Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL176C20520110671e-150
Sklu_2238.22072038121e-111
Kwal_14.23942072037771e-106
CAGL0G07689g2152117411e-100
Scas_675.282162127371e-100
KLLA0D02376g2072027029e-95
YKR014C (YPT52)2342307013e-94
Kwal_23.29782111694762e-60
YOR089C (VPS21)2102004753e-60
YNL093W (YPT53)2201734711e-59
KLLA0C13728g2081694562e-57
CAGL0J08635g2081724423e-55
ACL084C2071914362e-54
Scas_662.262121694353e-54
Sklu_2366.32181803823e-46
AEL187C2081983771e-45
Kwal_14.24842031713744e-45
YLR262C (YPT6)2151973731e-44
Sklu_2293.32141823693e-44
KLLA0F01232g2101713684e-44
Kwal_56.225552121753624e-43
Scas_574.22221753547e-42
Scas_203.22511723551e-41
CAGL0K06017g2191753485e-41
AGR257C2201733451e-40
KLLA0F20471g2121753432e-40
YBR264C (YPT10)1991583397e-40
YER031C (YPT31)2231743364e-39
CAGL0I09306g2061693337e-39
CAGL0K09394g2211523242e-37
AER434C2191943233e-37
CAGL0C02453g2181523217e-37
KLLA0D05313g2041843181e-36
YGL210W (YPT32)2221633155e-36
Scas_712.412191713094e-35
CAGL0K12672g2061853032e-34
Scas_713.52111803023e-34
YFL038C (YPT1)2061862999e-34
ABR220W2041842962e-33
Sklu_2144.32041822929e-33
KLLA0E12111g2141622884e-32
Kwal_14.11162041802851e-31
Kwal_23.50582131622851e-31
CAGL0F02123g2151622842e-31
Scas_707.262101832781e-30
CAGL0E02607g2081952781e-30
YFL005W (SEC4)2151622782e-30
Sklu_1815.22131622762e-30
ACR003C2081832762e-30
Scas_674.52081782763e-30
KLLA0D01265g2071972753e-30
Kwal_56.224402081782693e-29
Scas_656.22181622693e-29
AGL021W2121622693e-29
Sklu_2373.32081782675e-29
YML001W (YPT7)2082032632e-28
Kwal_47.190551791422481e-26
Sklu_1136.11821422464e-26
CAGL0I00594g2141822171e-21
YOR185C (GSP2)2201832162e-21
Kwal_33.140152711862192e-21
YLR293C (GSP1)2191832153e-21
Kwal_56.233612141822127e-21
AGR294C2141822111e-20
Sklu_2285.42141822111e-20
KLLA0C05126g2141822101e-20
KLLA0A04499g2141822101e-20
YPR165W (RHO1)2091752101e-20
Scas_586.62191812092e-20
Kwal_55.219372081752083e-20
Scas_691.362121752083e-20
Scas_610.42111762083e-20
Sklu_2151.42071722065e-20
ABR182W2091982056e-20
CAGL0I08459g2101752022e-19
ABR183W2071751978e-19
Sklu_2151.32091761961e-18
KLLA0B10626g2081781962e-18
ACR257C2591861973e-18
KLLA0C13816g1871641924e-18
ACL087C1871681924e-18
YKR055W (RHO4)2912021974e-18
Scas_444.4*2891801965e-18
KLLA0D08327g2541901931e-17
AER132W2321731911e-17
Kwal_55.219412091751891e-17
YNL090W (RHO2)1921691854e-17
Sklu_2345.52191621865e-17
Kwal_47.169832231711857e-17
KLLA0A05643g2181781849e-17
CAGL0J05632g1881681821e-16
Kwal_33.144522601961851e-16
Sklu_1816.11881691811e-16
Sklu_1655.12871761843e-16
Sklu_1653.32561751823e-16
Scas_578.71871641783e-16
Sklu_2007.22612021814e-16
KLLA0B05038g2231741795e-16
YGR152C (RSR1)2722021815e-16
CAGL0K08316g3231651801e-15
CAGL0E03113g3231701792e-15
ABL139C2942041772e-15
Scas_703.412251191743e-15
Scas_671.352342171743e-15
Scas_417.32911991746e-15
Scas_677.202832121746e-15
Scas_547.32231451716e-15
YNL180C (RHO5)3312461703e-14
Kwal_26.83872921671693e-14
CAGL0L11242g2541711658e-14
KLLA0C12001g2591671659e-14
Kwal_23.48752302111631e-13
Kwal_14.22442441661631e-13
Scas_575.102711831632e-13
CAGL0G08558g2271791612e-13
YIL118W (RHO3)2312141603e-13
AFR464W2641661613e-13
KLLA0F03443g2232071603e-13
ADL252W2242071594e-13
YML064C (TEM1)2451691561e-12
YOR101W (RAS1)3091861528e-12
Kwal_55.21971421941511e-11
YNL304W (YPT11)355991465e-11
CAGL0G05764g2901961465e-11
CAGL0J11242g3841321441e-10
Scas_697.463241641431e-10
Kwal_34.161421921571382e-10
Kwal_23.29441841641373e-10
ADL262W2701661403e-10
Kwal_23.31351911751373e-10
KLLA0A04213g1911751364e-10
YNL098C (RAS2)3221641386e-10
CAGL0B04521g3391631386e-10
AGL093W1911751347e-10
YLR229C (CDC42)1911751347e-10
CAGL0F05269g1911751331e-09
YOR094W (ARF3)1831641293e-09
KLLA0A11330g1901581293e-09
YCR027C (RHB1)2091231304e-09
ADL162W4041271315e-09
Scas_697.54*1811221269e-09
Sklu_2320.21641241251e-08
Scas_721.961911751251e-08
ACL078W1811251241e-08
Scas_628.212081741242e-08
Sklu_2354.104221221254e-08
CAGL0M03817g475971236e-08
KLLA0C13563g1821251181e-07
KLLA0C12881g373971211e-07
Sklu_2365.21971681136e-07
KLLA0C13387g211991128e-07
Scas_503.25271111149e-07
Kwal_47.182412301231084e-06
CAGL0I03916g1811751074e-06
YDL137W (ARF2)1811781064e-06
Scas_624.4*1811781065e-06
CAGL0J09064g1811821065e-06
Kwal_27.118721971271065e-06
Scas_701.42*1811781065e-06
YDL192W (ARF1)1811101003e-05
ADR094W1811221003e-05
Sklu_1681.2162169994e-05
KLLA0F05225g181122994e-05
Kwal_56.24453181178986e-05
Sklu_1358.1218130979e-05
YMR138W (CIN4)191169961e-04
Kwal_56.24462181182961e-04
CAGL0I00858g197180952e-04
Sklu_2202.6183121924e-04
AGR221W183124924e-04
KLLA0F17072g190126915e-04
YPL051W (ARL3)198182899e-04
CAGL0E06292g408158900.001
Scas_567.9199185880.001
KLLA0F02662g253123880.002
KLLA0E24805g183121860.002
YBR164C (ARL1)183121860.002
CAGL0I10835g183121850.003
CAGL0E05896g189119850.003
Scas_700.11183121850.003
YPL218W (SAR1)190119820.007
Scas_680.21183168810.010
CAGL0L12826g199192800.015
Scas_706.2*190119790.016
Sklu_2411.4496135800.021
KLLA0B02046g190146780.028
AGL261W198113780.030
KLLA0C06358g299143780.039
YMR023C (MSS1)526196780.039
Kwal_33.14296299158760.062
KLLA0E12837g19971720.15
Sklu_2335.9331161730.16
AFL114W190119720.17
Scas_721.9039763710.27
Kwal_47.17857198133700.28
Scas_698.27701150710.33
KLLA0F07931g490103710.35
Kwal_26.681066470710.36
CAGL0M07546g487181700.43
AFR446W299136690.44
KLLA0E23958g208284700.45
ADR402W661132700.47
AEL232C309130680.59
KLLA0A03465g65926670.91
Scas_692.9309136661.1
Kwal_56.2414914969641.2
KLLA0F18370g17967651.3
YDL006W (PTC1)281106651.4
YML121W (GTR1)310136641.9
Kwal_27.1250887436633.7
Scas_631.9152176633.7
CAGL0B02453g316136624.2
KLLA0D14663g40824614.6
YAL048C662122615.0
CAGL0F06677g446127606.2
Scas_603.720344598.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL176C
         (201 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   415   e-150
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        317   e-111
Kwal_14.2394                                                          303   e-106
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   290   e-100
Scas_675.28                                                           288   e-100
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   275   9e-95
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   274   3e-94
Kwal_23.2978                                                          187   2e-60
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   187   3e-60
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   186   1e-59
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   180   2e-57
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   174   3e-55
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   172   2e-54
Scas_662.26                                                           172   3e-54
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               151   3e-46
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   149   1e-45
Kwal_14.2484                                                          148   4e-45
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   148   1e-44
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           146   3e-44
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   146   4e-44
Kwal_56.22555                                                         144   4e-43
Scas_574.2                                                            140   7e-42
Scas_203.2                                                            141   1e-41
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   138   5e-41
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   137   1e-40
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   136   2e-40
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   135   7e-40
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   134   4e-39
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   132   7e-39
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   129   2e-37
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   129   3e-37
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   128   7e-37
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   127   1e-36
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   125   5e-36
Scas_712.41                                                           123   4e-35
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   121   2e-34
Scas_713.5                                                            120   3e-34
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   119   9e-34
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   118   2e-33
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           117   9e-33
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   115   4e-32
Kwal_14.1116                                                          114   1e-31
Kwal_23.5058                                                          114   1e-31
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   114   2e-31
Scas_707.26                                                           111   1e-30
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   111   1e-30
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   111   2e-30
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        110   2e-30
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   110   2e-30
Scas_674.5                                                            110   3e-30
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   110   3e-30
Kwal_56.22440                                                         108   3e-29
Scas_656.2                                                            108   3e-29
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   108   3e-29
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         107   5e-29
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   105   2e-28
Kwal_47.19055                                                         100   1e-26
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                            99   4e-26
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    88   1e-21
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    88   2e-21
Kwal_33.14015                                                          89   2e-21
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    87   3e-21
Kwal_56.23361                                                          86   7e-21
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    86   1e-20
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         86   1e-20
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    86   1e-20
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    86   1e-20
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    86   1e-20
Scas_586.6                                                             85   2e-20
Kwal_55.21937                                                          85   3e-20
Scas_691.36                                                            85   3e-20
Scas_610.4                                                             85   3e-20
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                84   5e-20
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    84   6e-20
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    82   2e-19
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    80   8e-19
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         80   1e-18
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    80   2e-18
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    80   3e-18
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    79   4e-18
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    79   4e-18
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    80   4e-18
Scas_444.4*                                                            80   5e-18
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    79   1e-17
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    78   1e-17
Kwal_55.21941                                                          77   1e-17
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    76   4e-17
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           76   5e-17
Kwal_47.16983                                                          76   7e-17
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    75   9e-17
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    75   1e-16
Kwal_33.14452                                                          76   1e-16
Sklu_1816.1 YNL090W, Contig c1816 115-681                              74   1e-16
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          75   3e-16
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            75   3e-16
Scas_578.7                                                             73   3e-16
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          74   4e-16
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    74   5e-16
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    74   5e-16
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    74   1e-15
CAGL0E03113g complement(289164..290135) some similarities with s...    74   2e-15
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    73   2e-15
Scas_703.41                                                            72   3e-15
Scas_671.35                                                            72   3e-15
Scas_417.3                                                             72   6e-15
Scas_677.20                                                            72   6e-15
Scas_547.3                                                             70   6e-15
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    70   3e-14
Kwal_26.8387                                                           70   3e-14
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    68   8e-14
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    68   9e-14
Kwal_23.4875                                                           67   1e-13
Kwal_14.2244                                                           67   1e-13
Scas_575.10                                                            67   2e-13
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    67   2e-13
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    66   3e-13
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    67   3e-13
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    66   3e-13
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    66   4e-13
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    65   1e-12
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    63   8e-12
Kwal_55.21971                                                          63   1e-11
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    61   5e-11
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    61   5e-11
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    60   1e-10
Scas_697.46                                                            60   1e-10
Kwal_34.16142                                                          58   2e-10
Kwal_23.2944                                                           57   3e-10
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    59   3e-10
Kwal_23.3135                                                           57   3e-10
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    57   4e-10
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    58   6e-10
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    58   6e-10
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    56   7e-10
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    56   7e-10
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    56   1e-09
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    54   3e-09
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    54   3e-09
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    55   4e-09
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    55   5e-09
Scas_697.54*                                                           53   9e-09
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            53   1e-08
Scas_721.96                                                            53   1e-08
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    52   1e-08
Scas_628.21                                                            52   2e-08
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         53   4e-08
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    52   6e-08
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    50   1e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    51   1e-07
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          48   6e-07
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    48   8e-07
Scas_503.2                                                             49   9e-07
Kwal_47.18241                                                          46   4e-06
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    46   4e-06
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    45   4e-06
Scas_624.4*                                                            45   5e-06
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    45   5e-06
Kwal_27.11872                                                          45   5e-06
Scas_701.42*                                                           45   5e-06
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    43   3e-05
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    43   3e-05
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            43   4e-05
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    43   4e-05
Kwal_56.24453                                                          42   6e-05
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             42   9e-05
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    42   1e-04
Kwal_56.24462                                                          42   1e-04
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    41   2e-04
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            40   4e-04
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    40   4e-04
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    40   5e-04
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    39   9e-04
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    39   0.001
Scas_567.9                                                             39   0.001
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    39   0.002
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    38   0.002
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    38   0.002
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    37   0.003
CAGL0E05896g join(complement(585178..585202),complement(584348.....    37   0.003
Scas_700.11                                                            37   0.003
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    36   0.007
Scas_680.21                                                            36   0.010
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    35   0.015
Scas_706.2*                                                            35   0.016
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           35   0.021
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    35   0.028
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    35   0.030
KLLA0C06358g complement(563583..564482) highly similar to sp|Q00...    35   0.039
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    35   0.039
Kwal_33.14296                                                          34   0.062
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    32   0.15 
Sklu_2335.9 YML121W, Contig c2335 18260-19255 reverse complement       33   0.16 
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    32   0.17 
Scas_721.90                                                            32   0.27 
Kwal_47.17857                                                          32   0.28 
Scas_698.27                                                            32   0.33 
KLLA0F07931g 744157..745629 weakly similar to sgd|S0005391 Sacch...    32   0.35 
Kwal_26.6810                                                           32   0.36 
CAGL0M07546g 756457..757920 similar to sp|P32559 Saccharomyces c...    32   0.43 
AFR446W [3638] [Homologous to ScYML121W (GTR1) - SH] complement(...    31   0.44 
KLLA0E23958g complement(2124622..2130870) some similarities with...    32   0.45 
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    32   0.47 
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...    31   0.59 
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    30   0.91 
Scas_692.9                                                             30   1.1  
Kwal_56.24149                                                          29   1.2  
KLLA0F18370g 1692172..1692711 no similarity, hypothetical start        30   1.3  
YDL006W (PTC1) [851] chr4 (439906..440751) Protein serine/threon...    30   1.4  
YML121W (GTR1) [3850] chr13 (26930..27862) GTP-binding protein i...    29   1.9  
Kwal_27.12508                                                          29   3.7  
Scas_631.9                                                             29   3.7  
CAGL0B02453g complement(234125..235075) highly similar to sp|Q00...    28   4.2  
KLLA0D14663g 1238190..1239416 similar to sp|Q06103 Saccharomyces...    28   4.6  
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    28   5.0  
CAGL0F06677g complement(656199..657539) highly similar to sp|P08...    28   6.2  
Scas_603.7                                                             27   8.3  

