Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL177W1198117657360.0
YJL080C (SCP160)1222115130850.0
Kwal_14.23971206114529170.0
Scas_711.361219114828390.0
KLLA0D02398g1205108128320.0
CAGL0M03223g1209114526730.0
Scas_612.2*71458830.15
Scas_515.634259820.15
CAGL0G04037g778182820.17
Kwal_14.168939528790.39
AER186C31649760.67
KLLA0E00847g713146741.5
CAGL0C05093g704155732.4
KLLA0D10021g50373713.1
KLLA0A10351g22879703.2
Kwal_55.20652694136704.4
YHL010C58579705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL177W
         (1176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  2214   0.0  
YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  1192   0.0  
Kwal_14.2397                                                         1128   0.0  
Scas_711.36                                                          1098   0.0  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...  1095   0.0  
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...  1034   0.0  
Scas_612.2*                                                            37   0.15 
Scas_515.6                                                             36   0.15 
CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces c...    36   0.17 
Kwal_14.1689                                                           35   0.39 
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    34   0.67 
KLLA0E00847g complement(87991..90132) some similarities with sgd...    33   1.5  
CAGL0C05093g complement(482106..484220) highly similar to sp|Q08...    33   2.4  
KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida ...    32   3.1  
KLLA0A10351g complement(906401..907087) similar to sp|Q9A7D3 Cau...    32   3.2  
Kwal_55.20652                                                          32   4.4  
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    32   5.0  

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2214 bits (5736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1101/1176 (93%), Positives = 1101/1176 (93%)

Query: 1    MESQAAVEEPQHSVVIXXXXXXXXXXXXXVADXXXXXXXXXXXXXXXXXXKRMPTRADFP 60
            MESQAAVEEPQHSVVI             VAD                  KRMPTRADFP
Sbjct: 1    MESQAAVEEPQHSVVIETPPTTAESSETPVADTATGAEPEGAGGAAVVAPKRMPTRADFP 60

Query: 61   PLSSVIFETQKVQWGPNMXXXXXXXXXXXXXXXXXXXXXXXMRSKTMQEAFSLDLQTQVT 120
            PLSSVIFETQKVQWGPNM                       MRSKTMQEAFSLDLQTQVT
Sbjct: 61   PLSSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSGAKPMRSKTMQEAFSLDLQTQVT 120

Query: 121  ISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVI 180
            ISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVI
Sbjct: 121  ISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVI 180

Query: 181  QVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXXXXXXXXXXQLINISLHGDVAS 240
            QVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKT            QLINISLHGDVAS
Sbjct: 181  QVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADLDDQLINISLHGDVAS 240

Query: 241  VNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAFPNGSEKIVLM 300
            VNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAFPNGSEKIVLM
Sbjct: 241  VNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVKAFPNGSEKIVLM 300

Query: 301  GPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKVSVIFPTALGD 360
            GPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKVSVIFPTALGD
Sbjct: 301  GPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKYKVSVIFPTALGD 360

Query: 361  DTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYDILKDI 420
            DTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYDILKDI
Sbjct: 361  DTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYDILKDI 420

Query: 421  KESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLTPSHVLAVD 480
            KESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLTPSHVLAVD
Sbjct: 421  KESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLTPSHVLAVD 480

Query: 481  DLDYELFHKDIKQALSKAEIPFVQLGDHYEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKV 540
            DLDYELFHKDIKQALSKAEIPFVQLGDHYEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKV
Sbjct: 481  DLDYELFHKDIKQALSKAEIPFVQLGDHYEGDNTVLLFAKVDEEDFQPSPEEVKEHLEKV 540

Query: 541  AAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSE 600
            AAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSE
Sbjct: 541  AAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITSAGGHAQIKLHTPSE 600

Query: 601  DEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFD 660
            DEITIRGDE         FESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFD
Sbjct: 601  DEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLAQIRQKFD 660

Query: 661  VQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGS 720
            VQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGS
Sbjct: 661  VQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKELIVPTKYHGSLIGS 720

Query: 721  QGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVP 780
            QGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVP
Sbjct: 721  QGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKALLDFEIENGHKSVINVP 780

Query: 781  VEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKA 840
            VEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKA
Sbjct: 781  VEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKA 840

Query: 841  VDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTN 900
            VDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTN
Sbjct: 841  VDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTN 900

Query: 901  KVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFN 960
            KVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFN
Sbjct: 901  KVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFN 960

Query: 961  VRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLI 1020
            VRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLI
Sbjct: 961  VRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIMVPAVYHAFVSERGQLI 1020

Query: 1021 NKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDN 1080
            NKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDN
Sbjct: 1021 NKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDN 1080

Query: 1081 IPWRLTYEHVDLSDILGEEGKHAMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKK 1140
            IPWRLTYEHVDLSDILGEEGKHAMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKK
Sbjct: 1081 IPWRLTYEHVDLSDILGEEGKHAMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKK 1140

Query: 1141 FNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDII 1176
            FNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDII
Sbjct: 1141 FNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDII 1176

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 158/369 (42%), Gaps = 56/369 (15%)

Query: 644  LIGPKGTNLAQIRQKF---DVQ---IDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAK 697
            ++GP G+ L     K    D++   +DVP+ +  TN  IT++G +  ++     +    +
Sbjct: 866  IVGPGGSTLKDFISKAGGDDIRNKTVDVPN-AESTNKVITISGPKTFVEKMSKALNQIVQ 924

Query: 698  KWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFP---KEGEVVTIKGPSRGV 754
                   KEL +P    G+LIG  G+ R +LE++++VRI+ P   KEG+V TI G    V
Sbjct: 925  DIKASVAKELNIPADRQGALIGPGGSVRRQLESQFNVRIEVPDKGKEGKV-TIHGRPEAV 983

