Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL175W88386742200.0
KLLA0D10197g85687319780.0
Scas_626.683986219030.0
Sklu_2397.884865717690.0
Kwal_27.968884167016380.0
YML099C (ARG81)88066914160.0
CAGL0H06875g7024787965e-94
YBR240C (THI2)450561481e-09
AFL033W382561453e-09
Scas_597.4475591444e-09
Kwal_14.1631443521435e-09
KLLA0F10373g348441353e-08
CAGL0F05357g601501349e-08
YLR228C (ECM22)8141001276e-07
AGL099C747581222e-06
KLLA0F20680g787591222e-06
Scas_573.41478571223e-06
Scas_596.4701561213e-06
YDR213W (UPC2)913561205e-06
Scas_679.26775951187e-06
AGL091W866481179e-06
Sklu_1373.2608481161e-05
KLLA0F22990g1253551162e-05
CAGL0C01199g922431152e-05
YDR207C (UME6)836331152e-05
Scas_717.33904671152e-05
CAGL0F07865g844481142e-05
Kwal_23.3122788481133e-05
Kwal_23.3178611341123e-05
Kwal_56.24566755571115e-05
Scas_721.94869701106e-05
KLLA0A10329g639681097e-05
KLLA0D00484g1004761099e-05
YLR256W (HAP1)1502401081e-04
Kwal_26.6732676361071e-04
KLLA0A04169g775431072e-04
CAGL0B03421g1355521072e-04
CAGL0J07150g1022501062e-04
CAGL0K11902g831711052e-04
Sklu_2434.10983541053e-04
ADR405C807621053e-04
YLR014C (PPR1)904381053e-04
Kwal_23.2905881641043e-04
KLLA0F14322g717401034e-04
KLLA0C17050g955391034e-04
YMR280C (CAT8)1433771044e-04
YDR421W (ARO80)950551035e-04
ABL099W800501035e-04
Kwal_23.6529598611025e-04
Scas_663.12944521025e-04
ACL058W817571017e-04
Kwal_26.6805944331017e-04
Kwal_26.7095838381018e-04
YDR034C (LYS14)7901101018e-04
CAGL0M12298g994501018e-04
CAGL0E05434g816541009e-04
KLLA0A06039g657371000.001
KLLA0A03443g975591000.001
Scas_702.71113511000.001
Kwal_55.20722827401000.001
YGL013C (PDR1)1068561000.001
KLLA0A09119g108265990.001
KLLA0F00572g59735990.001
KLLA0C16489g72830990.001
AFR117C115236990.001
Scas_556.6102249980.002
ADR404C87534980.002
Kwal_56.2305877551980.002
Scas_674.12*90928980.002
KLLA0A01804g94576980.002
AFR096W85233970.002
KLLA0F04213g76850970.002
Sklu_2064.292234970.002
KLLA0F02387g72779970.002
Kwal_34.1575162828970.002
Scas_521.289058970.002
YAL051W (OAF1)106263970.002
KLLA0F18084g86029970.003
Sklu_1622.277835960.003
Sklu_2296.691939960.003
YJL089W (SIP4)82949960.003
Sklu_2191.271841960.003
Scas_711.3193257960.003
KLLA0C10923g77558950.004
CAGL0K05841g137233950.004
CAGL0D03850g83441950.004
ADR403C97034950.004
ADR199C94450950.004
Sklu_2321.390652940.005
AFR171W61282940.005
CAGL0M03025g125458940.005
KLLA0E19701g68142940.005
YLR278C134154940.006
KLLA0D05038g67339930.006
Kwal_56.2467064335930.006
AGR369W105158930.006
KLLA0D10153g65545920.007
KLLA0D12650g65172920.008
Scas_630.1470155920.009
Kwal_47.1768185452920.009
KLLA0F09559g65853920.009
CAGL0D02904g88734920.009
Scas_590.2117274920.009
Kwal_14.2619116738920.009
YCR106W (RDS1)83286920.010
Kwal_23.642573535910.010
AGL206C73550910.011
KLLA0F22880g116443910.011
Kwal_47.1723394879910.011
AGR061C61237910.011
CAGL0F03025g92850910.013
Scas_720.5889029900.013
CAGL0L04400g98743900.014
Scas_588.1183552900.015
KLLA0D01452g144536900.017
YOR363C (PIP2)99644900.017
AAL057C80948890.017
KLLA0A03421g88043890.018
Scas_550.5*83249890.018
Scas_625.5114178890.019
YBR297W (MAL33)46843870.025
Kwal_55.2067425242860.026
Sklu_2301.151738870.027
KLLA0F10835g75643870.030
Sklu_2376.692236870.031
KLLA0D11286g67838870.031
YKL222C70547870.032
KLLA0F19602g60335870.035
YBL066C (SEF1)105736870.037
CAGL0I07755g105342870.037
AGL233C87243870.038
Scas_526.3110954870.040
YPL248C (GAL4)88129860.041
KLLA0E20405g113845860.047
YMR019W (STB4)94964850.056
KLLA0C04620g126938850.057
Scas_709.5175938850.060
Sklu_2411.1168757850.062
Kwal_27.10852104656850.068
Scas_699.793539840.072
Sklu_1973.177745840.074
Scas_638.14104358840.079
Scas_542.890247840.079
Scas_661.2374170840.082
YDR303C (RSC3)88545840.083
Scas_449.163667830.084
YHR056C (RSC30)88340840.086
Scas_696.44116441830.093
YDL170W (UGA3)52829830.096
YLR266C (PDR8)70138830.10
YGR288W (MAL13)47329820.10
YPR196W47054820.11
YLL054C76963820.12
YOR337W (TEA1)75952820.12
KLLA0F13904g57949820.13
ABL121C128564820.13
YOR172W (YRM1)78632820.14
ACR028C60138820.14
CAGL0H01507g79445810.15
Scas_659.1075730810.16
KLLA0C14212g104046810.16
Scas_688.1776938810.17
CAGL0G09757g142329810.17
ADR365W70160810.18
Kwal_27.10232120941810.18
CAGL0L03377g120975810.18
Scas_715.3111536810.19
ACR241C79534800.24
YDR520C77262800.24
YOR162C (YRR1)81040800.25
KLLA0F25630g100778790.28
CAGL0A04455g109836790.28
Sklu_2384.683149790.29
KLLA0E14036g67842790.33
CAGL0A00451g110741790.33
Kwal_23.653755243780.36
KLLA0A01298g18445750.36
Sklu_2268.287537780.37
AER183C87974780.38
YOR380W (RDR1)54654770.45
KLLA0D09977g63433770.46
Kwal_47.1750692440770.47
AGR280C110628770.49
KLLA0D12672g86529770.52
YKL015W (PUT3)97938770.53
CAGL0F02519g83229770.58
YJL103C61839760.59
KLLA0E18194g86529760.61
KLLA0D15356g62448760.64
YKL038W (RGT1)117084760.64
Scas_657.385623760.70
KLLA0C19228g59129750.77
YBL005W (PDR3)97638750.87
Kwal_26.810997039750.88
ACL096W83538750.90
AFL160C64868750.96
YHR178W (STB5)74338750.97
KLLA0B04840g77129751.0
Kwal_23.351457931741.1
KLLA0C01023g63650741.1
Kwal_26.744871432741.2
Scas_637.799844741.3
CAGL0L04576g86521741.3
Kwal_8.58063876731.4
Kwal_14.81956832731.5
CAGL0H00396g94032731.6
Scas_669.863734721.8
KLLA0E02618g110945722.0
YJL206C75848722.1
KLLA0F04609g91639722.2
AGL361C69639722.2
Scas_680.2573829712.3
YBR123C (TFC1)64953712.4
Scas_234.133732702.6
AFR081C48236702.7
Kwal_33.1393479741712.9
Kwal_33.15184953165703.3
YNR063W60722703.4
Sklu_2023.365829694.0
Kwal_47.1808974527685.4
Sklu_2082.18247626.0
AER291C66354686.2
YLR152C576105686.4
Sklu_2335.694039686.5
YFL052W46534677.2
KLLA0D00396g36151669.4
Scas_703.460952669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL175W
         (867 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...  1630   0.0  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   766   0.0  
Scas_626.6                                                            737   0.0  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                          686   0.0  
Kwal_27.9688                                                          635   0.0  
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   550   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   311   5e-94
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    62   1e-09
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    60   3e-09
Scas_597.4                                                             60   4e-09
Kwal_14.1631                                                           60   5e-09
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    57   3e-08
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    56   9e-08
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    54   6e-07
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    52   2e-06
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    52   2e-06
Scas_573.4                                                             52   3e-06
Scas_596.4                                                             51   3e-06
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    51   5e-06
Scas_679.26                                                            50   7e-06
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    50   9e-06
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            49   1e-05
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    49   2e-05
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    49   2e-05
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    49   2e-05