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  415 bits (1067), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180
           KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL
Sbjct: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180

Query: 181 AAQPQHSSSIQLQRPTTNDAT 201
           AAQPQHSSSIQLQRPTTNDAT
Sbjct: 181 AAQPQHSSSIQLQRPTTNDAT 201

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  317 bits (812), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 179/203 (88%), Gaps = 2/203 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLS+TIKL D++D ++KFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQERYKSLAPMYYRNAN ALVVYDVTQ DSL KAQ+WV+ELKSKVGDEDLVI LVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180
           KLDL +E+ + R +D ++AQ+YA   GL+FHEVSAKTG G+ ++FQ IG KLY Q+++SL
Sbjct: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180

Query: 181 --AAQPQHSSSIQLQRPTTNDAT 201
             A+Q +H  +++LQRPTTNDAT
Sbjct: 181 EAASQTRHVVNVELQRPTTNDAT 203

>Kwal_14.2394
          Length = 207

 Score =  303 bits (777), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 2/203 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLS+TIKL  H+D  IKFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQERYKSLAPMYYRNANAALVVYDVTQ  SL KAQSWV ELK+KVGD+DLVI LVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180
           KLDL  E+   R ++ E+AQ YA+  GL+FHEVSAKTG+G+  +FQ IG  +Y+++  + 
Sbjct: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180

Query: 181 AAQPQ--HSSSIQLQRPTTNDAT 201
           AA PQ   + +++LQRP+TND+T
Sbjct: 181 AASPQARKTPNVKLQRPSTNDST 203

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  290 bits (741), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 171/211 (81%), Gaps = 10/211 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAD-HDDAMIKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLS+T+K+ D ++D +IKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVG 119
           WDTAGQERYKSLAPMYYRNANAALVVYDVTQ DSL+KAQSWV EL++KVGDE+LVI+LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179
           NK+D+V+ D   R I++EE   YA+A  L+F EVSAKTG G+ D+FQ IG +LY  ++ S
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180

Query: 180 LAAQPQ---------HSSSIQLQRPTTNDAT 201
           L  + Q         ++  IQ QRP+TND +
Sbjct: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTS 211

>Scas_675.28
          Length = 216

 Score =  288 bits (737), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/212 (67%), Positives = 168/212 (79%), Gaps = 11/212 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLA---DHDDAMIKF 57
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLS+TIK+      +D +IKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFL 117
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ+DSL KA+SWV ELK+KVGDEDLVIFL
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 118 VGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177
           VGNKLDL + +   R +D+ EA+AYAE   L+F EVSAKTG G+ +VF+ IG KLY  ++
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 178 ESLAAQP--------QHSSSIQLQRPTTNDAT 201
           + + A+          +S  I  QRP+TND T
Sbjct: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTT 212

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  275 bits (702), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 133/202 (65%), Positives = 169/202 (83%), Gaps = 2/202 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAD-HDDAMIKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLS+TIKL++ +D+ ++KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVG 119
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+ DSL KA+ WV+ELK KV D+ L+I LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179
           NKLDLV E     ++D  +A+ +A+ + L+FH+VSAKTG  ++ VFQ IG +LY Q ++ 
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180

Query: 180 L-AAQPQHSSSIQLQRPTTNDA 200
           +  ++  ++++I LQRP+TND+
Sbjct: 181 IQESKKPNNNNISLQRPSTNDS 202

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  274 bits (701), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 140/230 (60%), Positives = 171/230 (74%), Gaps = 29/230 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHD-----DAMI 55
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLS++I +  +D     D +I
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI 115
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQEDSL KA++WV+ELK+KVGD+DLVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 116 FLVGNKLDLV----------------DEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGT 159
           +L+GNK+DL                 DE+ K R I +EEA+ YA+  GL+F EVSAKTG 
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 160 GILDVFQGIGGKLYEQRRESLAAQPQH--------SSSIQLQRPTTNDAT 201
           G+ ++FQ IG KLY+ +++ + ++              I LQRP+TND T
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPT 230

>Kwal_23.2978
          Length = 211

 Score =  187 bits (476), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 98/169 (57%), Positives = 122/169 (72%), Gaps = 5/169 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + + DH    IKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S  KA+ WV EL+ +   +D+VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALVGNKLD 123

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           +V E    R +  EEA+  A    L+F E SAKTG+ + +VF GIG K+
Sbjct: 124 IV-ESGGERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKI 171

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  187 bits (475), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 135/200 (67%), Gaps = 7/200 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + + +H    +KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH---TVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S  KA+ WV EL  +   +D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALVGNKID 123

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGK--LYEQRRESLA 181
           ++ E  + R +  EE +  AE  GL+F E SAKTG  + DVF GIG K  L     ++ A
Sbjct: 124 MLQEGGE-RKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSA 182

Query: 182 AQPQHSSSIQLQRPTTNDAT 201
           +  + S++ ++     ND T
Sbjct: 183 SNERESNNQRVDLNAANDGT 202

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  186 bits (471), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 98/173 (56%), Positives = 121/173 (69%), Gaps = 6/173 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ I     D  +IKFEIWD
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT---RDGKVIKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQER+  LAPMYYRNA AALVV+DVT E S  KAQ+WV EL  KVG  D+VI LVGNK
Sbjct: 68  TAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIALVGNK 126

Query: 122 LDLV--DEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           +DL+  D++ + R + +   Q   E   L++ E SAKTG  I  +FQ +G K+
Sbjct: 127 MDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKV 179

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  180 bits (456), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 94/169 (55%), Positives = 122/169 (72%), Gaps = 5/169 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + +ADH    IKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYDVT+  S  KA+ WV EL  +   + +VI LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKMD 123

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           L++ + + R +  EEA+  ++   L+F E SAKTG  + +VF  IG K+
Sbjct: 124 LLESE-EDRKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKI 171

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  174 bits (442), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 94/172 (54%), Positives = 123/172 (71%), Gaps = 5/172 (2%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           +   KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + + +H    +KFEIW
Sbjct: 5   ITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEH---TVKFEIW 61

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER+ SLAPMYYRNA AALVVYDVT+  S  KA+ WV EL+ +   +D++I LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIALVGN 120

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           K+D++ E+   R +  EEA+  AE   L+F E SAK+G  I DVF  IG K+
Sbjct: 121 KIDVL-ENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKV 171

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  172 bits (436), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/191 (52%), Positives = 128/191 (67%), Gaps = 8/191 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + +   D   IKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNM---DSKTIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER+ SLAPMYYRNA AALVVYD+T+  S  KA+ WV EL  +   + +VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKLD 123

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L+ E+ + R +  EEA+  AE  GL+F E SAKTG  I +VF  IG K+   +   +  Q
Sbjct: 124 LL-ENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAK---VGEQ 179

Query: 184 PQHSSSIQLQR 194
           P    S+   R
Sbjct: 180 PASGPSVDNAR 190

>Scas_662.26
          Length = 212

 Score =  172 bits (435), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 121/169 (71%), Gaps = 4/169 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL++ + +   +D  +KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNI---NDNTVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER+ SLAPMYYRNA AAL+VYDVT+  S  KA+ W+ EL  +  ++D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALVGNKVD 123

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           +++ +   R +  EE +  AE  GL+F E SAKTG  + + F  IG K+
Sbjct: 124 VLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKI 172

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  151 bits (382), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 115/180 (63%), Gaps = 23/180 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKL-------ADHDDAMI 55
           + KLVLLG+SSVGKSSIV RF   +F     +TIGAAF ++T+ L        +  D  I
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED--- 112
           K EIWDTAGQERY+SLAPMYYRN + AL+V+DVT +DS+A+AQSW++EL   + + +   
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 113 --LVIFLVGNKLDLVDEDCKPRVIDSEEAQ--AYAEAHGLMFHEVSAKTGTGILDVFQGI 168
             ++I +VGNK+DL  E        + E Q   Y +  G  +  VSAKTG GI ++F  I
Sbjct: 127 RGILIKIVGNKIDLNPE--------ARETQNLPYIQDQGYNWFPVSAKTGDGIDELFDTI 178

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  149 bits (377), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 119/198 (60%), Gaps = 26/198 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKL----ADHDDAM-- 54
             Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +R+++      D  DA   
Sbjct: 6   CCQVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEV 64

Query: 55  --IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD-- 110
             + FEIWDTAGQERY+SLAPMYYRN + ALVVYDVT++ S   A+SW++EL + +G+  
Sbjct: 65  RSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQ 124

Query: 111 -EDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIG 169
             D+V+ +VGNK+DL              A    E        VSAKTG GI ++F  I 
Sbjct: 125 RNDVVVRIVGNKIDL-------------HAGGQLEQPLPSATFVSAKTGEGIEELFMDI- 170

Query: 170 GKLYEQRRESLAAQPQHS 187
            K  +  R  L A+PQ S
Sbjct: 171 AKHVKPERFVLQAEPQES 188

>Kwal_14.2484
          Length = 203

 Score =  148 bits (374), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 112/171 (65%), Gaps = 20/171 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKL-ADHDDAMIKFEIWD 61
           + KLVLLG+SSVGKS++V RF   SF +   +TIGAAF ++ I    +     +KFEIWD
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEVKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKV-GDE--DLVIFLV 118
           TAGQERY++L PMYYRN + A VV+DVT+E +  KA SWV ELKS + G+E  ++VI L+
Sbjct: 68  TAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLI 127

Query: 119 GNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIG 169
           GNK+DL+DE   PR +               +  VSAKTG G+ D+F+ + 
Sbjct: 128 GNKIDLLDE-VPPRKVG--------------WTPVSAKTGEGVADLFESVA 163

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  148 bits (373), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 124/197 (62%), Gaps = 9/197 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R++  A++VYD+T+  S      W+ ++K++ GDE++++ +VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGN 124

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQGIGGKLYE-QRRE 178
           K DL DE    R I +EE +  A+  G  +F E S K G  +  +F+ I   L E Q  E
Sbjct: 125 KSDLSDE----RQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSE 180

Query: 179 SLAAQPQHSSSIQLQRP 195
           S     ++++S    +P
Sbjct: 181 STPLDSENANSANQNKP 197

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  146 bits (369), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 120/182 (65%), Gaps = 8/182 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT + S      W+ ++KS+ G+E++++ +VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEA-HGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179
           K DLVDE    R + +EE +  A+  +  +F E S K G  + ++F+ I   L E +  S
Sbjct: 127 KNDLVDE----RQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSLPEFQNSS 182

Query: 180 LA 181
            +
Sbjct: 183 YS 184

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  146 bits (368), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 112/171 (65%), Gaps = 21/171 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAM---IKFEIWD 61
           KLVLLG+SSVGKS+IV RF    F      TIGAAF ++ ++  D +D +   + FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD--EDLV-IFLV 118
           TAGQERY+SLAPMYYRN + AL+V+DVTQ  S  KAQSW++EL + + D  +D V + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 119 GNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIG 169
           GNK+DLVDE         E  Q + +A       VSAKTG GI ++F  IG
Sbjct: 130 GNKIDLVDE---------ETLQNWNDA-----ELVSAKTGEGIDELFLKIG 166

>Kwal_56.22555
          Length = 212

 Score =  144 bits (362), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 116/175 (66%), Gaps = 8/175 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT + S      WV ++KS+ G+E++V+ +VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEA-HGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
           K DL DE    R + +EE +  A+  +  +F E S K G  + ++F+ I   L E
Sbjct: 127 KNDLSDE----RQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPE 177

>Scas_574.2
          Length = 222

 Score =  140 bits (354), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 115/175 (65%), Gaps = 8/175 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T++ S      W+ ++K++ GD+++++ +VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVGN 124

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQGIGGKLYE 174
           K DL DE    R +  EE +  A+  G  +F E S K G  + ++F+ I   L E
Sbjct: 125 KSDLSDE----RQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSLPE 175

>Scas_203.2
          Length = 251

 Score =  141 bits (355), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 14/172 (8%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAM-IKFEIW 60
            + K VLLG+SSVG++SIV RF      + R   IGAAFL++ I+  D D+   +  EIW
Sbjct: 46  CRLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIW 105

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDE---DLVIFL 117
           DTAGQERY+SLAP+YYRN + AL+V+DVT  ++  KA+SWV+EL+S + +E   ++ ++L
Sbjct: 106 DTAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYL 165

Query: 118 VGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIG 169
           +GNK DL          + E     A      F EVSAK   GI ++F+ I 
Sbjct: 166 IGNKCDL----------EHESIAKTAILDMCTFKEVSAKRDEGIQELFEEIA 207

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  138 bits (348), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 114/175 (65%), Gaps = 8/175 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL---DDKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T+  S      W+ ++K++ G E++++ +VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVGN 125

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQGIGGKLYE 174
           K DL DE    R + +EE +  A+  G  +F + S K G  + ++F+ I   L E
Sbjct: 126 KSDLADE----RQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSLPE 176

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  137 bits (345), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++WDT
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL---DDRTIRLQLWDT 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQER++SL P Y R+++ A+VVYD+T + S      WV +++++ G+E+L++ +VGNK 
Sbjct: 69  AGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNKS 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAE-AHGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
           DLVDE    R +  EE +  A+  +  +F E S K G  +  +F+ I   L E
Sbjct: 129 DLVDE----RKVTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRIAKLLPE 177

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  136 bits (343), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 113/175 (64%), Gaps = 8/175 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   DD  I+ ++W
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL---DDKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      W+ ++K + G+E++++ +VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVGN 125

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEA-HGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
           K DLV+E    R + +EE +  +   +  +F E S K G  +  +F+ I   L E
Sbjct: 126 KSDLVEE----RQVSTEEGERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLLPE 176

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  135 bits (339), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 11/158 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAM---IKFEIW 60
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++TI++  +D +    I  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAGQERYKSL PMYYR+AN AL+V+++    SL  A++W  +L+ +     ++I  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTG 158
           K DLV E+       S E    AE  GL +  VSAKTG
Sbjct: 123 KYDLVCEE------HSGEVTIPAELQGLPYVAVSAKTG 154

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  134 bits (336), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 109/174 (62%), Gaps = 8/174 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F +RT+++   D   IK +IWD
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI---DGKRIKAQIWD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQERY+++   YYR A  AL+VYD+++  S      W++EL+    D+++ + L+GNK
Sbjct: 69  TAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNK 127

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQ 175
            DL       R + +EE++ +A+ + L+F E SA     +   F+ +   +Y++
Sbjct: 128 SDLA----HLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK 177

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  132 bits (333), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 107/169 (63%), Gaps = 14/169 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIK-LADHDDAMIKFEIWDT 62
            K+VLLG+S+VGKS+IV RF    +     +TIGAA++++ ++ + D D   ++ EIWDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLR-NNATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKV---GDEDLVIFLVG 119
           AGQERY+SL PMYYRN + A+VV+DV+   SL+ A  W++EL + V   G E + I LVG
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI 168
           NK+DL  ++ +  +    E Q         F  VSAK+G GI ++F  I
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQ---------FQAVSAKSGEGIEELFDHI 169

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  129 bits (324), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 97/152 (63%), Gaps = 8/152 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +RTIK+   +D  IK +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKV---EDKKIKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQERY+++   YYR A  AL+VYD+++  +      W+ ELK    D+++ I L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGNKSD 130

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSA 155
           L       R + +EEA+ +A  + L F E SA
Sbjct: 131 LE----HLRAVPTEEARGFASENQLFFTETSA 158