Query: 755  NKAHAELKALLDFEIENGHKSVINVP-VEHVPRVIGKNGDVINGIRAELGVELKLLQNTK 813
             K   E+ + +   I + +   I VP V H    + + G +IN +R    + +K   ++K
Sbjct: 984  EKCEKEIFSTI---IRDSYDQEIMVPAVYHA--FVSERGQLINKLRMTYFINVKHGNSSK 1038

Query: 814  TAKEQNLDTVQLEITGSRQAIKEASK----AVDAIIAEASDFTTKQLEIDAKYHKLIVGP 869
             A + +     + I   R +  E +K     V A  A A+D    +L  +      I+G 
Sbjct: 1039 KANKLSRSEQPIPIERVRGSEGEGTKLTIEEVSAPEASANDNIPWRLTYEHVDLSDILGE 1098

Query: 870  GG--STLKDFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIK 927
             G  +  K+   +A  D I+ +    P A     +        + E + K  N++V    
Sbjct: 1099 EGKHAMTKEQALEAAADQIKERIELAPKANCIGYL--------WCENVKK-FNKVV---- 1145

Query: 928  ASVAKELNIPADRQGALIGPGGSVRRQLESQFNVRIEVPDKGKEGK--VTIHGRPEAVEK 985
                              GPGGS  +Q+    N  I VP K  +    + + G  E+VEK
Sbjct: 1146 ------------------GPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGTKESVEK 1187

Query: 986  CEKEIFSTI 994
              K I   +
Sbjct: 1188 ACKMICDAL 1196

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%)

Query: 642  SRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIA 693
            ++++GP G+N+ QIR+  +  I+VP +S+  +  I + G + +++ A   I 
Sbjct: 1142 NKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGTKESVEKACKMIC 1193

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 1192 bits (3085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/1151 (53%), Positives = 812/1151 (70%), Gaps = 29/1151 (2%)

Query: 53   MPTRADFPPL-SSVIFETQKVQWGPNMXXXXXXXXXXXXXXXXXXXX--XXXMRSKTMQE 109
            +P+  D P L S+  F   KV WGPNM                         MRSK +QE
Sbjct: 52   LPSLKDLPSLGSNAAFANVKVSWGPNMKPAVSNSPSPSPSAPSLTTGLGAKRMRSKNIQE 111

Query: 110  AFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELV 169
            AF+LDLQ+Q++I+K E S+ V SVK++H VS+ESTLSK +RTFL++G   NV+ AKRELV
Sbjct: 112  AFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELV 171

Query: 170  KKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXXXXXXXXXXQL 229
            KKLT+P+  VI+VPSK  +SIIG GGR IREI++A   +KI+++K               
Sbjct: 172  KKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYE-VKINVSKEVNENSYDEDMDDTT 230

Query: 230  INISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADV---EISEDVT 286
             N+SL GD  SVN AK KIL+IVKEETKNATI + VE+++ +P+I +++    E  E+V 
Sbjct: 231  SNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEVK 290

Query: 287  VKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVRE 346
            V+ F   S  IV++GPR++AK  K ++Q+YL  LAS + E+K+ IP KFQ LIDAE+++E
Sbjct: 291  VQ-FYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKE 349

Query: 347  KYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKN 406
            KY V V FP+   D+ VSF GL   + +AI YAR SSK Y+VESL++SKAH KN+ HAKN
Sbjct: 350  KYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKN 409

Query: 407  LMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIIN 466
            L+ YF KY +LK ++ES   VK+ LP+ + LP  + V+I+I +K+D A   K VRK++I+
Sbjct: 410  LIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELIS 469

Query: 467  IVNRLTPSHVLAVDDLDYELFHKDIKQAL--SKAEIPFVQLGDHYEGDNTVLLFAKVDEE 524
             VN + PS  L + DLDYELF   IK  L  S++ + FVQ GD+Y  DN++LL A  ++E
Sbjct: 470  FVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDE 529

Query: 525  DFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENI 584
            DF+PS EE++  L K    L+ +RTKQ+ + TK   F  E Q   F   S TW L++E+I
Sbjct: 530  DFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDI 589

Query: 585  TSAGGHAQIKLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPANTVSRL 644
            +   GH QIKLHTP E+++T+RGDE         FESI  +PS KSK+TV++PAN+V+RL
Sbjct: 590  SEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARL 649

Query: 645  IGPKGTNLAQIRQKFDVQIDVPSESN-----DTNTEITLTGLEYNLQHAKTHIASEAKKW 699
            IG KG+NL QIR+KF  QID+P+E N     D   E+TLTGLEYNL HAK ++A+EAKKW
Sbjct: 650  IGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKW 709

Query: 700  ADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHA 759
            ADI TKELIVP K+HGSLIG  GTYR RL+ KY+V I FP++ E+VTI+GPSRGVNKAH 
Sbjct: 710  ADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKAHE 769

Query: 760  ELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQN 819
            ELKALLDFE+ENGHK VINVP EHVPR+IGKNGD IN IRAE GVE+  LQ +   K Q 
Sbjct: 770  ELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQE 829

Query: 820  LDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFIS 879
               V+LEITGSRQ IK+A+K V++I+AEASDF T+ L+ID KYHK IVG GG  L++ IS
Sbjct: 830  TGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIIS 889

Query: 880  KAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPAD 939
            KAGG++IRNK+VD+PNA+S NK IT+ GP+ FV+K+ + +N+IV+D + SV K ++IPA+
Sbjct: 890  KAGGEEIRNKSVDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAE 949

