Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL178W2052018301e-114
KLLA0D02420g2121444329e-54
Kwal_14.24092381294192e-51
CAGL0G07667g2581303985e-48
YJL079C (PRY1)2991273842e-45
YJL078C (PRY3)8811253954e-44
KLLA0D02442g3681323787e-44
Scas_711.372671333655e-43
YKR013W (PRY2)3291303671e-42
Scas_675.272901313632e-42
Sklu_956.13191213557e-41
Kwal_14.24103731333525e-40
AAL179W3601373515e-40
CAGL0F05137g2271353061e-34
KLLA0C01496g4561432804e-29
AFR700W4341482348e-23
Kwal_33.131927991442243e-21
Kwal_26.758267975700.41
AGL178W64628651.7
KLLA0D03432g1483104642.6
Scas_718.8247139632.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL178W
         (201 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   324   e-114
KLLA0D02420g complement(206544..207182) some similarities with s...   171   9e-54
Kwal_14.2409                                                          166   2e-51
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   157   5e-48
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   152   2e-45
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   156   4e-44
KLLA0D02442g complement(207613..208719) some similarities with s...   150   7e-44
Scas_711.37                                                           145   5e-43
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   145   1e-42
Scas_675.27                                                           144   2e-42
Sklu_956.1 YJL079C, Contig c956 998-1957                              141   7e-41
Kwal_14.2410                                                          140   5e-40
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   139   5e-40
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   122   1e-34
KLLA0C01496g complement(113533..114903) some similarities with s...   112   4e-29
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    95   8e-23
Kwal_33.13192                                                          91   3e-21
Kwal_26.7582                                                           32   0.41 
AGL178W [4134] [Homologous to ScYGR109W-B - NSH; ScYIL082W-A - N...    30   1.7  
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    29   2.6  
Scas_718.82                                                            29   2.8  

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  324 bits (830), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/201 (78%), Positives = 158/201 (78%)

Query: 1   MRACLLIPLLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTETP 60
           MRACLLIPLLL                                           PLTETP
Sbjct: 1   MRACLLIPLLLVAATARTVTVSVTATRTVTVISAAAVTTLRTTVFTTAYRTQTTPLTETP 60

Query: 61  LSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLP 120
           LSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLP
Sbjct: 61  LSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLP 120

Query: 121 HGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPC 180
           HGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPC
Sbjct: 121 HGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPC 180

Query: 181 YGLYIICQYDPPGNVADQYVA 201
           YGLYIICQYDPPGNVADQYVA
Sbjct: 181 YGLYIICQYDPPGNVADQYVA 201

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  171 bits (432), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 101/144 (70%)

Query: 56  LTETPLSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLV 115
            TE   ++PTA +  F + +LD+HN  R++H    L W   L + AQ++AN  +CNG L 
Sbjct: 61  FTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPELASRAQNFANSYVCNGQLE 120

Query: 116 HSGLPHGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYV 175
           HS LP+GENLALGY+  +AV AWY+E+  YDF+ P F+  TGHFTQLVW++T+ +GCA++
Sbjct: 121 HSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFI 180

Query: 176 MCGPCYGLYIICQYDPPGNVADQY 199
            CG  YG Y +C+YDPPGNV  ++
Sbjct: 181 RCGQYYGQYTVCEYDPPGNVIGKF 204

>Kwal_14.2409
          Length = 238

 Score =  166 bits (419), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%)

Query: 71  FASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGYS 130
           F S +L+ HN +R  H A  LRW+S L   AQ YAN   CNG+L+HSG P+GENLALG++
Sbjct: 103 FQSQMLETHNRFRDLHDAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFN 162

Query: 131 PAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQYD 190
             AA +AWYDE+  Y++  PGFS  TGHFTQLVW+S+  +GCA + CG  YG Y IC YD
Sbjct: 163 TTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYD 222

Query: 191 PPGNVADQY 199
           PPGNVA QY
Sbjct: 223 PPGNVAGQY 231

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  157 bits (398), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 93/130 (71%), Gaps = 1/130 (0%)

Query: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           FA ++L+ HN  R  H    PL W+  L  +AQ+YAN   C+G+LVHSG P+GENLA+GY
Sbjct: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189
           SP  +V AWYDEI +Y+++ PGFS +TGHFTQ+VW+S+T VGCA   CG  +G Y+IC Y
Sbjct: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240

Query: 190 DPPGNVADQY 199
           DP GN   ++
Sbjct: 241 DPAGNFLGEF 250

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  152 bits (384), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 86/127 (67%), Gaps = 1/127 (0%)

Query: 75  VLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGYSPAA 133
           VL  HN  R  H   P L W+ TL ++AQ YA+   C+G+L HSG P+GENLALGY   A
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 134 AVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQYDPPG 193
           AV AWY+EI+ YDFS PGFS  TGHFTQ+VW+STT VGC    CG  +G Y+IC YDP G
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 194 NVADQYV 200
           N   +Y 
Sbjct: 286 NYEGEYA 292

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  156 bits (395), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 1/125 (0%)