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  129 bits (323), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 114/194 (58%), Gaps = 8/194 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F +RTI++   +   +K +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEV---EGKKVKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQERY+++   YYR A  AL+VYD+++  S      W+ EL+    DE++ + L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADENVAVGLIGNKSD 130

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L       R + ++EA+ +A+ + ++F E SA     +   F+ +   +Y+   ++    
Sbjct: 131 LA----HLRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIYQMVSKNQVDL 186

Query: 184 PQHSSSIQLQRPTT 197
            +++ S  + R  T
Sbjct: 187 SENNGSGTVPRGPT 200

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  128 bits (321), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 97/152 (63%), Gaps = 8/152 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +RTI   D D   IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTI---DVDGKKIKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQERY+++   YYR A  AL+VYD+++  S      W++EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENA-DDNVAVGLIGNKSD 129

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSA 155
           L       R + +EEA+ +A  + L+F E SA
Sbjct: 130 LA----HLRAVPTEEAKQFASENQLLFTETSA 157

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  127 bits (318), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 114/184 (61%), Gaps = 12/184 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT ++S    ++W+ E+  + G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGNKND 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    +V+D+E A+ +A++ G+ F E SA   + + + F      + +Q +ES+A Q
Sbjct: 125 LTDK----KVVDTEVAKEFADSIGIPFIETSALDSSNVEEAFL----IMTKQIKESVAKQ 176

Query: 184 PQHS 187
            + +
Sbjct: 177 QKDN 180

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  125 bits (315), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 101/163 (61%), Gaps = 8/163 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F +RTI++   ++  IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEV---ENKKIKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADDNVAVGLIGNKSD 129

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQ 166
           L       R + ++EA+ +A  + ++F E SA     +   F+
Sbjct: 130 LA----HLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFR 168

>Scas_712.41
          Length = 219

 Score =  123 bits (309), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 103/171 (60%), Gaps = 8/171 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +RTI++   +   IK +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEV---EGKKIKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQERY+++   YYR A  AL+VYD+++  +      W+ EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLIGNKSD 129

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
           L       R + + EA+ +A  + L+F E SA     +   F+ +   +Y+
Sbjct: 130 LA----HLRAVPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIYQ 176

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  121 bits (303), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 109/185 (58%), Gaps = 12/185 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT ++S    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    RV++ + A+ +AEA+ + F E SA   T + + F  +      Q +ES+  Q
Sbjct: 125 LADK----RVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMA----RQIKESMTQQ 176

Query: 184 PQHSS 188
             + S
Sbjct: 177 NMNES 181

>Scas_713.5
          Length = 211

 Score =  120 bits (302), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 108/180 (60%), Gaps = 12/180 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT +DS    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    RV++ + A+ +A+A+ + F E SA   T + + F      +  Q +ES++ Q
Sbjct: 125 LTDK----RVVEYDVAKEFADANKMPFLETSALNSTNVEEAFL----TMARQIKESMSQQ 176

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  119 bits (299), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 111/186 (59%), Gaps = 12/186 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR ++  ++VYDVT ++S    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    RV++ + A+ +A+A+ + F E SA   T + D F  +      Q +ES++ Q
Sbjct: 125 LKDK----RVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMA----RQIKESMSQQ 176

Query: 184 PQHSSS 189
             + ++
Sbjct: 177 NLNETT 182

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  118 bits (296), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 110/184 (59%), Gaps = 12/184 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT ++S    ++W+ E+  + G   +V  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGNKND 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    +V+D E A+ +A++  +   E SA   + + + F      +  Q +E+++ Q
Sbjct: 125 LKDK----KVVDFEVAREFADSLNIPVLETSALDSSNVEEAFL----TMARQIKETMSHQ 176

Query: 184 PQHS 187
            + S
Sbjct: 177 QKES 180

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  117 bits (292), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 107/182 (58%), Gaps = 12/182 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F    IK  D D   +K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDF---KIKTVDLDGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT ++S    ++W+ E+  + G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGNKND 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    +V++ E A+ +A++  +   E SA   + + + F  +      Q +ES++ Q
Sbjct: 125 LTDK----KVVEYEVAKEFADSLQIPVLETSALDSSNVEEAFLTMA----RQIKESMSQQ 176

Query: 184 PQ 185
            +
Sbjct: 177 QR 178

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  115 bits (288), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 94/162 (58%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F    IK  D +   +K ++WDTA
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDF---KIKTVDINGKRVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   +++YDVT E +    + W + +      ED+V+ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQH-ASEDVVMLLVGNKKD 136

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +       R +  E+ +A A+  G+ F E SAK  T + ++F
Sbjct: 137 M-----DTRTVSYEQGEALAKELGIPFIEASAKDDTNVSEIF 173

>Kwal_14.1116
          Length = 204

 Score =  114 bits (285), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 107/180 (59%), Gaps = 12/180 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   D   +K +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A+  ++VYDVT  DS    + W+ E+  +     ++  +VGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGNKSD 124

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           L D+    R+++ + A+ +A++  + F E SA   + + + F  +     +Q +ES+A Q
Sbjct: 125 LQDK----RMVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMA----KQIKESMAQQ 176

>Kwal_23.5058
          Length = 213

 Score =  114 bits (285), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 94/162 (58%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D +   +K ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E + A  + W + +     DE   + LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHANDE-AQLLLVGNKSD 136

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +       R + +++ ++ A+  G+ F E SAK  T + D+F
Sbjct: 137 M-----DTRAVSTDQGESLAKELGIPFVEASAKDDTNVNDIF 173

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  114 bits (284), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 93/162 (57%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D +   +K ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E + A  + W   +     DE   + LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDE-AQLLLVGNKSD 136

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +       RV+  E+ +A A+  GL F E SAK    + ++F
Sbjct: 137 M-----DTRVVTYEQGEALAKELGLPFIESSAKNDDNVNEIF 173

>Scas_707.26
          Length = 210

 Score =  111 bits (278), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 101/183 (55%), Gaps = 9/183 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D +   +K ++WDTA
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 73

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E + +  + W   +     DE   + LVGNK D
Sbjct: 74  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDE-AQLLLVGNKSD 132

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           +       RV+  E+ ++ A+  GL F E SAK    + ++F  +   + E+   +  A 
Sbjct: 133 M-----DTRVVTYEQGESLAKELGLPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLAG 187

Query: 184 PQH 186
           P +
Sbjct: 188 PGN 190

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  111 bits (278), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 113/195 (57%), Gaps = 10/195 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L   DD ++  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVL--DDDKVVTMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDEDLVIFLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIG-GKLYEQRRE 178
           K+D+  ED K +V+  +  Q  A++ G +     SAK+   +   F+ I    L + + +
Sbjct: 127 KVDI--EDSK-KVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 183

Query: 179 SLAAQPQHSSSIQLQ 193
           + A +   + +I +Q
Sbjct: 184 AHAFEDDFNDAINIQ 198

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  111 bits (278), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 94/162 (58%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D +   +K ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E +    + W   +     DE   + LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDE-AQLLLVGNKSD 136

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +     + RV+ +++ +A A+  G+ F E SAK    + ++F
Sbjct: 137 M-----ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIF 173

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  110 bits (276), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 93/162 (57%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D +   IK ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKTVDINGKKIKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E + +  + W++ +     DE   + LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDE-AQLLLVGNKSD 136

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +       R +  E+ +A ++  GL F E SAK    + ++F
Sbjct: 137 M-----DTRAVTYEQGEALSKELGLPFVEASAKNDDNVNEIF 173

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  110 bits (276), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 105/183 (57%), Gaps = 9/183 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D +   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DGDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDEDLVIFLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179
           K+D+  E+ K +V+ +  +Q  A++ G + F   SAK    + D F+ I     +Q +  
Sbjct: 127 KIDV--EESK-KVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQAD 183

Query: 180 LAA 182
             A
Sbjct: 184 AGA 186

>Scas_674.5
          Length = 208

 Score =  110 bits (276), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 104/178 (58%), Gaps = 9/178 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTI--DDDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++ GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177
           K+D+   D   +V+ +  AQ  A++ G       SAK    I + F+ I     +Q +
Sbjct: 127 KVDI---DETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQNQ 181

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  110 bits (275), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 117/197 (59%), Gaps = 14/197 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  +DD +   ++WDTA
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--NDDKVATMQVWDTA 65

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++  N
Sbjct: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG---LMFHEVSAKTGTGILDVFQGIG-GKLYEQR 176
           K+D+  E+ K +V+ S  AQ  A++ G   L F   SAK    + D F+ I    L + +
Sbjct: 126 KVDV--EESK-KVVSSRSAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIARSALQQSQ 180

Query: 177 RESLAAQPQHSSSIQLQ 193
            ++ A +   S +I +Q
Sbjct: 181 SDADAYEDDLSEAINIQ 197

>Kwal_56.22440
          Length = 208

 Score =  108 bits (269), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 105/178 (58%), Gaps = 9/178 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ + +    D +   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM--DGDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++ GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177
           KLD+  E+ K +V+ +  AQ  A++ G +     SAK    +   F+ I     +Q +
Sbjct: 127 KLDV--EESK-KVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQ 181

>Scas_656.2
          Length = 218

 Score =  108 bits (269), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 91/162 (56%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F    IK  D     IK ++WDTA
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDF---KIKTLDIQGRKIKLQLWDTA 83

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E +    + W + +     +E + + LVGNK D
Sbjct: 84  GQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEH-ANEQVQLLLVGNKSD 142

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           L +     R +  E+ +  A   GL F E SAK    + D+F
Sbjct: 143 LGN-----RQVTKEQGEELARELGLPFMEASAKNDDNVNDLF 179

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  108 bits (269), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 9/162 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D +   IK ++WDTA
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKAVDINGKKIKLQLWDTA 76

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQER++++   YYR A   ++VYDVT E +    + W   +     +E+  + LVGNK D
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQH-ANEEAQLLLVGNKKD 135

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           +       R +  E+ ++ A+  G+ F E SAK    + D+F
Sbjct: 136 M-----DTRAVTYEQGESLAKELGVPFIEASAKDDENVSDIF 172

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  107 bits (267), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 104/178 (58%), Gaps = 9/178 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   +D +   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DEDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDEDLVIFLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177
           K+D+  E+ K +V+++  AQ  A++ G +     SAK    +   F+ I     +Q +
Sbjct: 127 KIDV--EESK-KVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQSQ 181

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  105 bits (263), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 117/203 (57%), Gaps = 10/203 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D +   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DGDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120
           GQER++SL   +YR A+  ++VYDVT   S    +SW +E  + + V   +   F++ GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGN 126

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIG-GKLYEQRRE 178
           K+D   E+ K +++  + AQ  A++ G +     SAK    +   F+ I    L + + +
Sbjct: 127 KIDA--EESK-KIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQAD 183

Query: 179 SLAAQPQHSSSIQLQRPTTNDAT 201
           + A +  ++ +I ++    N++ 
Sbjct: 184 TEAFEDDYNDAINIRLDGENNSC 206

>Kwal_47.19055
          Length = 179

 Score =  100 bits (248), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 8/142 (5%)

Query: 33  ESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQED 92
           +STIG  F +RTI++   +   IK +IWDTAGQERY+++   YYR A  AL+VYD+++  
Sbjct: 4   KSTIGVEFATRTIEV---EGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSS 60

Query: 93  SLAKAQSWVNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHE 152
           S      W+ EL+    DE++ + L+GNK DL       R + ++EA+ +A+ + L+F E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDLA----HLRAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGTGILDVFQGIGGKLYE 174
            SA     +   F+ +   +Y+
Sbjct: 116 TSALNSENVDQAFRELISAIYQ 137

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score = 99.4 bits (246), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 33  ESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQED 92
           +STIG  F +RTI++   +   IK +IWDTAGQERY+++   YYR A  AL+VYD+++ +
Sbjct: 4   KSTIGVEFATRTIEV---EGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSN 60

Query: 93  SLAKAQSWVNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHE 152
           S      W+ EL+    DE++ + L+GNK DL       R + ++EA+ +A+ + L+F E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDLA----HLRAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGTGILDVFQGIGGKLYE 174
            SA     +   F+ +   +Y+
Sbjct: 116 TSALNSENVDLAFRELITAIYQ 137

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA H +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFHTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 89/183 (48%), Gaps = 15/183 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAF--LSRTIKLADHDDAMIKFEIWD 61
           FKLVL+GD   GK++ V R +   F++   +TIG     LS      +     IKF++WD
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE-----IKFDVWD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQE++  L   YY NA  A++++DVT   +     +W  +L      E++ I L GNK
Sbjct: 69  TAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNK 126

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLA 181
           +D+ +   K + I       +     L ++++SAK+       F  +  KL    +    
Sbjct: 127 VDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV 180

Query: 182 AQP 184
           A P
Sbjct: 181 ASP 183

>Kwal_33.14015
          Length = 271

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 96/186 (51%), Gaps = 12/186 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
             K+V++GD +VGK+ ++  + +  F E     I   F +   K+   D+ +++  +WDT
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPE---EYIPTVFENYVTKMKGPDNTVVELALWDT 121

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V  + SL   Q  W+ E++    D    I LVG K
Sbjct: 122 AGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--ILLVGLK 179

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVFQ-GIGGKLY----EQ 175
            DL   D   +++D  EA  +A  H L+ H + S+K+   + ++F   +   LY    E+
Sbjct: 180 SDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELFNVAMATLLYDPVQER 239

Query: 176 RRESLA 181
           +R S+A
Sbjct: 240 KRISVA 245

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 89/183 (48%), Gaps = 15/183 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAF--LSRTIKLADHDDAMIKFEIWD 61
           FKLVL+GD   GK++ V R +   F++   +TIG     LS      +     IKF++WD
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE-----IKFDVWD 67

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQE++  L   YY NA  A++++DVT   +     +W  +L      E++ I L GNK
Sbjct: 68  TAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNK 125

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLA 181
           +D+ +   K + I       +     L ++++SAK+       F  +  KL    +    
Sbjct: 126 VDVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV 179

Query: 182 AQP 184
           A P
Sbjct: 180 ASP 182

>Kwal_56.23361
          Length = 214

 Score = 86.3 bits (212), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA + D   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTDFGELKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA + +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA + +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA + +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-AMIKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG         LA + +   IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAA 182
           D+ +   K + I       +     L ++++SAK+       F  +  KL    +    A
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLDFVA 175

Query: 183 QP 184
            P
Sbjct: 176 SP 177

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 85.5 bits (210), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 92/175 (52%), Gaps = 22/175 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +   DSL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKVD 125

Query: 124 LVDEDCKPRVID-----------SEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           L ++   P+ I+           S+E Q+ A+  G   ++E SAKTG G+ +VF+
Sbjct: 126 LRND---PQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFE 177

>Scas_586.6
          Length = 219

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 88/181 (48%), Gaps = 11/181 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +    ++ +  IKF+ WDTA
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSF-FTNYGE--IKFDCWDTA 69

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     +W  +L      E++ I L GNK+D
Sbjct: 70  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKVD 127

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQ 183
           + +   K + I       +     L ++++SAK+       F  +  KL    +    A 
Sbjct: 128 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVAS 181

Query: 184 P 184
           P
Sbjct: 182 P 182

>Kwal_55.21937
          Length = 208

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 90/175 (51%), Gaps = 22/175 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++        D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----QVDGRQVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +   DSL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILVGCKVD 125

Query: 124 LVDEDCKPRVIDS-----------EEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
           L D    P+ +++            EAQ+ A+  G   ++E SAKTG G+ +VF+
Sbjct: 126 LRD---NPQTVEALRAIGQQPVTGPEAQSVADKIGASAYYECSAKTGYGVREVFE 177