Scas_717.33                                                            49   2e-05
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    49   2e-05
Kwal_23.3122                                                           48   3e-05
Kwal_23.3178                                                           48   3e-05
Kwal_56.24566                                                          47   5e-05
Scas_721.94                                                            47   6e-05
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    47   7e-05
KLLA0D00484g 44879..47893 no similarity, hypothetical start            47   9e-05
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    46   1e-04
Kwal_26.6732                                                           46   1e-04
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    46   2e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    46   2e-04
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    45   2e-04
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    45   2e-04
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         45   3e-04
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    45   3e-04
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    45   3e-04
Kwal_23.2905                                                           45   3e-04
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    44   4e-04
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    44   4e-04
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    45   4e-04
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    44   5e-04
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    44   5e-04
Kwal_23.6529                                                           44   5e-04
Scas_663.12                                                            44   5e-04
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    44   7e-04
Kwal_26.6805                                                           44   7e-04
Kwal_26.7095                                                           44   8e-04
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    44   8e-04
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    44   8e-04
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    43   9e-04
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    43   0.001
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    43   0.001
Scas_702.7                                                             43   0.001
Kwal_55.20722                                                          43   0.001
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    43   0.001
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    43   0.001
KLLA0F00572g complement(42710..44503) some similarities with ca|...    43   0.001
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    43   0.001
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    43   0.001
Scas_556.6                                                             42   0.002
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    42   0.002
Kwal_56.23058                                                          42   0.002
Scas_674.12*                                                           42   0.002
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    42   0.002
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    42   0.002
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    42   0.002
Sklu_2064.2 , Contig c2064 873-3641                                    42   0.002
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    42   0.002
Kwal_34.15751                                                          42   0.002
Scas_521.2                                                             42   0.002
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    42   0.002
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    42   0.003
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            42   0.003
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       42   0.003
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    42   0.003
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         42   0.003
Scas_711.31                                                            42   0.003
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    41   0.004
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    41   0.004
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    41   0.004
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    41   0.004
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    41   0.004
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           41   0.005
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    41   0.005
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    41   0.005
KLLA0E19701g complement(1739869..1741914) some similarities with...    41   0.005
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    41   0.006
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    40   0.006
Kwal_56.24670                                                          40   0.006
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    40   0.006
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    40   0.007
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    40   0.008
Scas_630.14                                                            40   0.009
Kwal_47.17681                                                          40   0.009
KLLA0F09559g complement(876719..878695) some similarities with s...    40   0.009
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    40   0.009
Scas_590.2                                                             40   0.009
Kwal_14.2619                                                           40   0.009
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    40   0.010
Kwal_23.6425                                                           40   0.010
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    40   0.011
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    40   0.011
Kwal_47.17233                                                          40   0.011
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    40   0.011
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    40   0.013
Scas_720.58                                                            39   0.013
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    39   0.014
Scas_588.11                                                            39   0.015
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    39   0.017
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    39   0.017
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    39   0.017
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    39   0.018
Scas_550.5*                                                            39   0.018
Scas_625.5                                                             39   0.019
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    38   0.025
Kwal_55.20674                                                          38   0.026
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                38   0.027
KLLA0F10835g 997512..999782 no similarity, hypothetical start          38   0.030
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              38   0.031
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    38   0.031
