S +
Sbjct: 383 SSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQ 440

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
           +E TSS EP +S + TSS EP    E   S EP +S +   S EP    E   S EP +
Sbjct: 379 SEVTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTR 437

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 28/56 (50%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPE 191
           AEPT+  E   SVEPT S +   S EP   +E   S EP +S +   S EP    E
Sbjct: 373 AEPTTVSEVTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSE 428

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
           +E TSS EP +S + TSS EP    E   S EP +S +   S EP    E   S EP +
Sbjct: 403 SEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTR 461

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%)

Query: 136 AEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
           +E TSS EP +S + TSS EP    E   S EP +S +   S EP    E   S EP +
Sbjct: 427 SEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTR 485

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%)

Query: 143 EPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEP 192
           EP    E TSS EP +S +   SAEP    E   S EP +S +   S EP
Sbjct: 374 EPTTVSEVTSSVEPTRSSQVTSSAEPTTVSEFTSSVEPTRSSQVTSSAEP 423

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
            involved in organization of the actin cytoskeleton and in
            endocytosis, binds to the ARP2/3 complex to stimulate
            actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 137  EPTSSP-EPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPVK 194
            EP ++P +  K VE     +PV+S +PV+  +PV+  +PV+  +PV+  +PV+  +PV+
Sbjct: 1068 EPRATPFQEEKYVEVAQPTQPVQSTQPVQPTQPVQPTQPVQPTQPVQPTQPVQPTQPVQ 1126

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 133  VKSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKS 183
            V+ A+PT   +PV+S +P    +PV+  +PV+  +PV+  +PV+  +PV++
Sbjct: 1080 VEVAQPT---QPVQSTQPVQPTQPVQPTQPVQPTQPVQPTQPVQPTQPVQN 1127

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 134 KSAEPTSSPEPVKSVEPTSSPEPVKSVEPVKSAEPVKSPEPVKSPEPVKSPEPV 187
           KS E +  P PVKS    S+PEPVK+  PV    P K     K+ EPV+   PV
Sbjct: 528 KSEESSKVPTPVKS----STPEPVKTEMPVSKITPTKEN---KTMEPVRESTPV 574

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 158 KSVEPVKSAEPVKSPEPVKS--PEPVKSPEPVKSPEPVK 194
           K  EP KS E  K P PVKS  PEPVK+  PV    P K
Sbjct: 522 KEQEPKKSEESSKVPTPVKSSTPEPVKTEMPVSKITPTK 560

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 143 EPVKSVEPTSSPEPVKSV--EPVKSAEPVKSPEPVKSPEPVKSPEPVKSPEPV 193
           EP KS E +  P PVKS   EPVK+  PV    P K     K+ EPV+   PV
Sbjct: 525 EPKKSEESSKVPTPVKSSTPEPVKTEMPVSKITPTKEN---KTMEPVRESTPV 574

>YHR018C (ARG4) [2304] chr8 complement(140003..141394)
           Argininosuccinate lyase, catalyzes the final step in
           arginine biosynthesis [1392 bp, 463 aa]
          Length = 463

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 241 KPLTWSEELAKFARDFANQYDCSGRLVH--SDSPYGENLAVGYP 282
           +P+ WS  L+ +A  F   Y   G+++H  + SP G     G+P
Sbjct: 167 QPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALAGHP 210

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.128    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,473,161
Number of extensions: 423955
Number of successful extensions: 3185
Number of sequences better than 10.0: 108
Number of HSP's gapped: 2572
Number of HSP's successfully gapped: 469
Length of query: 353
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 250
Effective length of database: 13,030,455
Effective search space: 3257613750
Effective search space used: 3257613750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)