>Scas_691.36
          Length = 212

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 22/175 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +   DSL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKVD 125

Query: 124 LVDEDCKPRVID-----------SEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           L ++   P+ I+           + E Q+ AE  G   ++E SAKTG G+ +VF+
Sbjct: 126 LRND---PQAIEALRADEQQPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFE 177

>Scas_610.4
          Length = 211

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 92/176 (52%), Gaps = 22/176 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +   DSL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKVD 125

Query: 124 LVDEDCKPRVID-----------SEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQG 167
           L ++   P+ I+           S + Q+ A+  G   ++E SAKTG G+ +VF+G
Sbjct: 126 LRND---PQTIEALREEGQQPVSSADGQSVADQIGATGYYECSAKTGFGVREVFEG 178

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 84.0 bits (206), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 89/172 (51%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTD----VEVDGRHVELTLWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P  Y ++N  L+ + +   DSL   Q  W+NE+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILVGCKVD 125

Query: 124 LVDED--------CKPRVIDSEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           L D+            R + + + Q  A+  G + ++E SAK+G G+ +VF+
Sbjct: 126 LRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFE 177

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 83.6 bits (205), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 29/198 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      D D   ++  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVADV----DIDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + V   DSL   Q  WV+E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLVGCKVD 125

Query: 124 LVDEDCKPRV-----------IDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGK 171
           L ++   P+V           + + E  A A   G + + E SA+TG G+ +VF      
Sbjct: 126 LRND---PQVLQQLQAEGQRPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVFD----- 177

Query: 172 LYEQRRESLAAQPQHSSS 189
                R +L+ +P  S+ 
Sbjct: 178 --TATRAALSGKPAASAG 193

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + D   ++  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +   DSL   Q  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG---------LMFHEVSAKTGTGILDVFQ 166
           K+DL ++      + +E  Q  A A G           ++E SAKTG G+ +VF+
Sbjct: 123 KVDLRNDPQTLEQLRAEGLQPVATADGQNVADQIGATGYYECSAKTGYGVREVFE 177

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 80.5 bits (197), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 91/175 (52%), Gaps = 22/175 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F +    T+   +++      + D   ++  +WDTAG
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWDTAG 68

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ Y +   DSL    + W++E+      + + I LVG K D
Sbjct: 69  QEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILVGCKAD 126

Query: 124 LVDEDCKPRVID-----------SEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           L ++   P+VI+             +AQ  A+  G + + E SAKTG G+ +VF+
Sbjct: 127 LRND---PQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFE 178

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 92/176 (52%), Gaps = 22/176 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F +    T+   +++      + D   ++  +WDTAG
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWDTAG 69

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +   DSL    + W++E+      + + I LVG K+D
Sbjct: 70  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGCKVD 127

Query: 124 LVDEDCKPRVIDS-----------EEAQAYAEAHGLM-FHEVSAKTGTGILDVFQG 167
           L ++   P+V++S             AQ  A+  G + + E SAKTG G+ +VF+ 
Sbjct: 128 LRND---PQVVESLRTNGQEPVSQASAQEVADQIGAVEYIECSAKTGFGVREVFEA 180

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 93/178 (52%), Gaps = 22/178 (12%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + D   ++  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVGN 120
           TAGQE Y  L P+ Y ++N  L+ Y +   DSL    + W++E+      + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDLVDEDCKPRVID-----------SEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           K DL ++   P+V++             +AQ  A+  G + + E SAKTG G+ +VF+
Sbjct: 125 KADLRND---PQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFE 179

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 80.5 bits (197), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 90/186 (48%), Gaps = 12/186 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+V++GD + GK+S++  + +  F E    TI   F +    +      +I+  +WDT
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTI---FENYVTNIEGPRGKVIELALWDT 108

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y + +  +V Y      SL  A+  W  E++       ++  LVG K
Sbjct: 109 AGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LVGLK 166

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVFQ-GIGGKLYEQRRES 179
            DL   D   R++D  +A+  A   G   H + SAKT   + DVF   I   LY++    
Sbjct: 167 SDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALYDE---- 222

Query: 180 LAAQPQ 185
           L A PQ
Sbjct: 223 LRAPPQ 228

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 86/164 (52%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++        D   ++  +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTD----CRVDGIKVQLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +   +SL  A++ W  E+     +  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGLKKD 122

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
           L   D + +++  E+A+  A A G   + E SA TG  + DVF+
Sbjct: 123 LRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFE 166

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 84/168 (50%), Gaps = 8/168 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           +++ KLV++GD + GK+S++H F    F E    T+   +++        D   ++  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTD----CRVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y+ L PM Y  A+  L+ + +    SL+ A + W  E      +    I LVG
Sbjct: 61  DTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAP--IILVG 118

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
            K DL     +  ++   +AQ    A G   + E SA TG G+ DVF+
Sbjct: 119 LKKDLRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFE 166

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 80.5 bits (197), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 96/202 (47%), Gaps = 18/202 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
             K+V++GD +VGK+ ++  +V+ +F      TI   F +    +   +  +I+  +WDT
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTI---FENYVTNIEGPNGQIIELALWDT 128

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y NA+  +V Y V  + SL   +  W  E+K         I LVG K
Sbjct: 129 AGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IMLVGLK 186

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVFQG-----IGGKLYEQ 175
            DL + D    +++   A++ A+  G   H + SA+    I +VF+      +   LY  
Sbjct: 187 SDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDSLYAP 246

Query: 176 RRESLAAQPQHSSSIQLQRPTT 197
           R      +P H+     +R TT
Sbjct: 247 R------EPTHTIKNPFKRNTT 262

>Scas_444.4*
          Length = 289

 Score = 80.1 bits (196), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 87/180 (48%), Gaps = 13/180 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
              K+V++GD  VGK+ ++  +V+    EF    I   F +        D  +++  +WD
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQR---EFPTGDIPTVFENYVTDFEGPDGEVVELALWD 118

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAK-AQSWVNELKSKVGDEDLVIFLVGN 120
           TA QE Y  L P+ Y + +  LV Y V    SL    +SW+ E+K       ++  LVG 
Sbjct: 119 TAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--LVGL 176

Query: 121 KLDLVDEDCKP-RVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVF-----QGIGGKLY 173
           K DL D +     ++D +EA+  AE  G + H + SAKT   + DVF       + G LY
Sbjct: 177 KSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVFTVAIRTVLAGSLY 236

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 79.0 bits (193), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 87/190 (45%), Gaps = 25/190 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAD-----HDDAMI 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L D      +  + 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDED-- 112
           K  +WDTAGQE Y  L P+ Y   +  L+ + V + +S       W  E+K     E+  
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 113 -------LVIFLVGNKLDLVDED--------CKPRVIDSEEAQAYAEAHGLM-FHEVSAK 156
                  L I LVG K DL D+D             +  ++ Q      GLM + E SA 
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQIQELVNKLGLMGYVECSAA 179

Query: 157 TGTGILDVFQ 166
           T  G+ +VF+
Sbjct: 180 TQVGVREVFE 189

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 89/173 (51%), Gaps = 6/173 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L R I L   D   + F I D
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTD---VIFSIMD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
             GQ  + ++ P+    A A + ++D+T+ ++L   + W  + +    +E  +  LVG K
Sbjct: 71  LGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARG--FNETAIPLLVGTK 128

Query: 122 LDL-VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLY 173
            DL V+ D   +   S+ +  YA+  G      S  +   +  +F+ I  K +
Sbjct: 129 YDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVIIAKAF 181

>Kwal_55.21941
          Length = 209

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + D   ++  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +   DSL    + W++E+      + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDL-----VDEDCKPR---VIDSEEAQAYAEAHGLM-FHEVSAKTGTGILDVFQ 166
           K+DL     V E+ +      +    AQ  AE  G + + E SAKTG G+ +VF+
Sbjct: 125 KVDLRNDSQVIENLRANGHEPVSQGAAQEVAEQIGAVEYIECSAKTGYGVREVFE 179

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 85/169 (50%), Gaps = 13/169 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++        D   +   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTD----CRVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + V   +SL  A++ W +E      D  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGLKKD 122

Query: 124 L-----VDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
           L       E+    ++  E+A+  A A G   + E SA TG G+ DVF+
Sbjct: 123 LRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFE 171

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 80/162 (49%), Gaps = 5/162 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F SRT+KL      M   EI DTAG
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKLGK---VMYTLEICDTAG 82

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVG-DEDLVIFLVGNKLD 123
           Q+ +  +           LVVY V    S        +++  ++G DE++ + + GNK+D
Sbjct: 83  QDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGNKID 142

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           L  +    R +  EE Q  A++ G  F E SAK    + DV 
Sbjct: 143 LCPDGGNNRQVTREEGQQLAKSLGAGFSECSAKLNWNVEDVM 184

>Kwal_47.16983
          Length = 223

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 89/171 (52%), Gaps = 6/171 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ I L     A I F I D  
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLG---SAEILFYIMDLG 75

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQ  + ++ P+    A A + ++D+T+ ++L   + W    ++   +E  V  LVG K D
Sbjct: 76  GQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEW--HRQATGFNEQAVPLLVGTKYD 133

Query: 124 L-VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLY 173
           L V+ D + +   S+++  YA+A        S      +  +F+ +  KLY
Sbjct: 134 LFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLY 184

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 75.5 bits (184), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 91/178 (51%), Gaps = 8/178 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
             K+V++GD +VGK+S++  + +  F E    TI   F +    L   +  +++  +WDT
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTI---FENYVTNLEGPNGKIVELALWDT 87

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y + +  ++ Y +  + S    +  W+ E+K      D+ I +VG K
Sbjct: 88  AGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFC--PDVPIMIVGLK 145

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVF-QGIGGKLYEQRR 177
            DL  ED     +D+ +A+  A+  G   H + S+K+   + +VF   I   LY++ +
Sbjct: 146 SDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALYDELK 203

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 87/168 (51%), Gaps = 9/168 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ KLV++GD + GK+S+++ F    F E    T+   +++        D   +   +WD
Sbjct: 6   IRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTD----CRVDGIKVSLALWD 61

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGN 120
           TAGQE Y+ L P  Y  A+  L+ + V   +SL  A++ W  E      D  ++  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGL 119

Query: 121 KLDLVDEDCKPRV-IDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
           K DL     +  V ++ E+A+  A+A G   + E SA TG G+ DVF+
Sbjct: 120 KEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFE 167

>Kwal_33.14452
          Length = 260

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 89/196 (45%), Gaps = 39/196 (19%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDA---MIKF 57
           M   K V++GD +VGK+S++  +  ++F +    T+   + + TI L D D A   + + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTT-TIALNDGDSAEPQVFRL 59

Query: 58  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIF 116
            +WDTAGQE Y  L P+ Y   +  L+ + + + +S    +  W  E++     E+L +F
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 117 ---------LVGNKLDLVDEDCKPRVIDSEEAQAYAEAH----------------GLM-F 150
                    LVG K DL D        D  E    AE +                GLM +
Sbjct: 120 RVCGKYPILLVGTKADLRD--------DEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGY 171

Query: 151 HEVSAKTGTGILDVFQ 166
            E SA T  G+ DVF+
Sbjct: 172 VECSAATQVGVADVFE 187

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 84/169 (49%), Gaps = 9/169 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           +++ KLV++GD + GK+S+++ F    F E    T+   +++        D   ++  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTD----CRVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y+ L P  Y  AN  L+ + +   +SL  A++ W  E         +V  LVG
Sbjct: 61  DTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV--LVG 118

Query: 120 NKLDLVDE-DCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
            K DL         V+  E A+  A A G   + E SA TG G+ D+F+
Sbjct: 119 LKKDLRKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFE 167

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 75.5 bits (184), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 8/176 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
             K+V++GD +VGK+ ++  + +  F      TI   ++S   K+    + +I+  +WDT
Sbjct: 77  HLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVS---KVQGPRNKVIELALWDT 133

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V  + S    Q  W  E+K    D    + LVG K
Sbjct: 134 AGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAP--VMLVGLK 191

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVFQ-GIGGKLYEQ 175
            DL   D   +++D ++A   A+  G   H + SAK+   + +VF   +   LY++
Sbjct: 192 SDLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVFNLAMTTALYDE 247

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 74.7 bits (182), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 90/175 (51%), Gaps = 10/175 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L R I L   D   + F I D
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGSTD---VVFSIMD 114

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
             GQ  + ++ P+    A + + ++D+T+ ++L+  + W  + +    +E  +  LVG K
Sbjct: 115 LGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIALLVGTK 172

Query: 122 LDL---VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLY 173
            DL   +D + + ++  S  +  YA+A        S      I  +F+ I  K +
Sbjct: 173 YDLFITMDSEYQEQI--SRTSMKYAQAMDSPLVFCSTSNSINIQKIFKVIIAKAF 225

>Scas_578.7
          Length = 187

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F +    T+   +++        D   +   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTD----CRVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +   +SL  A++ W  E      +    I LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAP--IILVGLKKD 122

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGL-MFHEVSAKTGTGILDVFQ 166
           L  +     ++  E+AQ  A   G   + E SA TG G+ DVF+
Sbjct: 123 LRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFE 166

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 74.3 bits (181), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 91/202 (45%), Gaps = 26/202 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD-----AMI 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI LAD  D      + 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLV 114
           K  +WDTAGQE Y  L P+ Y   +  ++ + V +  S       W  E++     E++ 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 115 IF---------LVGNKLDLVDE--------DCKPRVIDSEEAQAYAEAHGLM-FHEVSAK 156
           +F         LVG K DL ++        +     +D  E        G M + E SA 
Sbjct: 120 LFSSCGKFPILLVGTKADLREDEHELDRLRELNSDFVDRHEIDHAVSKCGFMGYVECSAA 179

Query: 157 TGTGILDVFQ-GIGGKLYEQRR 177
           T  G+ +VF+  +   +YE  R
Sbjct: 180 TQFGVREVFERAVECVVYEPDR 201

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 73.6 bits (179), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 89/174 (51%), Gaps = 8/174 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L R + L   D   + F I D
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTD---VIFSIMD 71

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI-FLVGN 120
             GQ  + ++ P+    A A + ++D+T+ ++L   + W  + +   G  D  I  LVG 
Sbjct: 72  LGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQAR---GFNDTAISILVGT 128

Query: 121 KLDL-VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLY 173
           K DL VD D + +   S  A  YA+         S ++   +  +F+ +  K +
Sbjct: 129 KYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVVIAKAF 182

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 74.3 bits (181), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 107/202 (52%), Gaps = 14/202 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI++   D+ +   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVG 119
           DTAG  ++ ++  +Y ++    L+VY VT   SL +    + E   ++ D D V + L+G
Sbjct: 57  DTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELME-LREQVLRIKDSDRVPMVLIG 115

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRRE 178
           NK DL++E    RVI  EE    +   G + F+E SA   + + +VF  +  ++     E
Sbjct: 116 NKADLINE----RVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 179 SLAAQPQHSSSIQ---LQRPTT 197
           S+A +   + S Q   ++ P+T
Sbjct: 172 SVAVKDARNQSQQFSKIESPST 193

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 73.9 bits (180), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 81/165 (49%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    +      +I+  +WDT
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQGPKGQIIELALWDT 139

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNK 121
           AGQE Y  L P+ Y  A+  ++ Y +    SL   +  W  E++         + LVG K
Sbjct: 140 AGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTP--VMLVGLK 197