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    38   0.032
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    38   0.035
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    38   0.037
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    38   0.037
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    38   0.038
Scas_526.3                                                             38   0.040
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    38   0.041
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    38   0.047
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    37   0.056
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    37   0.057
Scas_709.51                                                            37   0.060
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      37   0.062
Kwal_27.10852                                                          37   0.068
Scas_699.7                                                             37   0.072
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          37   0.074
Scas_638.14                                                            37   0.079
Scas_542.8                                                             37   0.079
Scas_661.23                                                            37   0.082
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    37   0.083
Scas_449.1                                                             37   0.084
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    37   0.086
Scas_696.44                                                            37   0.093
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    37   0.096
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    37   0.10 
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    36   0.10 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    36   0.11 
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    36   0.12 
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    36   0.12 
KLLA0F13904g complement(1287758..1289497) some similarities with...    36   0.13 
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    36   0.13 
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    36   0.14 
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    36   0.14 
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    36   0.15 
Scas_659.10                                                            36   0.16 
KLLA0C14212g complement(1229219..1232341) some similarities with...    36   0.16 
Scas_688.17                                                            36   0.17 
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    36   0.17 
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    36   0.18 
Kwal_27.10232                                                          36   0.18 
CAGL0L03377g complement(382932..386561) some similarities with s...    36   0.18 
Scas_715.3                                                             36   0.19 
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    35   0.24 
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    35   0.24 
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    35   0.25 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    35   0.28 
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    35   0.28 
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          35   0.29 
KLLA0E14036g complement(1239566..1241602) some similarities with...    35   0.33 
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    35   0.33 
Kwal_23.6537                                                           35   0.36 
KLLA0A01298g complement(117215..117769) highly similar to sp|P40...    33   0.36 
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         35   0.37 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    35   0.38 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    34   0.45 
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    34   0.46 
Kwal_47.17506                                                          34   0.47 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    34   0.49 
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    34   0.52 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    34   0.53 
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    34   0.58 
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    34   0.59 
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    34   0.61 
KLLA0D15356g 1301848..1303722 no similarity, hypothetical start        34   0.64 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    34   0.64 
Scas_657.3                                                             34   0.70 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    33   0.77 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    33   0.87 
Kwal_26.8109                                                           33   0.88 
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    33   0.90 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    33   0.96 
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    33   0.97 
KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029 ...    33   1.0  
Kwal_23.3514                                                           33   1.1  
KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces ...    33   1.1  
Kwal_26.7448                                                           33   1.2  
Scas_637.7                                                             33   1.3  
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    33   1.3  
Kwal_8.580                                                             33   1.4  
Kwal_14.819                                                            33   1.5  
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    33   1.6  
Scas_669.8                                                             32   1.8  
KLLA0E02618g 244696..248025 no similarity, hypothetical start          32   2.0  
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    32   2.1  
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    32   2.2  
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    32   2.2  
Scas_680.25                                                            32   2.3  
YBR123C (TFC1) [311] chr2 complement(484698..486647) RNA polymer...    32   2.4  
Scas_234.1                                                             32   2.6  
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    32   2.7  
Kwal_33.13934                                                          32   2.9  
Kwal_33.15184                                                          32   3.3  
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    32   3.4  
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         31   4.0  
Kwal_47.18089                                                          31   5.4  
Sklu_2082.1 YER184C, Contig c2082 2025-2273                            28   6.0  
AER291C [2793] [Homologous to ScYHR178W (STB5) - SH] (1172383..1...    31   6.2  
YLR152C (YLR152C) [3561] chr12 complement(442959..444689) Member...    31   6.4  
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          31   6.5  
YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong...    30   7.2  
KLLA0D00396g complement(36277..37362) some similarities with ca|...    30   9.4  
Scas_703.4                                                             30   9.6  