Query: 940  RQGALIGPGGSVRRQLESQFNVRIEVPDKGK-EGKVTIHGRPEAVEKCEKEIFSTIIRDS 998
            R+GALIGPGG VRRQLES+FN+ + VP+K    GK+TI G PE VEK EK+I + IIR++
Sbjct: 950  RKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIREN 1009

Query: 999  YDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGS 1058
            +D+E+ VPA  + +VSERG  I KLRM   +NV+ GN+SKKANKL+R+   IP+E+V GS
Sbjct: 1010 FDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGS 1069

Query: 1059 -EGEG---TKLTIEEVSAPEASANDNIPWRLTYEHVDLSDIL--GEE-------GKHAMT 1105
             EGE    TK TIEEV AP +S   +I  RLTYE +DLS IL  GEE          +  
Sbjct: 1070 TEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAK 1129

Query: 1106 KEQALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINV 1165
            KE+AL+ A   IKERI  AP A   GY+W  + ++FN +VGPGGSNIK+IRE  + +INV
Sbjct: 1130 KEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINV 1189

Query: 1166 PKKSDKVSDII 1176
            P+KSDKV+D++
Sbjct: 1190 PRKSDKVNDVV 1200

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 644  LIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHA 688
            ++GP G+N+ +IR+  DV I+VP +S+  N  + + G +  ++ A
Sbjct: 1168 IVGPGGSNIKKIREAADVIINVPRKSDKVNDVVYIRGTKAGVEKA 1212

>Kwal_14.2397
          Length = 1206

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1145 (51%), Positives = 778/1145 (67%), Gaps = 24/1145 (2%)

Query: 51   KRMPTRADFPPLSSVIF--ETQKVQWGPNMXXXXXXXXXX---------XXXXXXXXXXX 99
            K +P++ DFP L S  F     KV WGPNM                              
Sbjct: 45   KPLPSKKDFPTLGSGAFLAAASKVSWGPNMKTQTASSASGASSTSNSAVQSRSTTPALSA 104

Query: 100  XXMRSKTMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPT 159
               RSKT+QEAFSLDLQ+Q+++SK +FS+ +  +K +HSVS+ESTLSK SRTFLI G P 
Sbjct: 105  KPARSKTIQEAFSLDLQSQISMSKPDFSRIIQGIKTTHSVSVESTLSKSSRTFLIFGKPQ 164

Query: 160  NVYNAKRELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXX 219
            +V  A+RE+VKKLT+PVTV I+VPSKT S+IIG GG+ IREI+     ++IDI K     
Sbjct: 165  DVKAARREIVKKLTKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLE-VRIDIGKEIKED 223

Query: 220  XXXXXXXXQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADV 279
                     ++++S+HGD+ SV  A+ KI +IVKE+TKNA+I V VE+K L+PFI+L  +
Sbjct: 224  TYDEDLDDSMVDVSIHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFINLEGL 283

Query: 280  EISEDVTVKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLI 339
            ++  D     F   S +I L G RDE + AK N+  YL  L+S++   K+ IP KFQ LI
Sbjct: 284  KLPVDAK---FNTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQFLI 340

Query: 340  DAEDVREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGK 399
            D  +++EK+ V+V  PTA G++ VSF G + +LD+A+++AR++SK+YIVESLE+SKAHGK
Sbjct: 341  DESEIKEKFNVTVHLPTAGGEE-VSFVGPAVHLDEAVSFARENSKKYIVESLEISKAHGK 399

Query: 400  NVAHAKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKT 459
            NVAHAKN+  YF  Y++L+ IK++F  V+  +P+P+EL   D V+I I + ++ A+  KT
Sbjct: 400  NVAHAKNIAIYFEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRISTTSENADDLKT 459

Query: 460  VRKQIINIVNRLTPSHVLAVDDLDYELFHKDIKQALSKAE--IPFVQLGDHYEGDNTVLL 517
            VRK IIN+VN L  S VL V+DLDYEL+ KDIK  L + +    FVQLGD + G++ +LL
Sbjct: 460  VRKDIINLVNELPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDKILL 519

Query: 518  FAKVDEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTW 577
            FA++ +EDF+PS +E+K+ L  V + L+ +R KQS L  KI    +E Q   F   + T 
Sbjct: 520  FARLSDEDFRPSDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPSTFTR 579

Query: 578  NLVLENITSAGGHAQIKLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVP 637
             L+ ++I + GGHAQ KLH P+ D++TIRGD           ESI  N  +K +   +V 
Sbjct: 580  ELIEQDIATEGGHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANSGEKFETKFAVS 639

Query: 638  ANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAK 697
            +N+V RLIG KG NL  IR+K+   IDV  ES+   TE+T+TGL+Y+++HAK ++ SE+K
Sbjct: 640  SNSVPRLIGSKGANLNAIREKYQCNIDVAQESSGNQTEVTVTGLKYSVEHAKAYLLSESK 699

Query: 698  KWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGE--VVTIKGPSRGVN 755
            KWAD+ TKEL V  KY G LIGSQGTYR RL+ KYSV I FP EGE   VTI+GPSRGV 
Sbjct: 700  KWADVITKELNVLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGPSRGVA 759

Query: 756  KAHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTA 815
            KA+ ELKALLDFEIENGH S+I VP EHVPR+IGKNGD IN IRA+ GVEL  LQ T   
Sbjct: 760  KAYDELKALLDFEIENGHTSIITVPTEHVPRIIGKNGDNINDIRADCGVELDFLQKTTDP 819