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFH-EVSAKTGTGILDVF 165
            DL +E+     +D  EA + A+ +G   H + SAK    + +VF
Sbjct: 198 SDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVF 242

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 93/170 (54%), Gaps = 17/170 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +TI++   D+ +   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKV----GDEDLVIF 116
           DTAG  ++ ++  +Y +     L+VY VT  DSL +    + ELK +V      + + + 
Sbjct: 57  DTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRE----LMELKEQVLRIKDSQRVPMV 112

Query: 117 LVGNKLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVF 165
           LVGNK DLVD+    R+I  EE    +   G + F+E SA   + + +VF
Sbjct: 113 LVGNKADLVDD----RIIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVF 158

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 91/204 (44%), Gaps = 30/204 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDA------- 53
           M   K V++GD +VGK+S++  +  +SF +     I   F + +  +A  D A       
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQ---DYIPTVFDNYSTTIAVQDPASSTGEQQ 73

Query: 54  MIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDED 112
           + K  +WDTAGQE Y  L P+ Y   +  L+ + + +  S    +  W  E+K     E+
Sbjct: 74  LFKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYEN 133

Query: 113 LVIF---------LVGNKLDLVDED--------CKPRVIDSEEAQAYAEAHGLM-FHEVS 154
           + +F         LVG K DL D+D             +   E +   +  G M + E S
Sbjct: 134 MELFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECS 193

Query: 155 AKTGTGILDVFQ-GIGGKLYEQRR 177
           A T  G+ +VF+  +   +YE  R
Sbjct: 194 AATQEGVREVFERAVKYVVYEPDR 217

>Scas_703.41
          Length = 225

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 70/119 (58%), Gaps = 7/119 (5%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL R +KL   D   I F + D  GQ+ 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTD---IVFSLMDLGGQKE 81

Query: 68  YKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI-FLVGNKLDLV 125
           + ++ P+    ++  + ++D+T+ ++L   + W  ++K   G  D+ I  LVG K DL+
Sbjct: 82  FINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTKYDLL 137

>Scas_671.35
          Length = 234

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 94/217 (43%), Gaps = 46/217 (21%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++         D+  I   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV----DNKHITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGN 120
           TAGQE +  L  + Y + +  ++ + +   DSLA  Q  WV E+      E + + LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHC--EGVKLVLVAL 128

Query: 121 KLDLVDED-----CKPRVI------DS--------------------EEAQAYAEAHG-L 148
           K DL + D       P VI      DS                    EE  A A+  G L
Sbjct: 129 KCDLRNNDNERSAITPGVIKQQSQTDSVNDLQQQEYQRNNGNNLISYEEGLAMAKKVGAL 188

Query: 149 MFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQPQ 185
            + E SAK   G+ + F        E  R +L A PQ
Sbjct: 189 RYLECSAKLNKGVNEAFT-------EAARVALTAGPQ 218

>Scas_417.3
          Length = 291

 Score = 71.6 bits (174), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 92/199 (46%), Gaps = 34/199 (17%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSF---------DEFRES-TIGAAFLSRTIKLADH 50
           M Q K V++GD +VGK+S++  +  ++F         D +  + ++   FLSR   LA+ 
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTISLRDPFLSRE-SLANE 59

Query: 51  DD----AMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAK-AQSWVNELK 105
           ++     + K  +WDTAGQE Y  L P+ Y   +  L+ + V +  S       W+ E+K
Sbjct: 60  NENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIK 119

Query: 106 SKVGDED---------LVIFLVGNKLDLVD--------EDCKPRVIDSEEAQAYAEAHGL 148
                E          L I L+G K DL D        ++   + I  ++     + +G 
Sbjct: 120 QNANVESSELFLQFGKLPIMLIGTKADLRDDEAVQKKLQETNSQFITRDQIDQVVDKYGF 179

Query: 149 M-FHEVSAKTGTGILDVFQ 166
           + + E SA T  G+ +VF+
Sbjct: 180 LGYVECSAATQMGVREVFE 198

>Scas_677.20
          Length = 283

 Score = 71.6 bits (174), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 98/212 (46%), Gaps = 24/212 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKL-----ADHDDAMI 55
           M   K  ++GD  VGK+ ++  +  ++F      T+   + S TI L        +    
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLV 114
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + V    SL   +S WV E+K+   +++L 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 115 IF---------LVGNKLDL-VDEDCKPRVIDSEEAQAYAEAHGLM-FHEVSAKTGTGILD 163
           +F         LVG K D   D++   +   +E  Q+  +  G + + E SA +  GI D
Sbjct: 120 VFQSRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALSQMGIKD 179

Query: 164 VFQG------IGGKLYEQRRESLAAQPQHSSS 189
           VF+        G  +    R ++AAQ   ++S
Sbjct: 180 VFEEAVKAVVYGDGIETPERGAMAAQKTRTTS 211

>Scas_547.3
          Length = 223

 Score = 70.5 bits (171), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 82/145 (56%), Gaps = 6/145 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L R +++   +   I F + D
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN---IVFSLMD 79

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
             GQ+ + ++ P+   N++  + ++D+T+ +SL   ++W   +++   + D V  LVG K
Sbjct: 80  LGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWY--MQAHGLNHDAVCILVGTK 137

Query: 122 LDL-VDEDCKPRVIDSEEAQAYAEA 145
            DL +D   + +   S  +  YA+A
Sbjct: 138 YDLFIDLPTEYQEQISRTSMKYAQA 162

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 105/246 (42%), Gaps = 51/246 (20%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSF---------DEFRES-TIGAAFLSRTIKLADH 50
           M   K V++GD +VGK+S++  +  +SF         D +  +  I     S  ++L + 
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 51  DDA----------------MIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSL 94
           +D                 + K  +WDTAGQE Y  L P+ Y   +  L+ + V++  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 95  AK-AQSWVNELK-----------SKVGDEDLVIFLVGNKLDLVDEDCKPR--------VI 134
           A   + W+ ELK           +K+G     I LVG K DL D+    +         +
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLG--KYPILLVGTKSDLRDDPATQKKLQEANSDYV 178

Query: 135 DSEEAQAYAEAHGLM-FHEVSAKTGTGILDVF-QGIGGKLYEQRRESLAAQPQHSSSIQL 192
             EE     +  G M + E SA T  G+ +VF Q +   +YE    +  +   H+ + +L
Sbjct: 179 SQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSA-NHTLTDEL 237

Query: 193 QRPTTN 198
              TTN
Sbjct: 238 TTATTN 243

>Kwal_26.8387
          Length = 292

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 87/167 (52%), Gaps = 10/167 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  + +     DD +   +I DT
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI----DDKVSILDILDT 71

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVGNK 121
           AGQE Y ++   Y R     L+VY VT   S  +  ++  ++  +V D D V +FLVGNK
Sbjct: 72  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQI-LRVKDADYVPVFLVGNK 130

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI 168
            DL DE    R +  EE  + A+     F E SAK    + D F G+
Sbjct: 131 SDLEDE----RQVAYEEGVSLAKQFNAPFMETSAKQAINVEDSFYGL 173

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 68.2 bits (165), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 88/171 (51%), Gaps = 12/171 (7%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL R + +   D   I F + D  GQ  
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTD---IVFSLMDLGGQRE 89

Query: 68  YKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI-FLVGNKLDL-- 124
           + ++ P+    ++  ++++D+T+ ++L   + W    +  +G  D  I  LVG K DL  
Sbjct: 90  FINMLPIATLGSSVIILLFDLTRPETLNSIKEW---YRQALGLNDSAIPILVGTKYDLFI 146

Query: 125 -VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
            ++E+ + +V  S+ +  YA+         S      I  +F+    K+++
Sbjct: 147 DLEEEYQEKV--SKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFD 195

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 68.2 bits (165), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 87/167 (52%), Gaps = 11/167 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + D+ +   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSYR----KTMEIDNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVG 119
           DTAG  ++ ++  +Y ++    L+VY V+   SL +    + E   ++ D D V I LVG
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLE-LREQVLRIKDSDRVPIVLVG 115

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVF 165
           NK DL DE    RVI  EE    +   G + F+E SA   + + +VF
Sbjct: 116 NKADLQDE----RVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVF 158

>Kwal_23.4875
          Length = 230

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 91/211 (43%), Gaps = 40/211 (18%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++         D+  I   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFV----DNQHITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDEDLVIFLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   Q  WV E+      E + + LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHC--EGVKLVLVAL 127

Query: 121 KLDL--------VDEDCKP-----------------RVIDSEEAQAYAEAHG-LMFHEVS 154
           K DL        +D    P                  +I  EE  A A+  G L + E S
Sbjct: 128 KCDLRSNNEEFALDSAITPGNIQQQQQQQQSSLQSNGLISYEEGLAMAKKIGALRYLECS 187

Query: 155 AKTGTGILDVFQGIGGKLYEQRRESLAAQPQ 185
           AK   G+ + F        E  R +L A P+
Sbjct: 188 AKMNRGVNEAFT-------EAARCALTASPR 211

>Kwal_14.2244
          Length = 244

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 84/166 (50%), Gaps = 9/166 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + D+ +   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYR----KTMEIDNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAG  ++ ++  +Y ++    L+VY VT   SL +      ++     +  + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPMVLVGN 116

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVF 165
           K DL DE    RVI  EE    +   G + F+E SA   + + +VF
Sbjct: 117 KADLQDE----RVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVF 158

>Scas_575.10
          Length = 271

 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 97/183 (53%), Gaps = 11/183 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI++   D+ +   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVG 119
           DTAG  ++ ++  +Y ++    L+VY VT   SL +    + E   ++ D D V + LVG
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELME-LREQVLRIKDTDRVPMVLVG 115

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRRE 178
           NK DL ++    RVI  EE    +   G + F+E SA   + + +VF  +  ++     E
Sbjct: 116 NKADLTED----RVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 179 SLA 181
           ++A
Sbjct: 172 TVA 174

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 83/179 (46%), Gaps = 24/179 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           K+V+LGD + GK+S+++ F +  F E  E T+   ++         D+  I   +WDTAG
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV----DNRHITLSLWDTAG 77

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGNKLD 123
           QE +  L  + Y + +  ++ + +   DSL   ++ WV E+       +LV  LV  K D
Sbjct: 78  QEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVALKCD 135

Query: 124 LVDED---CKP-------------RVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVF 165
           L + +     P              +I  EE  A A+  G L + E SAK   G+ + F
Sbjct: 136 LRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGVNEAF 194

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 90/214 (42%), Gaps = 44/214 (20%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++      + H    I   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKH----ITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGN 120
           TAGQE +  L  + Y +    ++ + +   DSL   Q+ WV E+      E + + LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC--EGVKLVLVAL 128

Query: 121 KLDLVDEDCKP-----------------------------RVIDSEEAQAYAEAHG-LMF 150
           K DL + + +                               +I  EE  A A+  G L +
Sbjct: 129 KCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRY 188

Query: 151 HEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQP 184
            E SAK   G+ + F        E  R +L A P
Sbjct: 189 LECSAKLNKGVNEAFT-------EAARVALTAGP 215

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 66.6 bits (161), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 83/166 (50%), Gaps = 9/166 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + DD     EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSYR----KSMEIDDKAFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120
           DTAG  ++ ++  +Y ++    L+VY VT   SLA+      ++      + + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVLVGN 116

Query: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVF 165
           K DL +E    R I  EE    +   G + F+E SA   + + +VF
Sbjct: 117 KADLQNE----RAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVF 158

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 36/207 (17%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E TI   ++         D+  I   +WD
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIFV----DNQHISLSLWD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   Q+ WV E+      E + + LV  
Sbjct: 69  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHC--EGVKLVLVAL 126

Query: 121 KLDLVDED--------CKPRVIDSEEAQA-------YAEA-------HGLMFHEVSAKTG 158
           K DL + +          P  I +  + A       Y E          L + E SAK  
Sbjct: 127 KCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGLISYEEGLDMAKKIGALRYLECSAKMN 186

Query: 159 TGILDVFQGIGGKLYEQRRESLAAQPQ 185
            G+ + F        E  R +L A P+
Sbjct: 187 RGVNEAFT-------EAARCALTATPK 206

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 92/207 (44%), Gaps = 36/207 (17%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++         D+  I   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFV----DNQHITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQS-WVNELKSKVGDEDLVIFLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   ++ WV+E+      E + + LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHC--EGVKLVLVAL 127

Query: 121 KLDLVDED-------CKPRVIDSE--------------EAQAYAEAHG-LMFHEVSAKTG 158
           K DL   D         P  I ++              E  A A+  G L + E SAK  
Sbjct: 128 KCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIPYDEGLAMAKQIGALRYLECSAKMN 187

Query: 159 TGILDVFQGIGGKLYEQRRESLAAQPQ 185
            G+ + F        E  R +L A P+
Sbjct: 188 RGVNEAFT-------EAARCALTATPK 207

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 83/169 (49%), Gaps = 8/169 (4%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL R + +   D   I F I D  GQ  
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTD---IIFSIMDLGGQRE 81

Query: 68  YKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI-FLVGNKLD-LV 125
           + ++ P+    ++  + ++D+T+ ++L+  + W    +   G  D  I  LVG K D L+
Sbjct: 82  FINMLPIATVGSSVIIFLFDLTRPETLSSIKEW---YRQAYGLNDSAIPILVGTKYDLLI 138

Query: 126 DEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYE 174
           D D + +   S  +  YA+         S      I  +F+    K++ 
Sbjct: 139 DLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFN 187

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 94/186 (50%), Gaps = 17/186 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + ++K+V++G   VGKS++  +F++  F +  + TI  ++  + +     DD +   +I 
Sbjct: 8   IREYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVV----IDDKVSILDIL 63

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVG 119
           DTAGQE Y ++   Y R     L+VY VT  +S  +  S+  +++ +V D D + + +VG
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVVVVG 122

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI-------GGKL 172
           NKLDL +E    R +  E+    A+     F E SAK    + + F  +       GGK 
Sbjct: 123 NKLDLENE----RQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDDGGKY 178

Query: 173 YEQRRE 178
               R+
Sbjct: 179 NSMNRQ 184

>Kwal_55.21971
          Length = 421

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 34  STIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQED 92
           STIG    +  + +   D+   K  +WDTAGQERY++ + P  Y+ +N  L+ YD+    
Sbjct: 202 STIGVDIRTNLVNI---DNRYFKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSRK 258

Query: 93  SLAKA-QSWVNE-LKSKVGDEDLVIFLVGNKLDL 124
           S       W+ E L     D+ L I+LVGNK+DL
Sbjct: 259 SFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDL 292

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 34  STIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQED 92
           STIG    +  + +   D+      +WDTAGQERY++ + P  Y+  NA ++ YD+T   
Sbjct: 142 STIGIDIKTNLVNI---DNRFFNVILWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAK 198

Query: 93  SLAKA-QSWVNELKSKVGDEDLV---IFLVGNKLDLVDE 127
           S     + W+ +       +DL+    FLVGNK+DL  E
Sbjct: 199 SFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKE 237

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 83/196 (42%), Gaps = 21/196 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDA-MIKFEI 59
           M   K VL+GDS VGK++ +  +   SF      T+   +L+    + D +         
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT---TIQDKETGYTFHTTF 57

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQ-SWVNELKSKVGDED----LV 114
           WDT+G +++  L P+ Y   +  L  +      S    +  W+ ELK  +   D    + 
Sbjct: 58  WDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSSTVP 117

Query: 115 IFLVGNKLDLVDEDCKPRVID-SEEAQAYAEAHGLM-----------FHEVSAKTGTGIL 162
           I LV  K DL D++    +++ S+E         L+           F + S+KTG G+ 
Sbjct: 118 ILLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYGLQ 177