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score = 1630 bits (4220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/867 (91%), Positives = 789/867 (91%)

Query: 1   MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS 60
           MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS
Sbjct: 1   MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS 60

Query: 61  CQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGEQPAQPFQRRNIMFVRXX 120
           CQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGEQPAQPFQRRNIMFVR  
Sbjct: 61  CQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGEQPAQPFQRRNIMFVRYD 120

Query: 121 XXXXXXXXXXXXLSALHSPPLEMIADHKTWIIKRFGVFKGTDXXXXXXXXXXXXXXXXXF 180
                       LSALHSPPLEMIADHKTWIIKRFGVFKGTD                 F
Sbjct: 121 EEYEYYEDMDDELSALHSPPLEMIADHKTWIIKRFGVFKGTDRVKRKYVPRKRRKVNPVF 180

Query: 181 ADAMAXXXXXXXXXXXXXXXXXXXXXLQGSLGSGNXXXXXXXXXXXXXXESAGAMSPVSA 240
           ADAMA                     LQGSLGSGN              ESAGAMSPVSA
Sbjct: 181 ADAMAREHRRKLEEREKQARRKRKGELQGSLGSGNATGAGFAKAGPPAAESAGAMSPVSA 240

Query: 241 TPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTLSFPTGLSVAQHGDGITADTAPP 300
           TPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTLSFPTGLSVAQHGDGITADTAPP
Sbjct: 241 TPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTLSFPTGLSVAQHGDGITADTAPP 300

Query: 301 KSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRLLLNNQGTDCNSSTGYKGLSGVHTPYT 360
           KSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRLLLNNQGTDCNSSTGYKGLSGVHTPYT
Sbjct: 301 KSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRLLLNNQGTDCNSSTGYKGLSGVHTPYT 360

Query: 361 VDNVAIHGPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSY 420
           VDNVAIHGPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSY
Sbjct: 361 VDNVAIHGPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSY 420

Query: 421 YQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQ 480
           YQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQ
Sbjct: 421 YQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQ 480

Query: 481 SKFPKNSKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGT 540
           SKFPKNSKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGT
Sbjct: 481 SKFPKNSKEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGT 540

Query: 541 MSDCQYHLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKD 600
           MSDCQYHLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKD
Sbjct: 541 MSDCQYHLTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKD 600

Query: 601 AGDKEFQKNGXXXXXXXXXXXXFTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFN 660
           AGDKEFQKNG            FTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFN
Sbjct: 601 AGDKEFQKNGSSTPPLSTDSSSFTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFN 660

Query: 661 TIVTKSYPHEINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFG 720
           TIVTKSYPHEINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFG
Sbjct: 661 TIVTKSYPHEINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFG 720

Query: 721 LFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLED 780
           LFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLED
Sbjct: 721 LFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLED 780

Query: 781 HTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVN 840
           HTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVN
Sbjct: 781 HTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVN 840

Query: 841 FGIGSYWGARQIMLEVWRRRMTDGKCD 867
           FGIGSYWGARQIMLEVWRRRMTDGKCD
Sbjct: 841 FGIGSYWGARQIMLEVWRRRMTDGKCD 867

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/873 (47%), Positives = 535/873 (61%), Gaps = 77/873 (8%)

Query: 35  RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMA 94
           +PR KTFTGCWTCR RKVKCDL +P C+RCEK GL CGGYD+KLRW+ PI+FD  GN  A
Sbjct: 5   KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGNVTA 64

Query: 95  GEDRDGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMIADHKTWIIKR 154
                 D ++P   +QRRN+ FVR              LSAL SPPLE+I++ KTWIIK+
Sbjct: 65  TPTGIKDPDEPQ--YQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWIIKK 122

Query: 155 FGVFKGTDXXXXXXXXXXXXXXXXXFADAMAXXXXXXXXXXXXXXXXXXXXXLQGSLGSG 214
           FGVFKGTD                 F +A+                         +L + 
Sbjct: 123 FGVFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLANKKNKVKTADSDSKEGTNLCT- 181

Query: 215 NXXXXXXXXXXXXXXESAGA----MSPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTLS 270
                          ES+ A     S      LF+FD ++     +EW++ EL+DD  LS
Sbjct: 182 -----------PEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWISNELRDDALLS 230

Query: 271 -SAMLRNTLSFPTGLSVAQHGDGITADTAPPKSQSSIFPEQTLPLQSAG----------- 318
            SA+   T+ F   + + Q+    T DT          P+  L + + G           
Sbjct: 231 ASAVQGETIPF---MGIRQNN---TPDT----------PQTPLTVDNMGKKNGSVNGNCN 274

Query: 319 ---TMVPPSVDEVSKVYRLLLNNQGTDCNSS--TGYKGLSGVHTPYTV------DNVAIH 367
              T    + DE+++VYRLL + +G+       T        H   T+      + V ++
Sbjct: 275 DGRTSGNDNEDELARVYRLLFHRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELN 334

Query: 368 GPESRMPASAIESVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVAD 427
            P S MP SAIE + S VPDP+IF    +TN L+ +P  G+ +HGL RFLL+YY QNVAD
Sbjct: 335 VPGSTMPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNVAD 394

Query: 428 LMSVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNS 487
           LM+VV LP N WKTIYFPRA+KALG+L  +GYTS+SRN+LLNALLAVSCF+LQSKFPKNS
Sbjct: 395 LMTVVVLPTNSWKTIYFPRALKALGDLTGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNS 454

Query: 488 KEMKYFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYH 547
            EMK+F++LG++FR QAS FL  CLS+T  QE YKD+LTAILSMNSIDVVWGTM+DCQ H
Sbjct: 455 PEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTMADCQVH 514

Query: 548 LTICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQ 607
           L ICE+F+E+RMK+RP +S KA+ LHRIFSFLKLIQDST+LDKV+ KEI++ D       
Sbjct: 515 LAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVILD------- 567

Query: 608 KNGXXXXXXXXXXXXFTGRYVEQLNKDNGRVCIEFIEK------------DGQYFDTRGS 655
            N               G + E LN+++G++ IEF                G +  +  +
Sbjct: 568 NNSSIDSHISSGISLSNGEFKESLNREDGKIVIEFFSSPSSGKPSPVAFPKGSHDSSGVT 627