Query: 816  KEQNLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLK 875
            K      V+LEITGSRQAIKEA++ V+AI+ EASD  T+  E++ KY + IVG GG  LK
Sbjct: 820  KAVETGKVELEITGSRQAIKEATQKVEAIVKEASDVETESFEVNPKYIRDIVGAGGRVLK 879

Query: 876  DFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELN 935
              ISKAGGD+IRNK+VD+P+A S +K ITI GP  FV+ M K +  I+++ + SV KEL+
Sbjct: 880  SLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSVEKELD 939

Query: 936  IPADRQGALIGPGGSVRRQLESQFNVRIEVPDKG-KEGKVTIHGRPEAVEKCEKEIFSTI 994
            +PADR GALIGPGG VRRQLES+FN+++ +PD G K  KV I G P+ +  CEK+IF+ +
Sbjct: 940  VPADRVGALIGPGGMVRRQLESEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKKIFTQL 999

Query: 995  IRDSYDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIER 1054
            IRDS D E+ VPA  H FVSE+G LI +LR  YF+NV+ GNS+ KANKL+RS   IP+E+
Sbjct: 1000 IRDSCDAEVQVPASLHEFVSEKGALIQRLRSDYFVNVRFGNSNGKANKLARSNLNIPVEK 1059

Query: 1055 VRGSEGEGTKLTIEEVSAPEASANDNIPWRLTYEHVDLSDILGEEGK---HAMTKEQALE 1111
              G+  E  K T EE+      +   IPWRL+YE VDLSDIL EE K       KE+ LE
Sbjct: 1060 ATGTAEESIKFTTEEIPLAIEESQGFIPWRLSYEPVDLSDILTEEEKANEKEPKKEEVLE 1119

Query: 1112 AAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDK 1171
                 IK+RIELA KA+ +GYLW     +F KVVG  GSNIK+IRE T TLINVPKK+DK
Sbjct: 1120 TVEKLIKDRIELATKASTVGYLWSSKSSEFRKVVGSMGSNIKKIREATGTLINVPKKNDK 1179

Query: 1172 VSDII 1176
            VSDII
Sbjct: 1180 VSDII 1184

>Scas_711.36
          Length = 1219

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1148 (49%), Positives = 773/1148 (67%), Gaps = 26/1148 (2%)

Query: 53   MPTRADFPPL-SSVIFETQKVQWGPNMXXXXXXXXXXXXXXXXXXXX---XXXMRSKTMQ 108
            +P+  D P L S+ IF   KV WGPNM                          MRSK +Q
Sbjct: 52   LPSLKDLPSLGSNSIFANSKVTWGPNMQPSPPISCSPSLSSSLSPSPVSGAKRMRSKNIQ 111

Query: 109  EAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKREL 168
            E+F+LDLQ+Q++I+K E S+ V SVKQ+++VS+ESTLSK SRTFLI+G  T V +AKR+L
Sbjct: 112  ESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDL 171

Query: 169  VKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXXXXXXXXXXQ 228
            VK+LTRP+  V+ VP++  ++IIG GG+ IR I+     + I++A+              
Sbjct: 172  VKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYD-VTINLARENNPDSYDEDLNDF 230

Query: 229  LINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTVK 288
              N++ HGD  SVN AK +I  IVKEETK  ++ V V+++++IPFI L+ + + E V   
Sbjct: 231  TANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCN 290

Query: 289  AFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVREKY 348
             + + +E + + GPRD+ K  K  VQ+YLN L+S ++E+KI IP KFQ LID + +++++
Sbjct: 291  FYRDTAE-VNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEF 349

Query: 349  KVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLM 408
             V V FP+   D+ VSF G    + +AIA+AR +SK + V+SL++SK+H KN+AHAKNL 
Sbjct: 350  NVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLA 409

Query: 409  FYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIV 468
             YF KY  LKDIKE++ EVK+VLP P  L    +V INI +K++ A + K  RK++IN V
Sbjct: 410  LYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFV 469

Query: 469  NRLTPSHVLAVDDLDYELFHKDIKQALSKAE--IPFVQLGDHYEGDNTVLLFAKVDEEDF 526
            N +TP   L + DLDYELFHK IK  L   E  +PF+QLGD++ G+++++LF    EEDF
Sbjct: 470  NTITPLDTLTITDLDYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDF 529

Query: 527  QPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENITS 586
            +PS EE+   LEKV A L+ +R K +K+  K+   DA+ Q    S  S T +L+LE+++ 
Sbjct: 530  KPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSK 589

Query: 587  AGGHAQIKLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPANTVSRLIG 646
              G+ QIKLHTP  +++TIRGD+           SI ENP+KKSK+TV V +N+++RL+G
Sbjct: 590  EEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVG 649

Query: 647  PKGTNLAQIRQKFDVQIDVPS--ESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITT 704
             KG+NL +IR+KFD QIDVP+  E  D   EI LTG EYNL+ AK  IA+EAKKWADI T
Sbjct: 650  TKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVT 709

Query: 705  KELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAELKAL 764
            KEL+VP KYHGSLIG+ G YR RL++KYSV I FP++ ++VTI+GPSRGV +A  EL AL
Sbjct: 710  KELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTELSAL 769

Query: 765  LDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQ 824
            LDFE ENG+K ++ VP EHVPR+IGK G  IN IRA+ GVE+  LQ +   K Q    V+
Sbjct: 770  LDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVE 829

Query: 825  LEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGD 884
            LEITG+R AI EA+  V  II EA+DF ++ L +  KYH++IVG GG  L+D ISKAGGD
Sbjct: 830  LEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGD 889