Query: 163 DVFQGIGGKLYEQRRE 178
           DV   +   +  + RE
Sbjct: 178 DVIDNVAKYVGAKERE 193

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 58/132 (43%), Gaps = 19/132 (14%)

Query: 54  MIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAK-AQSWVNELKSKVGDE- 111
           + K  +WDTAGQE Y  L P+ YR  +  L+ + V++  S       W  ELK   G E 
Sbjct: 116 IFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIES 175

Query: 112 -DLV-------IFLVGNKLDLVDE--------DCKPRVIDSEEAQAYAEAHGLM-FHEVS 154
            DL        I LVG K DL D+        D     +  EE     E +G M + E S
Sbjct: 176 GDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVECS 235

Query: 155 AKTGTGILDVFQ 166
           A T   +  VF+
Sbjct: 236 AATQNNVRQVFE 247

>Scas_697.46
          Length = 324

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 84/164 (51%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++KLV++G   VGKS++  + +   F +  + TI  ++  + +     DD +   ++ DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVV----IDDKVTVLDVLDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVGNK 121
           AGQE Y ++   Y R     L+VY VT ++S  +  ++  +++ +V D D + + +VGNK
Sbjct: 66  AGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQ-RVKDSDYIPVVIVGNK 124

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
            DL DE    R +  +     A+     F E SAK    + + F
Sbjct: 125 SDLEDE----RQVPYQSGVNLAKQMNAPFLETSAKQAINVEEAF 164

>Kwal_34.16142
          Length = 192

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F ++ I L          EI DTAG
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQF-TKQIVLGR---TTYTLEICDTAG 68

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLDL 124
           Q+ +  +            +VY      S    +   +++  +VG E +   ++GNK+DL
Sbjct: 69  QDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNKIDL 128

Query: 125 VDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGI 161
            D       +  +E +  A   G  F E SAK   G+
Sbjct: 129 RDSGINGGKVRRQEGEELAARLGAGFVECSAKLNIGV 165

>Kwal_23.2944
          Length = 184

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 14/164 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F   T+   +     +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDLVIFLVG 119
            GQ+R + L   Y+    A + V D    + L +A+    EL S +GD   E++V+ ++ 
Sbjct: 69  GGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAKE---ELYSIIGDKEMENVVLLVLA 125

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILD 163
           NK DL        + D  E +A+ ++        +A TG G+++
Sbjct: 126 NKQDLKGAMNPQEISDYLELKAHLDSQLWCVIGSNALTGQGLVE 169

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 80/166 (48%), Gaps = 8/166 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  + +     D  +   +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI----DGQVSILDILDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE Y ++   Y R     L+VY VT   S  +  ++  ++      E + IF+VGNK 
Sbjct: 66  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQILRVKDVEYVPIFVVGNKS 125

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI 168
           DL  E    R +  EE    A      F E SAK    + + F G+
Sbjct: 126 DLEGE----RQVSFEEGAELARHFNASFLETSAKQAINVEESFYGL 167

>Kwal_23.3135
          Length = 191

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+         +I  VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--VG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL D+          + R I +E+ +  A E   + + E SA T  G+ +VF
Sbjct: 115 TQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSALTQRGLKNVF 169

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 79/175 (45%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+         +I  VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--VG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL D+          + R I  E+ +  A E   + + E SA T  G+ +VF
Sbjct: 115 TQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVF 169

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 57.8 bits (138), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 85/164 (51%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++KLV++G   VGKS++  +  +  F +  + TI  ++  + +     DD +   +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVV----IDDEVSILDILDT 65

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVGNK 121
           AGQE Y ++   Y RN    L+VY +T + SL +  ++  ++  +V D D V I +VGNK
Sbjct: 66  AGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDTDYVPIVVVGNK 124

Query: 122 LDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
            DL +E    + +  ++    A+     F E SAK    + + F
Sbjct: 125 SDLENE----KQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAF 164

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 57.8 bits (138), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 8/163 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  + +     DD +   +I DT
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVVI----DDKVTILDILDT 63

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQE Y ++   Y R     L+VY VT   S  +  ++  +++     E + + +VGNK 
Sbjct: 64  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQRVKDVEYIPVVVVGNKS 123

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVF 165
           DL  E    R +  EE  + A+     F E SAK    + D F
Sbjct: 124 DLETE----RQVSFEEGASLAKQLNAPFLETSAKQAINVEDAF 162

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 56.2 bits (134), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 79/175 (45%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+         +I  VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCLI--VG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL +           + R I  E+ + +A E   + + E SA T  G+ +VF
Sbjct: 115 TQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVF 169

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 56.2 bits (134), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 79/175 (45%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+        +   +VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHC--PGVPCLVVG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL D+          + R I SE+    A E   + + E SA T  G+ +VF
Sbjct: 115 TQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVF 169

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 80/175 (45%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+        +   +VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHC--PGVPCLVVG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL D+          + R I +E+ +  A E   + + E SA T  G+ +VF
Sbjct: 115 TQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQRGLKNVF 169

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 78/164 (47%), Gaps = 14/164 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+++LG    GK++I+++      ++ + ST    F   T+   +     +KF +WD 
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDLVIFLVG 119
            GQ+R + L   Y+    A + V D +  + + +A+    EL S +G+   E++V+ +  
Sbjct: 69  GGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKE---ELYSIIGEKEMENVVLLVWA 125

Query: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILD 163
           NK DL D      V D  E +   +         +A +G G+++
Sbjct: 126 NKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVE 169

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 74/158 (46%), Gaps = 7/158 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSR-TIKLADHDDAMIKFEIWDTA 63
           K+++LG  +VGK++++ +  +  F E    TI   F+    +K  +  +     +I DT+
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPNGTELKFNLDIVDTS 66

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQ+ +  +           +++Y V    S    +   +++   +G  +L + LVGNK+D
Sbjct: 67  GQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVGNKID 126

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGI 161
           L       R +  +E +  A+     F E+  K G+GI
Sbjct: 127 L------DRQVSYKEGEELAKRLKCGFVEICVKQGSGI 158

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F +R I    HD  +   EI D
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIPYKSHDCTL---EILD 70

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQ+    L           ++ Y +    S        ++L  ++G ++L + LVG K
Sbjct: 71  TAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTK 130

Query: 122 LDL 124
            DL
Sbjct: 131 ADL 133

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 10/127 (7%)

Query: 33  ESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQE 91
           +STIG    +      D D  + K  +WDTAGQERY+ ++ P  Y+     ++ YD+   
Sbjct: 165 KSTIGVDIKT---SFVDIDRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICSR 221

Query: 92  DSLAKA-QSWVNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYA-EAHGLM 149
           ++     + W+ E       E    +LVGNK+DL     K R +   +  A+A EA    
Sbjct: 222 ETFPDCLEHWLPEALEHCQVEHTRFYLVGNKVDLY----KQRQVTHADVLAFADEAKRRY 277

Query: 150 FHEVSAK 156
             E+S K
Sbjct: 278 GFEISGK 284

>Scas_697.54*
          Length = 181

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 63/122 (51%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + ST    F   T+   +     +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQER + L   Y+    A + V D + ++ L +A+  +  + S+   E +V+ +  NK 
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAKEELYSIISEKEMEKVVLLVWANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 14/124 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            K+++LG  + GK++I+++      ++ + S     F   T+   +     +KF +WD  
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYKN-----VKFNMWDVG 52

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDLVIFLVGN 120
           GQER + L   Y+    A + V D   +D L +A+    E  S VG+   E +V+ ++ N
Sbjct: 53  GQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAKE---EFYSIVGEKEMEKVVLLVLAN 109

Query: 121 KLDL 124
           K DL
Sbjct: 110 KQDL 113

>Scas_721.96
          Length = 191

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 16/175 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           M   K V +GD +VGK+ ++  +  + F      T+   + + T+ + D    +    ++
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIFLVG 119
           DTAGQE Y  L P+ Y + +  LV + V    S     + W  E+         +I  VG
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--VG 114

Query: 120 NKLDLVDEDC--------KPRVIDSEEAQAYA-EAHGLMFHEVSAKTGTGILDVF 165
            ++DL  +          + R I  E+ +  A E   + + E SA T  G+ +VF
Sbjct: 115 TQIDLRSDPIIIEKLQRQRLRPISPEQGERLARELKAVKYVECSALTQRGLKNVF 169

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F   T+   +     +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDLVIFLVG 119
            GQER + L   Y+    A + V D   +  L +A+    EL S +G+   E++V+ ++ 
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAKE---ELYSIIGEKEMENVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Scas_628.21
          Length = 208

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 11/174 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F     KL D  +     EI D
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF----TKLIDFKNQHFTLEIVD 68

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNK 121
           TAGQ+    L           ++ Y V    +        ++L  ++  +D+ + +VGNK
Sbjct: 69  TAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGNK 128

Query: 122 LDLVDEDCKPRVIDSEEAQAYA-------EAHGLMFHEVSAKTGTGILDVFQGI 168
           +DL ++     V+  +E +  A       +     F E SAK  T +   FQ +
Sbjct: 129 IDLRNDLDNRTVVTKQEGKKLANLIRSSDKNIKAGFIECSAKDDTNVGTTFQKL 182

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 56/122 (45%), Gaps = 18/122 (14%)

Query: 18  SIVHRFVKDSFDEFRES------------TIGAAFLSRTIKLADHDDAMIKFEIWDTAGQ 65
           S  H+ +K+  D  ++S            TIG    +  I +   D+   K  +WDTAGQ
Sbjct: 180 STSHQMIKEEPDNQKDSQDPDEIVIDTKTTIGIDIKTSLINI---DNRFFKVIMWDTAGQ 236

Query: 66  ERYKS-LAPMYYRNANAALVVYDVTQEDSLAKA-QSWVNELKSKVGDEDLVIF-LVGNKL 122
           ERY++ + P  Y+ +N  ++ YD+    S       W+ E      D     F LVGNK+
Sbjct: 237 ERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLGKTRFYLVGNKI 296

Query: 123 DL 124
           DL
Sbjct: 297 DL 298

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 52.0 bits (123), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 33  ESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQE 91
           ++TIG    +  I +   D+ +    +WDTAGQERY++ + P  Y+ +NA ++ YD+T +
Sbjct: 237 KTTIGVDIKTNIINI---DNRIFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDITDK 293

Query: 92  DSLAKA-QSWVNELKSKVGDEDL---VIFLVGNKLDL 124
            S   + + W+ E        D      + +GNK DL
Sbjct: 294 CSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDL 330

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F   T+   +     +KF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDLVIFLVG 119
            GQ R + L   Y+   +A + V D   ++ L +A+    EL S +G+   E +V+ ++ 
Sbjct: 69  GGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAKE---ELFSIIGEKEMEKVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 34  STIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKS-LAPMYYRNANAALVVYDVTQED 92
           STIG    +    L + D+   +  +WDTAGQERY++ +    Y+ +N  ++ YD+   +
Sbjct: 159 STIGIDIKT---NLVNIDNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDICDFN 215

Query: 93  SLAKAQS-WVNELKSKVGDEDLVIF-LVGNKLDLVDE 127
           S     + W+ E    + +  +  F LVGNKLDL  E
Sbjct: 216 SFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDLYKE 252

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 75/168 (44%), Gaps = 15/168 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           QF +++LG  + GK++ +    K+     +        + + +      D ++KF  WD 
Sbjct: 17  QFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKITPTVGQNVATIPVQDCVLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED---LVIFLVG 119
            GQE  +SL   YY  A+  + V D T  D L + +     L+S V DED   + + ++ 
Sbjct: 75  GGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECKE---TLRSIVMDEDVEGVPVLMLA 131

Query: 120 NKLDLVDEDCKPRVIDSEEA-QAYAEAHGL---MFHEVSAKTGTGILD 163
           NK D  D   +  V D +E     AE  G        +SA TG G+ D
Sbjct: 132 NKQDRED---RMEVQDIKEIFNKIAEHLGARDSRVLPISALTGEGVTD 176

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 6/99 (6%)

Query: 71  LAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-IFLVGNKLDLVDEDC 129
           +   Y R     L+VY VT + S  +  ++  ++  +V D D V +F++GNK DL DE  
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDLEDE-- 57

Query: 130 KPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI 168
             R +  EE Q  A+     F E SAK    + + F G+
Sbjct: 58  --RQVSYEEGQTLAKQFDAPFLETSAKQNINVEESFYGL 94

>Scas_503.2
          Length = 527

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (46%), Gaps = 14/111 (12%)

Query: 25  KDSFDEFRE------STIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKS-LAPMYYR 77
           K SFD+  E       TIG    S  + +       I    WD AGQ+R+K+ +    Y+
Sbjct: 236 KASFDDREEMIIDTRPTIGIDIKSTLVNIQGKKYNCI---FWDPAGQDRFKNVMMDSLYK 292

Query: 78  NANAALVVYDVTQEDSLAK-AQSWVNELKSKVGDEDLV---IFLVGNKLDL 124
            +NA ++ YD+    S     + W+NE    V   DL     +LVGNKLDL
Sbjct: 293 ISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEIKFYLVGNKLDL 343

>Kwal_47.18241
          Length = 230

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L           I+D 
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-------IVRIFDL 56

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQ R++ L   Y+  A+  + V D+  + + A+ +  V ++      + + + ++GNK+
Sbjct: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116

Query: 123 DLV 125
           DL+
Sbjct: 117 DLI 119

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 71/175 (40%), Gaps = 19/175 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKL 172
           DL      P  + + E       H +           A TG G+ +  + +   L
Sbjct: 129 DL------PEAMSAAEITEKLGLHSIRNRPWFIQATCATTGEGLYEGLEWLSNNL 177

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 72/178 (40%), Gaps = 19/178 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLYEQ 175
           DL      P  + + E       H +           A +G G+ +  + +   L  Q
Sbjct: 129 DL------PEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQ 180

>Scas_624.4*
          Length = 181

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 72/178 (40%), Gaps = 19/178 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLYEQ 175
           DL      P  + + E       H +           A +G G+ +  + +   L  Q
Sbjct: 129 DL------PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNLKNQ 180

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 74/182 (40%), Gaps = 27/182 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED----LVIFLV 118
            GQ+R +SL   YYRN    + V D      + +A+    E+  ++ +ED     V  + 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR----EVMQRMLNEDELRNAVWLVF 124

Query: 119 GNKLDLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLY 173
            NK DL      P  + + E       H +           A +G G+ +  + +   L 
Sbjct: 125 ANKQDL------PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNLS 178

Query: 174 EQ 175
            Q
Sbjct: 179 NQ 180

>Kwal_27.11872
          Length = 197

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 59/127 (46%), Gaps = 8/127 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           Q+ +++LG  + GK++ +    ++     +        + + +      + ++KF  WD 
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVPVGNCLLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED---LVIFLVG 119
            GQE  ++L P YY+ A+  + V D    + L +       L++ V DED   + + ++ 
Sbjct: 75  GGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIPVLMLA 131

Query: 120 NKLDLVD 126
           NK D  D
Sbjct: 132 NKQDRED 138

>Scas_701.42*
          Length = 181

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 72/178 (40%), Gaps = 19/178 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ+R +SL   YYRN    + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLYEQ 175
           DL      P  + + E       H +           A +G G+ +  + +   L  Q
Sbjct: 129 DL------PEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNLKNQ 180

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 52/110 (47%), Gaps = 12/110 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED 112
            GQ+R +SL   YYRN    + V D      + +A+    E+  ++ +ED
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR----EVMQRMLNED 114