Query: 656 VPLFNTIVTKSYPH-EINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTA 714
            P+F+ I ++SY + + N+T  + LS D LYGLPNSLILLFSDCV L RH  Y+++HN  
Sbjct: 628 TPIFSNIASESYYYPKSNDTDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHNIV 687

Query: 715 QPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTM 774
            P +F   C + EQR+LSWK EW F    S   F+NDT+EGVYHHTMSFY GL+IYYFT+
Sbjct: 688 TPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTV 747

Query: 775 ARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKW 834
            + L    ++++VQ VL+ L +L  +IE+K VKIVPL+WQGFMAGC+C DS++QLEFK+W
Sbjct: 748 VKGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDSNLQLEFKEW 807

Query: 835 TAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCD 867
            A+L   G+GSYWGARQIM EVWRRR+   + D
Sbjct: 808 AAKLCKSGMGSYWGARQIMFEVWRRRLNGEQND 840

>Scas_626.6
          Length = 839

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/862 (46%), Positives = 516/862 (59%), Gaps = 60/862 (6%)

Query: 26  KEGSGTAVRRPR-AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPI 84
           ++ + T  +RPR AKTFTGCWTCR RKVKCDL +P C RC+KSGL+CGGYDIKLRWS  +
Sbjct: 2   RKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLV 61

Query: 85  RFDKFGNQMAGEDRDGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMI 144
           +FD +G Q+               +QRRNI FV+              LS LH+PP E I
Sbjct: 62  KFDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKI 121

Query: 145 ADHKTWIIKRFGVFKGTDXXXXXXXXXXXXXXXXXFADAMAXXXXXXXXXXXXXXXXXXX 204
           AD KTWIIK+FGVF+GTD                   D                      
Sbjct: 122 ADGKTWIIKKFGVFRGTDK-----------------IDKQYAPRKKRRKPAPSTVSKRKT 164

Query: 205 XXLQGSLGSGNXXXXXXXXXXXXXXESAGAMSPVSATPLF-DFDFSTPGLVSSEWMAGEL 263
                 L +                  +   SPV+  P F DFD +   + S EW++ EL
Sbjct: 165 LKTGNKLSAKESAGKPINIEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSEL 224

Query: 264 KDDTTLSSAMLRNTLSFPTGLSVAQHGDGIT-ADTAPPKSQSSIFPEQTLPLQSAG---- 318
           +DD  LS+  ++       G S+    D  T A T+  +   S      +P+        
Sbjct: 225 RDDVLLSAFAIQ-------GASINDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGD 277

Query: 319 -TMVPPSVD-EVSKVYRLLLNNQGTDCNSSTGYKGLSGVHTPYTVDNVAIHGPES--RMP 374
            T   P+ D  +     LL +N+ T  + ST  KG+  V T        +  P+S   MP
Sbjct: 278 DTQTSPNNDYTIQNALNLLFHNKQTPTSPSTS-KGM--VKT-------LLDAPQSDSHMP 327

Query: 375 ASAIESVPSIVPDPTIFTLAEHTNSL---IRLPRMGMQIHGLTRFLLSYYQQNVADLMSV 431
            + +E    I P P    + E  N L     +P  G+ +HG+ +FLL+YY +NVADLM+V
Sbjct: 328 RTIMEI---INPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTV 384

Query: 432 VALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMK 491
           V L +NPWK +YFPRA++ALG+L  LGYT++SRN+LLNALLAVSCF+L+SKF KNSKE  
Sbjct: 385 VPLSRNPWKKLYFPRALQALGDLVGLGYTTNSRNSLLNALLAVSCFNLKSKFEKNSKEYN 444

Query: 492 YFVSLGMDFRNQASGFLNACLSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTIC 551
           YF++LG++ R QAS FLN CL+ST   E YKDVLTAILSMNSIDVVWGTM DCQ HLTIC
Sbjct: 445 YFLNLGIELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTIC 504

Query: 552 EEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGX 611
           E+F+E RM SRP +S KAR LHRIFSFLKLIQDSTALDKV++KEI++   G K+      
Sbjct: 505 EDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVI--YGKKDKPDKNK 562

Query: 612 XXXXXXXXXXXFTGRYVEQLNKDNGRVCIEFIEKDGQYFDTRGSV----PLFNTIVTKSY 667
                        G++ E LNK NG++ IE+I  D    +   S     P+F  I ++SY
Sbjct: 563 VADPFVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESY 622

Query: 668 --PHEINETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVK 725
             P + +E+  D LS D LYGLPNSLILLFSDCV +VRH  Y+     A P  F   C+ 
Sbjct: 623 YKPGQKSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFTEICLN 682

Query: 726 IEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQN 785
            E+RLL WKPEW F+K+++  EFI+DT+EGVYHHTMSFYYGL+IYYF+MA+ L +  LQ+
Sbjct: 683 FEKRLLKWKPEWAFYKENTD-EFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQS 741

Query: 786 YVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGS 845
           YV+KVL HL +L ++I+HK VKIVPLMWQGF+AGCS     +Q EF+KW A+L   G+GS
Sbjct: 742 YVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMGS 801

Query: 846 YWGARQIMLEVWRRRMTDGKCD 867
           YWGARQ+M EVWRRRM D   D
Sbjct: 802 YWGARQVMFEVWRRRMNDEPND 823

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/657 (53%), Positives = 457/657 (69%), Gaps = 36/657 (5%)

Query: 239 SATPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLR----NTLSFPTGLSVAQHGDGIT 294
           + T LFDFDFS+      EW++ EL+DD  LS++ ++    NT +FP G +  +     T
Sbjct: 184 TPTDLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTE--SSAT 241