Query: 885  DIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGAL 944
            DIRNK +D+PNA S + VIT+ GPK FV  + K +N+IV+D + SV K L IP +R GAL
Sbjct: 890  DIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGAL 949

Query: 945  IGPGGSVRRQLESQFNVRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQEIM 1004
            +GPGG +RRQLE++FNV +EVP K + G V I G PE VEK EK+I + I+RDS+D+E+ 
Sbjct: 950  VGPGGMIRRQLETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTEIVRDSFDRELS 1009

Query: 1005 VPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGS----EG 1060
            VPA  H FVSERG    KLR+  F+NVKHGN+S++A +L+RS   IP+E+VR +    + 
Sbjct: 1010 VPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKK 1069

Query: 1061 EGTKLTIEEVSAPEASAND-NIPWRLTYEHVDLSDILGE---EGKHAM--------TKEQ 1108
            E  +  IEEV  P     D +IPWRLTYE +D S++L E   E K A          KE+
Sbjct: 1070 EQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEE 1129

Query: 1109 ALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKK 1168
             L      I++R+  A  +   GY+WC + +KFNKVVGPGGSNIK+IR+  + +INVP++
Sbjct: 1130 TLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRR 1189

Query: 1169 SDKVSDII 1176
            SDKV+D+I
Sbjct: 1190 SDKVNDVI 1197

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 99/423 (23%), Positives = 175/423 (41%), Gaps = 48/423 (11%)

Query: 594  KLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPANTVSRLIGPKGTNLA 653
            K+    E E+ I G            + I +  +     T+SV       ++G  G NL 
Sbjct: 821  KVQETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLR 880

Query: 654  QIRQKF---DVQ---IDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTKEL 707
             I  K    D++   ID+P+ +++++  IT+ G +  +      I    +   +  TK L
Sbjct: 881  DIISKAGGDDIRNKNIDIPNANSESDV-ITVQGPKKFVASVLKQINKIVEDGENSVTKTL 939

Query: 708  IVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEV--VTIKGPSRGVNKAHAELKALL 765
             +P + HG+L+G  G  R +LE +++V ++ P + E   V I G    V KA    K +L
Sbjct: 940  EIPEERHGALVGPGGMIRRQLETEFNVILEVPHKNETGPVRITGLPENVEKAE---KKIL 996

Query: 766  DFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQL 825
               + +     ++VP   +   + + G     +R E  V +K    ++ A   N   V +
Sbjct: 997  TEIVRDSFDRELSVPA-SLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVI 1055

Query: 826  EITGSRQAIKEASK-AVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGGD 884
             +   R A ++  K    A+I E  +    + + D  + +L   P      DF      D
Sbjct: 1056 PVEKVRPATEDEKKEQFRAVIEEVGEPRNDKEDGDIPW-RLTYEP-----IDFSEVLSED 1109

Query: 885  DIRNKTVDVPNAESTNKVITISGPKTFVEKMSK--ALNQIVQDIKASVAKELN------- 935
                K       E+T        PK  +++  K   LN++V+ I+  VAK  +       
Sbjct: 1110 SDETK-------EAT--------PKVEIDEAKKEETLNKVVKMIEDRVAKAASSTFAGYI 1154

Query: 936  IPAD--RQGALIGPGGSVRRQLESQFNVRIEVPDKGKEGK--VTIHGRPEAVEKCEKEIF 991
              AD  +   ++GPGGS  +++    +V I VP +  +    + + G  E VEK E  I 
Sbjct: 1155 WCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVRGTKEGVEKAEALIL 1214

Query: 992  STI 994
              +
Sbjct: 1215 QAL 1217

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1081 (53%), Positives = 752/1081 (69%), Gaps = 9/1081 (0%)

Query: 102  MRSKTMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNV 161
            +RS+ +QE FSLDL  Q  I+K EFS  V SVKQ + VS+ESTLSK SRTFLI+GS   +
Sbjct: 107  LRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSSDKI 166

Query: 162  YNAKRELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXXXX 221
              AKRELVKKLT+PV V  +VPSKT S+IIG GG+ IR I++AAG +KI + K       
Sbjct: 167  GLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAG-VKIVVPKEVDEGTY 225

Query: 222  XXXXXXQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEI 281
                    + ISLHGD  SV  AK KIL +VKEETKNA I + VE+ +L+PFI L  VEI
Sbjct: 226  DSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESVEI 285

Query: 282  SEDVTVKAFPNGS-EKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLID 340
              DV  + F N    +I L GPRD  K AKV V NYLN L  K+  KK  +P KF PL+ 
Sbjct: 286  PADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPLVK 345

Query: 341  AEDVREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKN 400
              ++ EK+ V V  P+  GDD   F G S N+++AI YA+ SSK + VESLE+SKAHGKN
Sbjct: 346  PSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHGKN 405

Query: 401  VAHAKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTV 460
            V HAKNL+ YF KY++L  I E F +V++VLP  E +P L++VSI +IS  D A+  KTV
Sbjct: 406  VKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIKTV 465

Query: 461  RKQIINIVNRLTPSHVLAVDDLDYELFHKDIKQAL--SKAEIPFVQLGDHYEGDNTVLLF 518
            RKQI+ +VN L+P   L + DLDY LFHKDIKQ L  +++++PF+QLGD + G++ +LL 
Sbjct: 466  RKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDILLI 525

Query: 519  AKVDEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWN 578
             K++E+DF+PS +E+K  LE V   L+ +R KQS L + +V+   + Q     +  VT N
Sbjct: 526  TKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVTLN 585

Query: 579  LVLENITSAGGHAQIKLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPA 638
            L+ E ++ AG HA IKL TPS ++ITIRGD+          +SI EN S +SK+T  VP 
Sbjct: 586  LINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQVPT 645