Query: 71  FASAVLDLHNDYRRRH-HAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           F S VL+ HN +R  H    PL W+ TL T+AQ+YA++  C+G L HS  P+GENLALGY
Sbjct: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189
           +   AV AWY EI++Y++S PGFS +TGHFTQ+VW+ST  +GC Y  CG  +  YI+C Y
Sbjct: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSY 144

Query: 190 DPPGN 194
           +PPGN
Sbjct: 145 NPPGN 149

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  150 bits (378), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 1/132 (0%)

Query: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           FAS++LD HN  R  H   P L W+  L ++AQ+YA+   C+GSL HSG P+GENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189
               AV AWY EI +Y FS P +S +TGHFTQ+VW+STT VGC    CG  +G YIIC Y
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 190 DPPGNVADQYVA 201
           DP GN+   + +
Sbjct: 351 DPAGNMLGTFAS 362

>Scas_711.37
          Length = 267

 Score =  145 bits (365), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 88/133 (66%), Gaps = 2/133 (1%)

Query: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYA-NRILCNGSLVHSGLPHGENLALG 128
           F S++L+ HN  R  H    PL W+  L  +AQ YA N   C+G L+HSG P+GENLA G
Sbjct: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187

Query: 129 YSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQ 188
           Y+   +V AWY+EI+EYD+S PGFS +TGHFTQLVW+ T+ VGCA   C   +G Y+IC 
Sbjct: 188 YTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICS 247

Query: 189 YDPPGNVADQYVA 201
           Y+  GN   +Y A
Sbjct: 248 YNSAGNFDGEYEA 260

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  145 bits (367), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 1/130 (0%)

Query: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           F++++++ HN  R  H     L W+ TL T+AQ+YA+   C+G+LVHSG P+GENLALGY
Sbjct: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189
               +V AWY+EI  YD+S PGFS + GHFTQ+VW+ T+ VGC    CG  +G YIIC Y
Sbjct: 252 GTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSY 311

Query: 190 DPPGNVADQY 199
              GNV  ++
Sbjct: 312 KAAGNVIGEF 321

>Scas_675.27
          Length = 290

 Score =  144 bits (363), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (67%), Gaps = 2/131 (1%)

Query: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           FAS+VL+ HN  R  H   P L W+  L ++AQ+YA+   C+G+LVHSG P+GENLALGY
Sbjct: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPC-YGLYIICQ 188
               +V AWY+EI+ YD+S PGFS   GHFTQ+VW+S+T VGC    C    +G Y+IC 
Sbjct: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271

Query: 189 YDPPGNVADQY 199
           Y+P GN   ++
Sbjct: 272 YNPAGNFIGEF 282

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  141 bits (355), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 82/121 (67%), Gaps = 1/121 (0%)

Query: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129
           FAS++LD HN  R  H     L W+ TL  +AQ YA+   C+GSL HSG P+GENLALGY
Sbjct: 172 FASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALGY 231

Query: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189
           S   AV AWY EI+ YD+S P +S +TGHFTQ+VW+ST+ VGC    C   +G Y+IC Y
Sbjct: 232 SATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICSY 291

Query: 190 D 190
           +
Sbjct: 292 N 292

>Kwal_14.2410
          Length = 373

 Score =  140 bits (352), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 87/133 (65%), Gaps = 1/133 (0%)

Query: 68  NNTFASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLA 126
           N+ FAS +L  HN+ R  H     L W+  L ++AQ YA++  C+GSL HSG P+GENLA
Sbjct: 233 NSDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLA 292

Query: 127 LGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYII 186
           +GYS   +V AWY EI +YD+S P +S +TGHFTQ+VW+ ++++GC    CG   G Y+I
Sbjct: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVI 352

Query: 187 CQYDPPGNVADQY 199
           C Y   GN   ++
Sbjct: 353 CSYKTAGNFLGEF 365

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  139 bits (351), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 87/137 (63%), Gaps = 4/137 (2%)

Query: 62  SRPTAVNN--TFASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSG 118
           SRP    N  +F   +L  HN  R+ H    PL W+  L   A+ +AN+  C+G LVHS 
Sbjct: 211 SRPAGGQNGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSD 270

Query: 119 LPHGENLALGY-SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMC 177
            P+GENLA+GY +P  AV AWYDEI++Y +S P FS +TGHF+QLVW+ T  +GCA   C
Sbjct: 271 SPYGENLAVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKC 330

Query: 178 GPCYGLYIICQYDPPGN 194
           G   G Y+IC YDP GN
Sbjct: 331 GGSVGDYLICSYDPAGN 347

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  122 bits (306), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 78/135 (57%), Gaps = 8/135 (5%)

Query: 71  FASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPH-----GEN 124
           +   +LD HN  R  H     L WN  L   AQ YA+R  C+G+L H+  P      GEN
Sbjct: 87  WQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHN--PEFIEAIGEN 144

Query: 125 LALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLY 184
           LA+GY    A+ AWYDEI  YD+S P     T HFTQLVW+ T +VGCAY  CG     Y
Sbjct: 145 LAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNY 204