Query: 295 ADTAPPKSQSSIFP------EQTLPLQSAGTMVPPSVD---EVSKVYRLLLNNQGTDCNS 345
           AD    K+ S           Q   +Q        S+D   EVS+VYRLL +++  D + 
Sbjct: 242 ADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASIDPIAEVSQVYRLL-SHRNEDKDK 300

Query: 346 STGYKGLSGVHT---------PYTV---DNVAIHGP--ESRMPASAIESVPSIVPDPTIF 391
               +     H          P  V   + ++IH P  ESRMP S +E VPS+VPDP+IF
Sbjct: 301 DVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIF 360

Query: 392 TLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKAL 451
            L    N L+RLP  G+ +HGL RFLL+YY QNVADLM+VVALP NPWKTIYFPRA+KAL
Sbjct: 361 NLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKAL 420

Query: 452 GELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNAC 511
           G+L  +GYTS+SRN+LLNALLAVSCF+LQSKFPKN+ +M++++ LG++FR+QAS FL  C
Sbjct: 421 GDLAGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKC 480

Query: 512 LSSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEKARC 571
           L+S++ QE YKD+LTAILSMNSIDVVWGTM+DCQYHLTICE+F+E RMK+RP +SEKA+ 
Sbjct: 481 LNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKA 540

Query: 572 LHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGXXXXXXXXXXXXFTGRYVEQL 631
           LHRIFSFLKLIQDSTALDKV+E EI++KD  D++                   G + E L
Sbjct: 541 LHRIFSFLKLIQDSTALDKVREGEIVIKD--DEDVTGEQLQESQTGQDLNIADGEFKESL 598

Query: 632 NKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPH-EINETRIDTLSMDVLYGLPNS 690
           N+ +G++ IEF+++      + GS P+F  I +++Y + +++ T  D LS D LYGLPNS
Sbjct: 599 NQKDGKIRIEFVKQPQS--SSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNS 656

Query: 691 LILLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFIN 750
           LIL FSDCV LVRHR Y+K +    P  +   C + E+RLL+WK EW F+K  ++ EF+N
Sbjct: 657 LILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTR-EFVN 715

Query: 751 DTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVP 810
           DT+EGVYHHTMSFYY L+IYYFTMAR L +  LQ+YV+KVLSHL +L ++I+HK+VK+VP
Sbjct: 716 DTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVP 775

Query: 811 LMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCD 867
           L+WQGF+AGCS  DS++QL FKKW A+L + G+GSYWGARQIM EVWRRRM   + D
Sbjct: 776 LIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEEND 832

 Score =  176 bits (445), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 93/131 (70%), Gaps = 1/131 (0%)

Query: 33  VRRPR-AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGN 91
           +R+PR AKTFTGCWTCR RKVKCDLG+PSC+RCE+SG +CGGYDIKLRWS PI+FD++G 
Sbjct: 8   IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYGV 67

Query: 92  QMAGEDRDGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMIADHKTWI 151
           Q+       D       FQRRNI FVR              LSALHSPPLE IA  KTWI
Sbjct: 68  QLPPSPNSPDSGSDEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENIAGDKTWI 127

Query: 152 IKRFGVFKGTD 162
           I +FGVF+GT+
Sbjct: 128 INKFGVFRGTE 138

>Kwal_27.9688
          Length = 841

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/670 (49%), Positives = 440/670 (65%), Gaps = 65/670 (9%)

Query: 236 SPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTLSFPTGLSVAQHGDGITA 295
           S  S   LFDFDFS+      EW+A EL+DD  LS++ ++      T  ++ Q   G T+
Sbjct: 183 SSQSLANLFDFDFSSMNFNGHEWIANELRDDALLSASAIQGG----TMDNLFQRPQGQTS 238

Query: 296 DTAPPKSQSSI----FPEQTLP-----------LQSAGTMVPPSVDEVSKVYRLLL--NN 338
            +A  + QSS      P +  P           LQ AG   P  VD++S+VY+LL   N 
Sbjct: 239 FSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQKAG---PADVDDISRVYKLLFHRNE 295

Query: 339 QGTDCNSSTGYKGLSGVHTPYTV---DNVAI---HGPESRMPASAIESVPSIVPDPTIFT 392
             +          +   H P T+   DNV +    G E RMP   +E V S VPD TIF 
Sbjct: 296 DRSKVTQQAPVVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTIFN 355

Query: 393 LAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKALG 452
           L  + N L+RLP  G+++HGLTRFL++YY QNV DLM+VVALP NPW+TIYFPRA +ALG
Sbjct: 356 LPTNDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQALG 415

Query: 453 ELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACL 512
           ++  +GYTS+SRN+LLNA+LAVSCF+LQSKFP+NS EM++++ LG++FR QAS FL ACL
Sbjct: 416 DIAGVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKACL 475

Query: 513 SSTSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEKARCL 572
           +S+++QE YKD+LTAILSMNSIDVVWGTM+DCQYHLT+CE  +E RMK+RP LS KAR L
Sbjct: 476 ASSAKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARAL 535

Query: 573 HRIFSFLKLIQDSTALDKVQEKEIIM-----KDAGDKEFQKNGXXXXXXXXXXXXFTGRY 627
           HRIFSFLKLIQDSTALDKV E+EI++     +   + +   NG              G +
Sbjct: 536 HRIFSFLKLIQDSTALDKVHEREIVIDHRIPESVVENDVSDNG--------------GEF 581

Query: 628 VEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPHEINETRI----------D 677
            E LNK +G++ IE+++++ +     GS P+F+++ +++Y +  N              D
Sbjct: 582 KESLNKVDGKIRIEYVKQNRK----SGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGND 637