Query: 639  NTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKK 698
            N VSRLIGPKG NL QIR+KFDVQ  +P +S D NT++TLTGL+YNL  AKT+I +EAKK
Sbjct: 646  NVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTDVTLTGLQYNLDQAKTYILAEAKK 705

Query: 699  WADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAH 758
            W+DI TKELIVP KYH +L G QGTYRIRLENKYSV I+FPK+ E+VTI+GPSRGV  A+
Sbjct: 706  WSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGVKAAY 765

Query: 759  AELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQ 818
             ELKALLDFEIENGHK ++ VPV++V RVIGK+G+ IN I+AE GVEL  L  T + K +
Sbjct: 766  DELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDSEKAK 825

Query: 819  NLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLE-IDAKYHKLIVGPGGSTLKDF 877
                V+LEITGSR +IKEA+  V +II +AS+F T  LE ID+KY+  I+G  GS LK+ 
Sbjct: 826  EAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQLKEI 885

Query: 878  ISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIP 937
            ISKAGGD+IRNK V++P+A S +KVITI GP  FV+K+ K +  +V  ++ S+ +ELNIP
Sbjct: 886  ISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFVKKVVKQIKGVVSGLENSITEELNIP 945

Query: 938  ADRQGALIGPGGSVRRQLESQFNVRIEVPDK-GKEGKVTIHGRPEAVEKCEKEIFSTIIR 996
             ++ GALIGP GSVRR+LE++F VRI VP+K   + KVT+ G P  +E C+K+I   IIR
Sbjct: 946  QEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANIESCKKKIEKEIIR 1005

Query: 997  DSYDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVR 1056
            DS+D EI VPA YH++VS  G +   LR  + I+V HGN ++ A  LSR+   +P E V 
Sbjct: 1006 DSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVP-ENVA 1064

Query: 1057 GSEGEGTKLTIEEVSAPEASANDNIPWRLTYEHVDLSDILGEE-GKHAMTKEQALEAAAD 1115
            G E E + + I+ V+  EA   D IPWRLTY  +DLSD+LGE+  K   +K+Q LE A+ 
Sbjct: 1065 GGENESSNVLIQSVTETEAKV-DTIPWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASK 1123

Query: 1116 QIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDI 1175
             I++RI  A   N  G++W ++ KKFN +VGP G NI++IR  T T+I+VP+KSDKV+++
Sbjct: 1124 LIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNV 1183

Query: 1176 I 1176
            I
Sbjct: 1184 I 1184

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 638  ANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAK 697
            A   + ++GP G N+ +IR      I VP +S+  N  I + G E  ++ A   I    K
Sbjct: 1146 AKKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVLGSEEGVKKAAELICKRLK 1205

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1145 (47%), Positives = 773/1145 (67%), Gaps = 24/1145 (2%)

Query: 51   KRMPTRADFPPL--SSVIFETQKVQWGPNMX-XXXXXXXXXXXXXXXXXXXXXXMRSKTM 107
            K +P+  D P L  S+      KV+WGPNM                        MRS  +
Sbjct: 48   KPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRMRSNNI 107

Query: 108  QEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRE 167
            QE F+LDLQ+Q++++K E S+ + +VKQ+++VS+ESTLS+ SRTFLI+G    V  AKRE
Sbjct: 108  QETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKEAKRE 167

Query: 168  LVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTXXXXXXXXXXXX 227
            L+K LTRP+T  I+VPS+  + IIG GG+ IREI++    +KI I+K             
Sbjct: 168  LIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYD-VKIHISKEPKPDSYNEDLDD 226

Query: 228  QLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDVTV 287
             L +IS+ GD  SV  AK KILSIV E+ KN T  ++VE+  L  F+++ +V  S+DV V
Sbjct: 227  DLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVS-SDDVKV 285

Query: 288  KAFPN-GSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVRE 346
            + + + GS    + G  D+ K AK  +++YL  L+++++E+ + IP KFQ LIDA++V++
Sbjct: 286  QYYQDTGS--FTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADEVKD 343

Query: 347  KYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKN 406
            ++ V V FP +  D+TV F GL   + +AI++AR SSKQYIV+SL++SKAH KN+ HAK 
Sbjct: 344  RFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLDHAKR 403

Query: 407  LMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIIN 466
            L+ YF KY++L  + E F +VK VLP+ E+L     V I + +K D   + K  R++II 
Sbjct: 404  LVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAARREIIA 463

Query: 467  IVNRLTPSHVLAVDDLDYELFHKDIKQAL--SKAEIPFVQLGDHYEGDNTVLLFAKVDEE 524
            IVN +TP+  L +DDLDYELFH++IK  L   ++E  F+Q+GD+++GD++V+LFA   +E
Sbjct: 464  IVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFATSTDE 523

Query: 525  DFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLENI 584
            DF+PS +E+KE LEKV A L+++R KQ+ L     + ++E Q   F  DSV   L+LE+I
Sbjct: 524  DFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLILEDI 583

Query: 585  TSAGGHAQIKLHTPSEDEITIRGDEXXXXXXXXXFESIAENPSKKSKLTVSVPANTVSRL 644
            +   GH QIKLH+P ++++T+RGDE          +SI ENPS  +K+TV VP  +VSRL
Sbjct: 584  SGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVASVSRL 643

Query: 645  IGPKGTNLAQIRQKFDVQIDVPSES---NDTNTEITLTGLEYNLQHAKTHIASEAKKWAD 701
            IG KG NL ++R K++  ID+P +     D   EIT+ GL++ ++HAK  IA+EAK+ AD
Sbjct: 644  IGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAKRLAD 703