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ++ + L   Y+RN    + V D      +A+A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/169 (17%), Positives = 72/169 (42%), Gaps = 9/169 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
            +++++G    GK++I+++       E   +     F   T++  +     I F +WD  
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDVG 52

Query: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
           GQ++ + L   Y+RN    + V D      +++A+  +  + ++    + V+ +  NK D
Sbjct: 53  GQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQD 112

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           L +      + +     +  + H  +     A +G G+ +  + +   L
Sbjct: 113 LPEAMSAAEITEKLGLHSIRQ-HPWIIQATCAASGEGLYEGLEWLSNNL 160

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ++ + L   Y+RN    + V D      +A+A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DL 124
           DL
Sbjct: 129 DL 130

>Kwal_56.24453
          Length = 181

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/178 (17%), Positives = 73/178 (41%), Gaps = 19/178 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ++ + L   Y+RN    + V D      +++A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLYEQ 175
           DL      P  + + E       H +           A +G G+ +  + +   L  Q
Sbjct: 129 DL------PEAMSAAEITEKLGLHSIRQRPWFIQAACATSGEGLYEGLEWLSNNLKNQ 180

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFR-ESTIGAAFLSRTIKLADHDDAMIKFEIWD 61
           + + ++LG  + GKS++V   ++      R   T+G  F   TI+ A H+      ++WD
Sbjct: 42  ELRSLVLGLDNSGKSTVVDWLLERGEKRSRITPTVG--FRIHTIEYAGHN-----VQLWD 94

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDEDLVIFLV 118
             GQ   +     Y+   +  L V DVT     +++ + + +L   + ++G    +I L+
Sbjct: 95  IGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKMIVLL 154

Query: 119 GNKLDLVDED 128
            NK+DL+DED
Sbjct: 155 -NKMDLIDED 163

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 80/169 (47%), Gaps = 18/169 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVK--DSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60
           + + ++LG  + GKS+IV++ +   +  ++    T+G    S  IK     D  I   +W
Sbjct: 16  EIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIK-----DVTI--SLW 68

Query: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQ----EDSLAKAQSWVNELKSKVGDEDLVIF 116
           D  GQ   +     Y+    A +   DV+     +++L + +  +N  ++++G E  VI 
Sbjct: 69  DIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVI- 127

Query: 117 LVGNKLDLVDEDC----KPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGI 161
           +V NK+DLV++      +  +++SE    +     +   + S  TG GI
Sbjct: 128 VVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGI 176

>Kwal_56.24462
          Length = 181

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 75/182 (41%), Gaps = 27/182 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + +++++G    GK++++++       E   +     F   T++  +     I F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKA----QSWVNELKSKVGDEDLVIFLV 118
            GQ++ + L   YYRN    + V D      +++A    Q  +NE   ++ +  L++F  
Sbjct: 69  GGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNE--DEIRNASLLVF-- 124

Query: 119 GNKLDLVDEDCKPRVIDSEEAQAYAEAHGL-----MFHEVSAKTGTGILDVFQGIGGKLY 173
            NK DL      P  + + E       H +           A +G G+ +  + +   L 
Sbjct: 125 ANKQDL------PEAMSAAEITEKLGLHSIRQRPWFIQATCATSGEGLYEGLEWLSNSLK 178

Query: 174 EQ 175
            Q
Sbjct: 179 NQ 180

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 81/180 (45%), Gaps = 16/180 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKL-ADHDDAMIKFEIWD 61
           + + ++LG  + GKS+IV+  + +S ++    T    F   +I + +  D    K  +WD
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGFQIHSIVVESAQDGKTYKVNLWD 74

Query: 62  TAGQERYKSLAPMYYRNANAALVVYDVTQ----EDSLAKAQSWVNELKSKVGDEDLVIFL 117
             GQ   +     Y+   +  L   D+      ++S  + +  V + + ++G +  ++  
Sbjct: 75  IGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVMQDRDRIGYQCKLVVA 134

Query: 118 VGNKLDLVDE-DCKPRVIDSEEAQAYAEAHGLMFHE--------VSAKTGTGILDVFQGI 168
           + NK+DLV++ D +    D E+   +   HG    E         S KTG GI ++ Q I
Sbjct: 135 I-NKIDLVEQADLEHYAHDIEQKIEHILHHGQSVGESSIGHYVLCSGKTGAGIENLAQMI 193

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ   +     YY N  A + V D T +D ++ A   ++ +  +   +D  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTASKELHMMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QVGEVVTTKPTIGFNVETLTYRN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDL---VIFLVG 119
            GQ   +     YY N  A + V D T +D +  A     EL + + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVA---ARELHTMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 69/126 (54%), Gaps = 17/126 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           +++LLG  + GK++++++ + +  D+  + TIG  F  +T+KL++        ++WD  G
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIG--FQIKTLKLSNK-----VLQMWDIGG 69

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV-----IFLVG 119
           Q+  +     Y+   +  + V D+  ++ L ++ + + E+   V + D +     +F++ 
Sbjct: 70  QKTLRPFWFNYFEKTDYLIWVIDIL-DNRLMESLTLLEEI---VQENDRINLQFEVFILL 125

Query: 120 NKLDLV 125
           NK+DL+
Sbjct: 126 NKIDLL 131

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 38.9 bits (89), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 14/182 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           Q+ +++LG  + GK++ +    K+    F+        + + +     D   I  + WD 
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQI-LKFWDV 75

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDL---VIFLVG 119
            GQE  +S+   YY   +  + + D +  + L +  +    L+S V DE++    I ++ 
Sbjct: 76  GGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEEIEGVPILMLA 132

Query: 120 NKLDLVDEDCKPRVIDSEEA----QAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQ 175
           NK D  D   +  V D +E       +  A       +SA TG G+ D  + +  +L   
Sbjct: 133 NKQDRQD---RMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERN 189

Query: 176 RR 177
           ++
Sbjct: 190 KK 191

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 69/158 (43%), Gaps = 32/158 (20%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIK------------LADH 50
            F++++LGD  VGK+S++ +++ D++    E+T       + I             +A+ 
Sbjct: 20  NFRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEK 79

Query: 51  D----------------DAMIKFEIWDTAGQ---ERYKS-LAPMYYRNANAALVVYDVTQ 90
           D                  +IK EI D       E Y + L  +  + ++A ++ +D   
Sbjct: 80  DVIDFNLDNSHRFQYTNKDLIKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGKS 139

Query: 91  EDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLDLVDED 128
           + +    + + N +K  +G+E + + +   K+D + ED
Sbjct: 140 QTTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLMED 177

>Scas_567.9
          Length = 199

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 80/185 (43%), Gaps = 19/185 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDEFRESTIGAAFLSRTIKLADHDDAMIK 56
           Q+ +++LG  + GK++ +    K+        D+    T+G    + ++   +++  ++K
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNVATISV---ENNKKLLK 72

Query: 57  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIF 116
           F  WD  GQE  +S+   YY   +  + V D T    + +    + ++      E + I 
Sbjct: 73  F--WDVGGQENLRSMWSEYYSQCHGIIFVVDSTDRSRIDECSKTLGKIVMDDEVEGVPIL 130

Query: 117 LVGNKLDLVDEDCKPRVIDSEE----AQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKL 172
           ++ NK D+ +   +  V D +E       +  A       VSA TG G+ D    +  +L
Sbjct: 131 MLANKQDMPE---RMEVQDIKEIFNQIAEHLSARDSRVLPVSALTGEGVKDAIDWMTLRL 187

Query: 173 YEQRR 177
              ++
Sbjct: 188 ERNKK 192

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 63/123 (51%), Gaps = 6/123 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           Q  + ++G  + GK++  +    + F      T+G     + +KL +H +     +++D 
Sbjct: 23  QLSIAVVGLQNSGKTTFTNLIAGEEFVVDTIPTLGVNI--KDVKLPNHTN----LKVYDL 76

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           AGQ R++ L    ++  +  + + D++   +  +A++ ++++      E + I ++GNK+
Sbjct: 77  AGQTRFQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNKV 136

Query: 123 DLV 125
           DL+
Sbjct: 137 DLI 139

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 52/121 (42%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVITTKPTIGFNVETLNYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ   +     YY N  A + V D T +D +  A   ++ +  +   +D  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMNIASKELHLMLQEEELQDSALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 53/121 (43%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLSYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ   +     YY +  A + V D T +D ++ A   ++ +  +   +D  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 53/121 (43%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ   +     YY +  A + V D T +D ++ A   ++ +  +   +D  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 57/119 (47%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +LA  +   IKF  +D  G
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 75

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
             + + L   Y+   N  + + D    D   +A+  ++ L +    +D+   ++GNK+D
Sbjct: 76  HVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

>Scas_700.11
          Length = 183

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 8/121 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F   T+   +     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
            GQ   +     YY +  A + V D T +D +  A   ++ +  +   +D  + +  NK 
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASKELHLMLQEEELQDAALLVFANKQ 129

Query: 123 D 123
           D
Sbjct: 130 D 130

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +LA  +   IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
             + + L   Y+   N  + + D    +   +A+  ++ L +    +D+   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

>Scas_680.21
          Length = 183

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62
           + K ++LG  + GKS++V++ + +      E T    F     ++ + +       +WD 
Sbjct: 16  ELKCLILGLDNSGKSTLVNKLLPEEERSQVEITPTIGF-----QIVNFNHGGYTISMWDI 70

Query: 63  AGQERYKSLAPMYYRNANAALVVYDVTQ----EDSLAKAQSWVNELKSKVGDEDLV--IF 116
            GQ   +     Y+    A +   DV+     ++SL +    +N  ++    E L   + 
Sbjct: 71  GGQTTLRPFWDNYFDKMEALVWCVDVSAPSRFQESLRELSQLLNLDRTVESGETLPFKLI 130

Query: 117 LVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDV 164
           +V NK+DLVD +     +DS     + E    +   VSA  G G +++
Sbjct: 131 VVLNKIDLVDWNSVEGQLDS-LLSTHLEGIEYVSLAVSALNGQGTMEL 177

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 81/192 (42%), Gaps = 31/192 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDEFRESTIGAAFLSRTIKLADHDDAMIK 56
           Q+ +++LG  + GK++ +    K+        D+    T+G    +  +   D++ +++K
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKI-APTVGQNVATIPV---DNNRSILK 72

Query: 57  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGD---EDL 113
           F  WD  GQ   +++   YY   +  + V D T    + +       L++ V D   E +
Sbjct: 73  F--WDVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECSE---TLRTIVMDDEIEGI 127

Query: 114 VIFLVGNKLDLVDEDCKPRVIDSEEAQ-------AYAEAHGLMFHEVSAKTGTGILDVFQ 166
            I ++ NK D      KP  ++ ++ +        +  A       V A TG GI D  +
Sbjct: 128 PILMLANKQD------KPERMEVQDIKEIFNRIAEHMSARDSRVLPVCALTGEGIKDSIE 181

Query: 167 GIGGKLYEQRRE 178
            +  +L   + +
Sbjct: 182 WMILRLQRNKND 193

>Scas_706.2*
          Length = 190

 Score = 35.0 bits (79), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +LA  +   IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
             + + L   Y+   N  + + D    +   +A   ++ L      +D+   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKID 135

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 35.4 bits (80), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 23/135 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMI-----KFE 58
            KLVLLG  + GKSS+++    D      E++I ++    T    D  D  I     K  
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSIPGTT---RDSIDVPIDVNGYKVV 298

Query: 59  IWDTAG-------QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDE 111
           + DTAG       Q   + +     +++ + LVV  V   + L       + +KS++ D+
Sbjct: 299 LCDTAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKSQLRDK 358

Query: 112 DLVIFLVGNKLDLVD 126
           +++I  V NK DLVD
Sbjct: 359 NIII--VVNKSDLVD 371

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 34.7 bits (78), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 19/146 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +LA  +   IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLV-GNKLD 123
             + + L   Y+   N  + + D    +   +A+  ++ L  ++ + D V F V GNK+D
Sbjct: 77  HLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDAL-FQIKELDNVPFAVLGNKID 135

Query: 124 LVDEDCKPRVIDSEEAQAYAEAHGLM 149
                  P  +   E +A   A GLM
Sbjct: 136 ------SPSAVSETELRA---ALGLM 152

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 34.7 bits (78), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 53  AMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDED 112
            ++KF  WD  GQE  +++   YY   +  + + D T  + L +    +  + +  G E 
Sbjct: 68  TLLKF--WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQECCDSLRSIVTDDGVEG 125

Query: 113 LVIFLVGNKLDLVDE----DCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGI 161
           + I ++ NK D  D+    D K +V +  +   + EA       +SA TG GI
Sbjct: 126 VPILMLANKQDREDKMELHDIK-QVFN--KLALHLEARDSRVLPISALTGEGI 175

>KLLA0C06358g complement(563583..564482) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein singleton, start by similarity
          Length = 299

 Score = 34.7 bits (78), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 21/143 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGATI--------DVEHSHLRFLGNMTLN 58

Query: 59  IWDTAGQE-----RYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ+      +       ++     + V+DV  +D L     +   LK  K    D
Sbjct: 59  LWDCGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKYSPD 118

Query: 113 LVIFLVGNKLDLVDEDCKPRVID 135
             IF++ +K+DLV  D +  + D
Sbjct: 119 AKIFVLVHKMDLVQLDKRTELFD 141

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 34.7 bits (78), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 86/196 (43%), Gaps = 30/196 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMI-----KFE 58
            KLVLLG  +VGKSS+V+    D        +I +     T    D  DAMI     K  
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTNDDI------SIVSDIPGTT---RDSIDAMINVNGYKVI 325

Query: 59  IWDTAG-QERYKSLAPMY------YRNANAALVVYDVTQEDSLAK--AQSWVNELKSKV- 108
           I DTAG +E+      M        ++  + L ++ V   D L+K   +  +  L SK  
Sbjct: 326 ICDTAGIREKSSDKIEMLGIDRAKKKSVQSDLCLFIVDPTD-LSKLLPEDILAHLSSKTF 384

Query: 109 GDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGI 168
           G++ ++I  V NK DLV +D   +V++  + +  ++   L    VS KT  GI  +   +
Sbjct: 385 GNKRIII--VVNKSDLVSDDEMTKVLNKLQTRLGSKYPIL---SVSCKTKEGIESLISTL 439

Query: 169 GGKLYEQRRESLAAQP 184
                   + S  A P
Sbjct: 440 TSNFESLSQSSADASP 455

>Kwal_33.14296
          Length = 299

 Score = 33.9 bits (76), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 23/158 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGATI--------DVEHSHLRFLGNMTLN 58

Query: 59  IWDTAGQ----ERYKSLAPMY-YRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ    E Y S    + ++     + V+DV  ++ +   + +   LK  K    D
Sbjct: 59  LWDCGGQDVFMENYFSQQKDHIFQMVQVLIHVFDVESQEVIKDIEIFTKALKQLKKYSPD 118

Query: 113 LVIFLVGNKLDLVDEDCKPRV--IDSEEAQAYAEAHGL 148
             IF++ +K+DLV  D +  +  I   + Q  + A+G 
Sbjct: 119 AKIFVLLHKMDLVQRDKRQELFQIMMSKLQETSSAYGF 156

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 57  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDE----D 112
           ++I D +GQE ++ L   Y+   N   +VY V   DS  + Q  +NEL+++  +     D
Sbjct: 70  WKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDS-DRLQESINELQARYVNTPAAVD 128