Query: 678 TLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEW 737
            LS D LYGLPNS+ILLFSDCV L RHR Y+++H+   P S+ + C + E++L  W  EW
Sbjct: 638 VLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEW 697

Query: 738 IFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLREL 797
            F K +S  EF+NDT+EGVY+HTMSFY  L+IYY TMAR      +Q  V+  L++L +L
Sbjct: 698 DFHKPNS-TEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKL 756

Query: 798 GNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVW 857
             +I +K VKIVPL+WQGF+AGCS  D+ +QL++K+W A+L N G+GSYWGARQIM EVW
Sbjct: 757 TELI-NKGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVW 815

Query: 858 RRRMTDGKCD 867
           RRR+    CD
Sbjct: 816 RRRVNGENCD 825

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (69%), Gaps = 4/133 (3%)

Query: 30  GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKF 89
           G  VRR   KTFTGCWTCR RKVKCDLGKP+CQRCEKSGL+CGGYDIKLRWS  I+F+KF
Sbjct: 11  GKEVRR--VKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKF 68

Query: 90  GNQMAGEDRDGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMIADHKT 149
           G Q+       +G +  Q  QRRN+ FV               LSALHSP  + I+D+KT
Sbjct: 69  G-QVDSNGSPANGTEEPQS-QRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDKISDNKT 126

Query: 150 WIIKRFGVFKGTD 162
           WIIK+FGVF+GT+
Sbjct: 127 WIIKKFGVFRGTE 139

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/669 (45%), Positives = 409/669 (61%), Gaps = 52/669 (7%)

Query: 238 VSATP-LFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTL---SFPTGLSVAQHGDGI 293
           V  TP L D+D++   +   EW++ EL+DD  LS+  L+      + P  +S+ ++ + +
Sbjct: 209 VPPTPNLLDYDWNNLNITGYEWISSELRDDALLSAVTLQGHHLGHTQPQEISLEENSNVV 268

Query: 294 TADT-APPKSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVY----RLLLNNQGTDCNSSTG 348
           + +     K     F       Q + T+   +     K+Y    +LL     ++      
Sbjct: 269 SGEEHVNAKEHGCAFEADN---QGSSTLPNKAASANDKLYQQNLKLLFQKNSSNSEEPDP 325

Query: 349 YKGLSGVHT-------PYTVDNVAIHGP---ESRMPASAIE--SVPSIVPDPTIFTLAEH 396
              +  V         P +  N     P   ESRMP S +E  S  S +P P +  +   
Sbjct: 326 QALIDDVFVNIEPRSLPASDLNKITLAPPNEESRMPKSMLELTSYSSDLP-PELVDI--- 381

Query: 397 TNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGA 456
                 +P+  + +HGL RFLL++Y  NVAD M+VV L KNPWKT+YFPRA+ ALG+L  
Sbjct: 382 ------IPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKTLYFPRALMALGDLAG 435

Query: 457 LGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACLSSTS 516
           LG +S+SRNALLNALLAVSCFHLQSK+P+N K  KYF+ LG++ RNQAS FL  CL++ S
Sbjct: 436 LGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELRNQASNFLRLCLNTKS 495

Query: 517 R-QEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEKARCLHRI 575
              E YKDVLTAILSMNSIDVVWGTM+DCQ HL +CE+F+ESRMK RP +SEK + LHRI
Sbjct: 496 SIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMKLRPNISEKTKTLHRI 555

Query: 576 FSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQK-----NGXXXXXXXXXXXXFTGRYVEQ 630
           FSFLKLIQDSTALDKV+ KEI++  + + +  K     N               G + E 
Sbjct: 556 FSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSSEPRVDVVQEGLFREA 615

Query: 631 LNKDNGRVCIEFIEK-----DGQYFDTRGSVPLFNTIVTKSYPHE------INETRIDTL 679
           LN+++G++ IEF+++           +  + P+F  I T+SY ++      +++T  + +
Sbjct: 616 LNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATESYYNKSDISKLVSKTDENII 675

Query: 680 SMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEWIF 739
             D LYGLPNSLILLFSDCV +VRH  Y+       P  F    +  E+RLL WK EW F
Sbjct: 676 GTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSLNFEKRLLKWKSEWNF 735

Query: 740 WKDDSKAE-FINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELG 798
            +++S+ + FIN T E +YHHTMSFY+ L+IYYFTMARSL    LQNYV KVL HL  + 
Sbjct: 736 HQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFLQNYVAKVLDHLNAME 795

Query: 799 NIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWR 858
            +++ K VKIVPL+WQGFMAGC+CTD + Q EF++W A+L   G+GSYWGARQ+MLEVWR
Sbjct: 796 ELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGVGSYWGARQVMLEVWR 855

Query: 859 RRMTDGKCD 867
           RR  D   D
Sbjct: 856 RRKEDEPGD 864

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/132 (56%), Positives = 89/132 (67%), Gaps = 8/132 (6%)

Query: 37  RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFG------ 90
           RAKTFTGCWTCR RKVKCDL  P CQRCEKS L CGGYDIKLRWS P++FD +G      
Sbjct: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQN 73

Query: 91  NQMAGEDRDGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMIADHKTW 150
           +     +  G  ++P   +QRRNI FVR              L+ LH+PP+E I+D+KTW
Sbjct: 74  SPATTTNLSGSVDEPQ--YQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDNKTW 131

Query: 151 IIKRFGVFKGTD 162
           IIK+FGVFKGTD
Sbjct: 132 IIKKFGVFKGTD 143

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  311 bits (796), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 177/478 (37%), Positives = 268/478 (56%), Gaps = 74/478 (15%)