Query: 702  ITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAEL 761
            I TKEL+   KYH +L G QG YR RL+ KY+V I F KE   +TIKGPSRGVNKA+ EL
Sbjct: 704  IVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKAYDEL 763

Query: 762  KALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLD 821
            KALLDFE+ENGHK+++NVPVEH+ R+IGKNGD ING+  E GVEL  LQ +   K     
Sbjct: 764  KALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKAVETG 823

Query: 822  TVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKA 881
             V+LEITG+R AIKEAS  + AI++EA+D  T++L+ID KYHK IVG GG TL++ IS A
Sbjct: 824  VVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREIISNA 883

Query: 882  GGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQ 941
            GGD++R + VD+PNA+S + +ITI GPK FV  + KA+N+IV++ + S+ K++ +P +R 
Sbjct: 884  GGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVPGERL 943

Query: 942  GALIGPGGSVRRQLESQFNVRIEVPDKG-KEGKVTIHGRPEAVEKCEKEIFSTIIRDSYD 1000
            GALIGPGG VR+QLES+FN+++ VP +  +E +V++ G PE +EK EK+IF+ IIRD++D
Sbjct: 944  GALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIRDNFD 1003

Query: 1001 QEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEG 1060
             EIMVPA    +VS+RG L  +LR+  F+NV++GN++KKAN L+R+   IP E+V G+EG
Sbjct: 1004 LEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVAGAEG 1063

Query: 1061 EGTKLTIEEVSAPEASAN--DNIPWRLTYEHVDLSDILGEEG---KHAMT----KEQALE 1111
            E  K T+EE + P    N    IPWRL YE +D   IL EE    K A      K+Q L+
Sbjct: 1064 EKVKFTVEE-TGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEKKEASVDENKKQQLLK 1122

Query: 1112 AAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDK 1171
             A + I+ RI  AP A   GY+W  +  KF KVVG GGSN+K+IRE+TN ++ VPKKSDK
Sbjct: 1123 EAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDK 1182

Query: 1172 VSDII 1176
            ++++I
Sbjct: 1183 INNVI 1187

>Scas_612.2*
          Length = 714

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 764 LLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLD 821
           LL F +EN ++ +++ P+E V R+I  + +  +G+ ++  +  ++LQN + AK Q LD
Sbjct: 149 LLSFLLENRNQ-IVSQPIEEVLRLIKTSNEGSSGLLSQQDIRNQVLQNAQMAKNQKLD 205

>Scas_515.6
          Length = 342

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 704 TKELIVPTKYHGSLIGSQGTY--RIRLENKYSVRIQFPKEGE---VVTIKGPSRGVNKA 757
           TK +  P KY   +IG +GTY   +R     S+R++ P + E   +++I+GP   V+ A
Sbjct: 267 TKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRLKSPDDKEDLAIISIRGPPLCVDAA 325

>CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces
           cerevisiae YLL032c, hypothetical start
          Length = 778

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 76/182 (41%), Gaps = 21/182 (11%)

Query: 646 GPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEY-NLQHAKTHIASEAKKWADITT 704
           G K   L +I +K   Q+D+  E +D N  +++   +  NL+ A T +  E         
Sbjct: 399 GKKNGKLTRIMEKSQAQLDLNFEEDDKNMFLSIISNKVNNLESAFTLLLDELP-----CE 453

Query: 705 KELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQF------PKEG------EVVTIKGP-- 750
               +P  YH   IGS G+       K++V IQF      P+ G      + V I+ P  
Sbjct: 454 GTFFIPEVYHRPAIGSGGSIIQTTMRKHNVFIQFSNTFLLPQSGLSFVRFDNVIIRCPFK 513

Query: 751 -SRGVNKAHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLL 809
             +G++ A  +LK L+    E    + I +       V+ ++ + I  +  +  V L   
Sbjct: 514 NRKGIDLAIEDLKVLIQEYSEQQPSTNIRLSPAQYKHVLFEHINTIGHLEKQNNVFLDFP 573

Query: 810 QN 811
           QN
Sbjct: 574 QN 575

>Kwal_14.1689
          Length = 395

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 1138 VKKFNKVVGPGGSNIKQIRETTNTLINV 1165
            VK+ + VVGPGG  I +++E TNT INV
Sbjct: 67   VKQASMVVGPGGEKISRMKEKTNTRINV 94

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 633 TVSVPANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTN-TEITLTG 680
           TV++PA  V  L+G  G  +A +R+    +I V  E N  N  E T+TG
Sbjct: 240 TVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPNQNNEREFTITG 288

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 97/253 (38%), Gaps = 70/253 (27%)

Query: 786 RVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLDTVQLEITGSRQAIKEASKAVDAI- 844
           R++G+ G+ I+ IR   GV++ +     + KE++     LE+TGS  A+  A+   D + 
Sbjct: 46  RILGRGGNTIDNIRKANGVKIGI-----STKEKSCSDRLLEVTGSIDAV--ANSLADVVK 98

Query: 845 IAEASDFTTKQLEIDAKYHKL--------------------------------------I 866
           +  A D   +  E + + H                                        I
Sbjct: 99  VLTADDTNEEDAEPEPEQHIFKHLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSSI 158

Query: 867 VGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQI---- 922
           +G  GS +K  I       + +KT  +P  +S ++++ I G    +    K ++Q     
Sbjct: 159 IGTAGSKIKKLIDTHSSKLVVSKTF-LP--DSQDRILEIQGFPNSIANCIKDISQTLIKD 215