Query: 185 IICQYDPPGNVADQY 199
           I+C+YDP GN A ++
Sbjct: 205 IVCEYDPAGNWAGEF 219

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  112 bits (280), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 83/143 (58%), Gaps = 14/143 (9%)

Query: 66  AVNNTFASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRIL------CNGSLVHSG 118
           A+++    +VL+ HN+YR RH +  PL WN  L  +A  Y   +       CN  L HSG
Sbjct: 292 AISDADRESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSG 351

Query: 119 LPHGENLALGYS--PAAAVTAWYDEIAEYDFST-PGFSH---ATGHFTQLVWRSTTSVGC 172
            P+GENLA G +  PAA V  WYDEI  YD++   G SH     GHFTQLVW ++T VGC
Sbjct: 352 GPYGENLAAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGC 411

Query: 173 AYVMCGPCYGLYIICQYDPPGNV 195
           +   C     +Y+IC+Y P GNV
Sbjct: 412 SVTKCSSG-SVYLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 94.7 bits (234), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 79/148 (53%), Gaps = 17/148 (11%)

Query: 67  VNNTFASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRIL------CNGSLVHSGL 119
           +++  AS ++  HN  R  H    PL+WN+ L   A  Y + ++      C   L HS  
Sbjct: 266 LDHNVASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNG 325

Query: 120 PHGENLALGYSPAAA-----VTAWYDEIAEYDFST-PGFSH---ATGHFTQLVWRSTTSV 170
           P+GEN+A G S         V +WY+EI +YD++   G  H   A GHFTQLVW  +  V
Sbjct: 326 PYGENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEV 385

Query: 171 GCAYVMCG-PCYGLYIICQYDPPGNVAD 197
           GCA V C     G+YI+C+Y P GN+ D
Sbjct: 386 GCAVVYCSNNGKGIYILCEYHPVGNIED 413

>Kwal_33.13192
          Length = 799

 Score = 90.9 bits (224), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 76/144 (52%), Gaps = 20/144 (13%)

Query: 72  ASAVLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYAN------RILCNGSLVHSGL--PHG 122
           ASA+L  HN  R  H   P L W+  L   A +YAN      R +C+G L HS      G
Sbjct: 632 ASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQG 691

Query: 123 ENLALGYS--PAAAVTAWYDEIAEYDFS-TPGFSH---ATGHFTQLVWRSTTSVGCAYVM 176
           EN+A G +  P   V  WYDEI++YD+    G  H     GHFTQ+VW ST  VGCA V 
Sbjct: 692 ENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQ 751

Query: 177 CGPC--YG---LYIICQYDPPGNV 195
           C     YG   +Y++C+Y   GNV
Sbjct: 752 CDTMAKYGQNSIYLLCEYKDAGNV 775

>Kwal_26.7582
          Length = 679

 Score = 31.6 bits (70), Expect = 0.41,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 5/75 (6%)

Query: 109 LCNGSLVHSGLP-HGENLALGYSPAAAVTAWYDEIAE---YDFSTPGFSHATGHFTQLVW 164
           L  G + H  +  H  +   GY P  A+ A YD I     ++F  P      GH  +   
Sbjct: 84  LSGGQIFHEMMRRHKVDTVFGY-PGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYA 142

Query: 165 RSTTSVGCAYVMCGP 179
           R++   G   V  GP
Sbjct: 143 RASGKPGVVLVTSGP 157

>AGL178W [4134] [Homologous to ScYGR109W-B - NSH; ScYIL082W-A - NSH]
           complement(363877..365817) [1941 bp, 646 aa]
          Length = 646

 Score = 29.6 bits (65), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 3/28 (10%)

Query: 124 NLAL---GYSPAAAVTAWYDEIAEYDFS 148
           NLAL      P   ++AW++E++EYDF+
Sbjct: 609 NLALLQDQSGPVRRISAWFEELSEYDFT 636

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 13/104 (12%)

Query: 69  NTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALG 128
           +T+      +H  +    + +PLR+      +A+ +A R+ C G+LV +G P  EN++  
Sbjct: 661 STYMIQTPSMHPWFEWISYILPLRYAFENMLNAEFHARRMDCGGTLVPTG-PVYENVSSE 719

Query: 129 YSPAAAVTAWYDEI---------AEYDFSTPGFSHATGHFTQLV 163
           Y   A + +   E           +YD+S   +SH   +F  L+
Sbjct: 720 YKVCAFIGSQPGESYVLGDNYLKLQYDYS---YSHQWRNFGILI 760

>Scas_718.82
          Length = 471

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 5/39 (12%)

Query: 118 GLPHGENLALGYSPAAAVTAWYDEIA-----EYDFSTPG 151
           G P G +L LG + A  + AW ++++     E +FS PG
Sbjct: 375 GKPVGADLELGIATAPVLYAWREDVSLGPMIERNFSQPG 413

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.136    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,639,391
Number of extensions: 215451
Number of successful extensions: 418
Number of sequences better than 10.0: 21
Number of HSP's gapped: 398
Number of HSP's successfully gapped: 21
Length of query: 201
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 104
Effective length of database: 13,238,163
Effective search space: 1376768952
Effective search space used: 1376768952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)