Query: 113 LVIFLVGNKLD 123
           + I +V NK D
Sbjct: 129 IPIAVVLNKTD 139

>Sklu_2335.9 YML121W, Contig c2335 18260-19255 reverse complement
          Length = 331

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 29/161 (18%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 40  KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGATI--------DVEHSHLRFLGNMTLN 90

Query: 59  IWDTAGQERYKSLAPMYYRN--------ANAALVVYDVTQEDSLAKAQSWVNELKS-KVG 109
           +WD  GQ+ +      Y+ N            + V+DV  ++ +   + +   LK  K  
Sbjct: 91  LWDCGGQDVF---MENYFTNQKDHIFQMVQVLIHVFDVESQEVIKDIEIFTRALKQLKKY 147

Query: 110 DEDLVIFLVGNKLDLVDEDCKPRV--IDSEEAQAYAEAHGL 148
             D  IF++ +K+DLV  D +  +  I   + Q  + A+G 
Sbjct: 148 SPDAKIFVLLHKMDLVQLDKRQELFEIMMSKLQETSAAYGF 188

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +LA      IKF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELA---IGSIKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLD 123
             + + L   Y+   N  + + D    +   +A+  ++ L      + +   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

>Scas_721.90
          Length = 397

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLS-----------RTIKLADH 50
          +QF L+LLG++ +GK++ ++       +   ++ +    LS           RTIKL + 
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNIETTTHVIKRTIKLKEK 86

Query: 51 DDA 53
          D A
Sbjct: 87 DGA 89

>Kwal_47.17857
          Length = 198

 Score = 31.6 bits (70), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 18/133 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFV---KDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEI 59
           + + ++LG  + GKS++V   +   K    +    T+G  F   TI   +H+      ++
Sbjct: 16  EIRCLVLGLDNSGKSTVVDWILSVYKKRPRQLITPTVG--FQIHTIPFQNHN-----VQL 68

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV----- 114
           WD  GQ   +     Y+   +  + V D      L ++   + ELK  + + D +     
Sbjct: 69  WDIGGQSTLRPYWDNYFDKTDVLMWVIDAAAAQRLEES---IGELKVILQNRDRLGYGCK 125

Query: 115 IFLVGNKLDLVDE 127
           I ++ NK DL+ +
Sbjct: 126 IVVLLNKTDLIPD 138

>Scas_698.27
          Length = 701

 Score = 32.0 bits (71), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 29/150 (19%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDS----FDEFR-------ESTIGAAFL----------S 42
              V+LG+ S GKS+I+ R ++DS     DE R       +S + A  L          S
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 43  RTIKLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQ---EDSLAKAQS 99
            T  L   D  + +F  +D  G  ++ S +    R    A++  D      E +     +
Sbjct: 331 STFSL---DKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTIDCNTDAFESAFNMGSA 387

Query: 100 WVNELK-SKVGDEDLVIFLVGNKLDLVDED 128
            +  +   K  + D +I ++ NK+D +D D
Sbjct: 388 TIQHIYLCKQANIDNIIIMM-NKMDTIDWD 416

>KLLA0F07931g 744157..745629 weakly similar to sgd|S0005391
           Saccharomyces cerevisiae YOL031c, hypothetical start
          Length = 490

 Score = 32.0 bits (71), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 14/103 (13%)

Query: 12  SSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIK-FEIWDTAGQERYKS 70
           +S G   ++ RF+          +I    LSRT  ++  DD + + ++I D + + +   
Sbjct: 307 ASQGSKLLIKRFL----------SILDVLLSRTEYVSIKDDVLWRLYQIEDPSSKIKILE 356

Query: 71  LAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDL 113
           +   +Y   N  ++  D  Q+D +   Q WVNEL + +   +L
Sbjct: 357 IIAKFYNEKNEQVI--DTVQQD-MKTVQKWVNELTTIIQTPEL 396

>Kwal_26.6810
          Length = 664

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF-----DEFRESTIGAAFLSRTIKLADHDDAMIKF 57
          Q K+V+ GD  VGK+S++   +KD F     D     TI   F S  +        ++  
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPV--CPKKSVLVDT 62

Query: 58 EIWDTAGQER 67
            +D  G +R
Sbjct: 63 TSYDLPGLQR 72

>CAGL0M07546g 756457..757920 similar to sp|P32559 Saccharomyces
           cerevisiae YMR023c MSS1 mitochondrial GTPase involved in
           expression of COX1, hypothetical start
          Length = 487

 Score = 31.6 bits (70), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 79/181 (43%), Gaps = 27/181 (14%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
             + LLG  +VGKSS++++   D      +        +R I  +  +    K  ++DTA
Sbjct: 239 INMTLLGAPNVGKSSLLNQIASDDISIVSD----IPGTTRDIVSSIVNINGYKVNLFDTA 294

Query: 64  GQERYKSLAPM--------YYR--NANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDL 113
           G  R  +  P+        + R  +++  + V D TQ   L    + ++ LKS       
Sbjct: 295 GI-RVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPL----NVLDLLKSSDLSGSE 349

Query: 114 VIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAH--GLMFHEVSAKTGTGILDVFQGIGGK 171
           +IF+V NK+D+VD+ CK   I     Q Y   +  G     VS    TGI ++   + GK
Sbjct: 350 IIFVV-NKIDIVDDSCKLSKI-----QQYIGNNLTGCKICFVSCLKSTGIDELVTVLTGK 403

Query: 172 L 172
            
Sbjct: 404 F 404

>AFR446W [3638] [Homologous to ScYML121W (GTR1) - SH]
           complement(1240754..1241653) [900 bp, 299 aa]
          Length = 299

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 21/136 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 8   KLLLMGRSGAGKSSM-RSIIFSNYSAFDTRRLGATI--------DVEHSHLRFLGNMTLN 58

Query: 59  IWDTAGQE-----RYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ+      +       ++     + V+DV  ++ +   + +   LK  K    D
Sbjct: 59  LWDCGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESQEVIRDIEIFTRALKHLKRYSPD 118

Query: 113 LVIFLVGNKLDLVDED 128
             IF++ +K+DLV  D
Sbjct: 119 AKIFVLLHKMDLVQLD 134

>KLLA0E23958g complement(2124622..2130870) some similarities with
            sp|P48415 Saccharomyces cerevisiae YPL085w SEC16
            multidomain vesicle coat protein singleton, hypothetical
            start
          Length = 2082

 Score = 31.6 bits (70), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 14/84 (16%)

Query: 109  GDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQ-- 166
            G EDL ++  G+   L  ED KP+ IDS   Q           E+  KT +  L+ F   
Sbjct: 1740 GPEDLAMYAYGS-YKLSGEDAKPQTIDSPNGQK---------QEIENKTSSPPLNSFVPS 1789

Query: 167  --GIGGKLYEQRRESLAAQPQHSS 188
              G+G  L   +   L A  Q+ S
Sbjct: 1790 NIGLGENLISVKSIGLPAHLQNDS 1813

>ADR402W [2142] [Homologous to ScYAL048C - SH]
           complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 31.6 bits (70), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADH---DDAMIKFEI 59
           + ++V+ GD  VGKSS++   VKD F    +  + A  + R    + +   +  ++  + 
Sbjct: 5   RIRIVVCGDKGVGKSSLIACLVKDQFIPNLQDALPAVTIPRDFSASPYSPQNTILVDTKN 64

Query: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAK-AQSWVNELKSKVGDEDLVIFLV 118
            D AG ++         +NA+   +VY     DS  + A  W+   +S +G  +L + L 
Sbjct: 65  SDLAGLQK-------ELKNADVIWLVY--ADHDSYERIALYWMMMFRS-LG-LNLPVILC 113

Query: 119 GNKLDLVDEDCK 130
            NK D   E C+
Sbjct: 114 RNKSDDGIEYCR 125

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score = 30.8 bits (68), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/130 (20%), Positives = 54/130 (41%), Gaps = 25/130 (19%)

Query: 5   KLVLLGDSSVGKSSIV-----HRFVKDSFD----EFRESTIGAAFLSRTIKLADHDDAMI 55
           ++ ++G  + GK+++      H F  D+      + R +TIG   L              
Sbjct: 70  QIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLL-------------- 115

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI 115
             +++D AGQ R++ L        +  + V D++ + +   A+  +  +          +
Sbjct: 116 --QVYDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTPV 173

Query: 116 FLVGNKLDLV 125
            ++GNK DLV
Sbjct: 174 LIIGNKADLV 183

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
          Saccharomyces cerevisiae YAL048c vacuolar aspartic
          proteasse singleton, start by similarity
          Length = 659

 Score = 30.4 bits (67), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          + ++V+ GDS VGK+S++   VKD F
Sbjct: 5  RIRIVVCGDSGVGKTSLIACLVKDQF 30

>Scas_692.9
          Length = 309

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 21/136 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 14  KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGATI--------DVEHSHLRFLGNMTLN 64

Query: 59  IWDTAGQE-----RYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ+      +       ++     + V+DV   D +   + +   LK  K    +
Sbjct: 65  LWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTDVIKDIEIFTRALKQLKKYSPE 124

Query: 113 LVIFLVGNKLDLVDED 128
             IF++ +K+DLV  D
Sbjct: 125 AKIFVLLHKMDLVQLD 140

>Kwal_56.24149
          Length = 149

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%)

Query: 55  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLV 114
           IKF  +D  G  + + L   Y+   N  + + D    + L +A+  ++ L +    +D+ 
Sbjct: 26  IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFNIAELKDVP 85

Query: 115 IFLVGNKLD 123
             ++GNK+D
Sbjct: 86  FVILGNKID 94

>KLLA0F18370g 1692172..1692711 no similarity, hypothetical start
          Length = 179

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 11/67 (16%)

Query: 70  SLAPMYYR-----NANAALVVYDVTQEDSLAKAQSWVNELKSKV-----GDEDLV-IFLV 118
           S+ P+ YR     N+  + ++Y  TQE++++ +QS+V   K++       D +L  + L 
Sbjct: 19  SVKPVLYRSTVRNNSWWSKIIYPFTQEENISPSQSYVKTGKNQCFLPIRNDNELNDVLLF 78

Query: 119 GNKLDLV 125
            N+L L+
Sbjct: 79  NNRLPLI 85

>YDL006W (PTC1) [851] chr4 (439906..440751) Protein serine/threonine
           phosphatase of the PP2C family, involved in the
           dephosphorylation of multiple MAP kinases and involved
           in tRNA splicing [846 bp, 281 aa]
          Length = 281

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 11/106 (10%)

Query: 87  DVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAH 146
           D   +DS+  AQ       + VGD  +V+F  GN + L  +    +  D+ E Q   +A 
Sbjct: 127 DSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYD---HKASDTLEMQRVEQAG 183

Query: 147 GLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESLAAQPQHSSSIQL 192
           GL+          G+L V + +G K +    +SL      ++S+++
Sbjct: 184 GLIM----KSRVNGMLAVTRSLGDKFF----DSLVVGSPFTTSVEI 221

>YML121W (GTR1) [3850] chr13 (26930..27862) GTP-binding protein
           involved in the function of the Pho84p phosphate
           transporter [933 bp, 310 aa]
          Length = 310

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 21/136 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +GA          D + + ++F       
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGAT--------IDVEHSHLRFLGNMTLN 58

Query: 59  IWDTAGQE-----RYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ+      +       ++     + V+DV   + L   + +   LK  +    D
Sbjct: 59  LWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPD 118

Query: 113 LVIFLVGNKLDLVDED 128
             IF++ +K+DLV  D
Sbjct: 119 AKIFVLLHKMDLVQLD 134

>Kwal_27.12508
          Length = 874

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 17 SSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDD 52
          S I + FVKDS ++ R+ T    F+  TI LAD + 
Sbjct: 44 SEITYVFVKDSNNKVRQITSQFPFVKNTIFLADKES 79

>Scas_631.9
          Length = 1521

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 19/76 (25%)

Query: 85  VYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAE 144
            YD  + + + K +S +NE++  +G +   I           EDC        E   + E
Sbjct: 716 TYDTKECNGIGKVKSLLNEIREDIGSKTKDI-----------EDC--------EMHVHHE 756

Query: 145 AHGLMFHEVSAKTGTG 160
              + FH    K+G G
Sbjct: 757 GQYITFHRTDVKSGAG 772

>CAGL0B02453g complement(234125..235075) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein, hypothetical start
          Length = 316

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 21/136 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKF------E 58
           KL+L+G S  GKSS+    +  ++  F    +G           D + + ++F       
Sbjct: 9   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGVTM--------DVEHSHLRFLGNMTLN 59

Query: 59  IWDTAGQ----ERYKSLAPMY-YRNANAALVVYDVTQEDSLAKAQSWVNELKS-KVGDED 112
           +WD  GQ    E Y S    + ++     + V+DV  ++ +   + +   L+  +    D
Sbjct: 60  LWDCGGQDVFMENYFSKQKDHIFQMVQVLIHVFDVESQEVMKDIEIFTRALRQLRKYSPD 119

Query: 113 LVIFLVGNKLDLVDED 128
             IF++ +K+DLV  D
Sbjct: 120 AKIFVLLHKMDLVQLD 135

>KLLA0D14663g 1238190..1239416 similar to sp|Q06103 Saccharomyces
           cerevisiae YPR108w RPN7 subunit of the regulatory
           particle of the proteasome singleton, start by
           similarity
          Length = 408

 Score = 28.1 bits (61), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 2/24 (8%)

Query: 91  EDSLAKAQSWVN--ELKSKVGDED 112
           E  L KAQSW+N  E  +K+GD+D
Sbjct: 103 EGELEKAQSWINLGEYYAKIGDKD 126

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 7/122 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63
           F   ++G    GKSS++  F+  SF E    TI       +++L       +   I    
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQYYL---ILQEL 505

Query: 64  GQERYKSLAPM-YYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122
           G++ Y  L      +  +   + YD +  +S +   S +++       +DL +  V +K 
Sbjct: 506 GEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL---QDLPLVFVASKA 562

Query: 123 DL 124
           DL
Sbjct: 563 DL 564

>CAGL0F06677g complement(656199..657539) highly similar to sp|P08539
           Saccharomyces cerevisiae YHR005c GPA1, start by
           similarity
          Length = 446

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 49/127 (38%), Gaps = 14/127 (11%)

Query: 20  VHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNA 79
           V RF ++++    E  +     +  I     +    KF+++D  GQ   +      +   
Sbjct: 252 VERFSENNYVCTDEDILKGRIKTTGITETQFNIESTKFKVYDAGGQRSERKKWIHCFEGI 311

Query: 80  NAALVVYDVTQEDSLAKAQSWVNELKSKV------------GDEDLVIFLVGNKLDLVDE 127
            A L V  +++ D +    S VN +   +             D   ++FL  NK+DL +E
Sbjct: 312 TAVLFVLALSEYDQMLFEDSTVNRMHESIMLFEKLINSRWFKDTPFILFL--NKVDLFEE 369

Query: 128 DCKPRVI 134
             K   I
Sbjct: 370 KVKREPI 376

>Scas_603.7
          Length = 203

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 101 VNELKSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAE 144
           V+EL  KV DE+ + F    KLD + E  KP+ +  E+    AE
Sbjct: 153 VDELMGKVADENGLEFKQSAKLDNLPEIEKPQAVSEEKEDKLAE 196

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,354,547
Number of extensions: 256277
Number of successful extensions: 1246
Number of sequences better than 10.0: 222
Number of HSP's gapped: 1001
Number of HSP's successfully gapped: 223
Length of query: 201
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 104
Effective length of database: 13,238,163
Effective search space: 1376768952
Effective search space used: 1376768952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)