Query: 923 -VQDIKAS-------------VAKELNIPADRQGALIGPGGSVRRQLESQFNVRIEV--- 965
            V D K               V   + IPA+  GAL+G GG+    L      +I V   
Sbjct: 216 DVLDTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQE 275

Query: 966 PDKGKEGKVTIHG 978
           P++  E + TI G
Sbjct: 276 PNQNNEREFTITG 288

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 60/146 (41%), Gaps = 17/146 (11%)

Query: 848 ASDFTTKQ-----LEIDAKYHKLIVGPGGSTLKDFISKAGGDDIRNKTVDVPNAESTNKV 902
           A DF   Q     LE+D  Y   I G     L   +      D +   + + N  S + +
Sbjct: 370 AEDFQCVQNVRFTLELDTIYKDFISGKKNGKLMKIM------DRKKCAISLENDSSGHML 423

Query: 903 ITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQGALIGPGGSVRRQLESQFNVR 962
           + + G     +++  + + ++Q++     K   IP      +IG GGSV + +  ++NV 
Sbjct: 424 VILQGEDW--QQIQDSFSLLLQELPCE--KSFFIPEAYHRPVIGTGGSVIQTIMRKYNVF 479

Query: 963 IEVPDKGK--EGKVTIHGRPEAVEKC 986
           I+  +  +  +G  T       + +C
Sbjct: 480 IQFSNSFQLPQGDWTFTRYDNVIIRC 505

>CAGL0C05093g complement(482106..484220) highly similar to sp|Q08225
           Saccharomyces cerevisiae YOL057w, hypothetical start
          Length = 704

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 64/155 (41%), Gaps = 24/155 (15%)

Query: 835 KEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKAGG----------- 883
           KE +K   A+++ A +F + +L   A + K    P   T  + ++  G            
Sbjct: 339 KERTKKFGAMVSRAEEFIS-ELPWSADFEKPKFNPPDFTSLEVLTFTGSGIPAGINIPNY 397

Query: 884 DDIR----NKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPAD 939
           DD+R     K V + N  S +   +   P TF++   + + +  Q     V   ++    
Sbjct: 398 DDVRLNIGFKNVSLGNILSASAKASAKHPPTFIKSEDRGIFEKYQSDSFEVQVGIH---- 453

Query: 940 RQGALIGPG-GSVRRQLESQFNVRIEVPDKGKEGK 973
               L+G G G +  Q+E  FN  IE P  G +GK
Sbjct: 454 ---ELLGHGSGKLLCQIEDGFNFDIENPPTGLDGK 485

>KLLA0D10021g 847239..848750 similar to ca|CA3272|CaALD4 Candida
            albicans aldehyde dehydrogenase, mitochondrial (by
            homology), start by similarity
          Length = 503

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 1007 AVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGSEGEGTKLT 1066
            ++Y  FV+   QL + ++ TY +     ++     ++S+ +Q   +E ++    EG K+ 
Sbjct: 307  SIYEEFVA---QLADHVKKTYIVGAPSDDAVIVGPQVSKKQQERVLEYIKIGIEEGCKVP 363

Query: 1067 IEEVSAPEASAND 1079
            +  + APE  AND
Sbjct: 364  LGGLGAPEPIAND 376

>KLLA0A10351g complement(906401..907087) similar to sp|Q9A7D3
           Caulobacter crescentus Hypothetical protein CC1790,
           hypothetical start
          Length = 228

 Score = 31.6 bits (70), Expect = 3.2,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 426 EVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQIINIVNRLT----PSHVLAVDD 481
           E+K+ +P  +ELP     SIN+I K     Q +T  KQ+ + ++ LT    PSH    D 
Sbjct: 112 ELKVHIPPKDELPSSKPRSINVIVKPSNTSQ-ETAIKQLRDSISALTGLEDPSH----DS 166

Query: 482 LDYELFHKDIKQALSKAEI 500
           + + +    I + L  +E+
Sbjct: 167 IKFHITLAYINEELKDSEV 185

>Kwal_55.20652
          Length = 694

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 19/136 (13%)

Query: 646 GPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIASEAKKWADITTK 705
           G K   +++I       + +  + + +N  ITLT   +   +A  ++  E    A+I+  
Sbjct: 391 GKKNGKISRITDNAKCVLSLEFQEDQSNMLITLTSNSFAAANAGINLLGEELP-AEIS-- 447

Query: 706 ELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEV------------VTIKGPS-- 751
              +P  YH  +IG+ G+    +  +++V IQF    ++            V I+ PS  
Sbjct: 448 -FFIPEAYHRPVIGTGGSVIQTIMRRFNVFIQFSNTFQLPQNDFGLTRHNNVVIRCPSKN 506

Query: 752 -RGVNKAHAELKALLD 766
            + +++A  EL  L++
Sbjct: 507 RKSISQAKKELMRLVN 522

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 356 TALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAKNLMFYFAKYD 415
           + L +D +   GL ANLD       Q  ++   ++LE SK   +     K+LMFY    +
Sbjct: 490 SKLEEDMLVIEGLQANLDHLSKKQEQLEREN--KALEESKQDLE--EQVKDLMFYLDSQE 545

Query: 416 ILKDIKESFKEVKLVLPTP 434
             KD  ES KE  +++  P
Sbjct: 546 KFKDADESVKEGTILIQQP 564

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,058,565
Number of extensions: 1435550
Number of successful extensions: 4342
Number of sequences better than 10.0: 52
Number of HSP's gapped: 4264
Number of HSP's successfully gapped: 66
Length of query: 1176
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1063
Effective length of database: 12,684,275
Effective search space: 13483384325
Effective search space used: 13483384325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)