Query: 410 IHGLTRFLLSYYQQNVADLMSVVALP---KNPWKTIYFPRAVKALGELGALGYT-SHSRN 465
           +H   RFLL++Y + V DLM++  +P   KNPW  IYFPRA+ ALGEL A   + +++R 
Sbjct: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308

Query: 466 ALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACLS------------ 513
           +LLN  L+VSCF+L+     +     ++++L ++ R +AS FLN  L             
Sbjct: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLALEQEEEYEEYRDIL 368

Query: 514 -----STSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEK 568
                +    +H+ D+L AIL+MNSID+VWGTM DC  +L ICE+ I S+ K R ++S+K
Sbjct: 369 EDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLI-SKNKKRVVVSKK 427

Query: 569 ARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGXXXXXXXXXXXXFTGRYV 628
            + L+ I++FLKL+Q+STA++ +  +  +     D                      +Y+
Sbjct: 428 IKSLYTIYAFLKLMQNSTAMETITSEPSLDFHNPD------------------IIPYKYL 469

Query: 629 EQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPHEINETRIDTLSMDVLYGLP 688
            +  +++                         TI T  Y      T+++TL  D L  LP
Sbjct: 470 RETYEND-----------------------IKTIFTDHY----GSTKMNTLGADALNALP 502

Query: 689 NSLILLFSDCVSLVRHRFYFKRHNTA--QPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKA 746
           NSL+LLF DCVSL R+ FY K+ +     PT F +   + E +L +WK EW F+ D +  
Sbjct: 503 NSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFF-DSTGR 561

Query: 747 EFINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELGNIIE---- 802
            F++ T+EG+YHHTMSFYYGL +YY+   ++ +  +L   V KV+ HL+++  + +    
Sbjct: 562 NFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSAG 621

Query: 803 HKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRR 860
            + +K++PL+WQGF+AGC C+D  +Q EFK W   +   G GSY GA QIM EVWRRR
Sbjct: 622 KEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRR 679

 Score =  120 bits (302), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/129 (46%), Positives = 79/129 (61%), Gaps = 5/129 (3%)

Query: 38  AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGED 97
            KT++GCWTCR RKVKCDL +PSC RC +S + CGGY IKLRWS  + FD +G  M   +
Sbjct: 9   VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVPMPSNE 68

Query: 98  R----DGDGEQPAQPFQRRNIMFVRXXXXXXXXXXXXXXLSALHSPPLEMIADHKTWIIK 153
                +GD  + +    RRN+  VR              LS LH+PP + IA++KTWIIK
Sbjct: 69  SITTTEGDDVETSTNL-RRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANNKTWIIK 127

Query: 154 RFGVFKGTD 162
           +FGVF+  +
Sbjct: 128 KFGVFRAIE 136

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 25 KKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRW 80
          KK  S + V   + +TFTGCW CR +K +CD  +P C  C K G +C  YDI+L W
Sbjct: 11 KKVASSSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 25 KKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRW 80
          + E      R+PR + FTGCW CR +K +CD G P C  C K G  C  YD++L W
Sbjct: 5  RNERHRAGARKPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>Scas_597.4
          Length = 475

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAG 95
          +A+TFTGCW CRL+K +CD  KP+C  C + G  C  YDI+L W +   F K    M+G
Sbjct: 17 KARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMWLDVNMF-KVDTSMSG 73

>Kwal_14.1631
          Length = 443

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 31 TAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSN 82
          +   + +A++FTGCW CR +K +CD  KP C  C K G  C  YDI+L W N
Sbjct: 2  STASKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVWQN 52

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRW 80
          + + FTGCW CR +K KCD  KP C  C K G++C  YD++L W
Sbjct: 3  KDRNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSW 45

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%)

Query: 22  ALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           A  K +  G   R+P  ++ TGCW CRLRK KC   KP+C  C++  LDC
Sbjct: 508 AASKVKKEGERKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
           regulatory element binding protein involved in the
           regulation of sterol biosynthetic gene expression and
           may be involved in regulating sterol uptake [2445 bp,
           814 aa]
          Length = 814

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 1   MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS 60
           M  D+ +    R   A   +   +K   + T  R+   K+ TGC  C+ R+VKCD GKP 
Sbjct: 1   MTSDDGNAGQEREKDAELIEVGGKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPF 60

Query: 61  CQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDG 100
           C++C    LDC    I+ R        KF +  A  DR G
Sbjct: 61  CKKCTNMKLDCVYSPIQPRRRKDSSSSKFAS--AVHDRVG 98

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 19  NDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
           +D   +KK G+GT  R       TGCW CRLRK KC   +P C  C +  L+C  YDI
Sbjct: 662 DDAPNKKKAGAGTRSR-------TGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 8/59 (13%)

Query: 18  RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
           ++ + ++K+  +G       A++ TGCW CRLRK KC   KP CQ C +  L+C  YDI
Sbjct: 700 KSSDQIKKRNATG-------ARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>Scas_573.4
          Length = 1478

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 14 TPAARNDEALQKK-EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          TP +  D +      G+ T V+R R +    C  CR RKVKCD  +P CQ+C K+G+
Sbjct: 12 TPLSATDSSSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGV 68

>Scas_596.4
          Length = 701

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 16  AARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           + RN +  Q+        RR R+    GCW CRLRK KC   KP+C  C++  LDC
Sbjct: 544 SNRNQKKAQEPVDETKKARRSRS----GCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 24 QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
          +K   + T  R+   K+  GC  C+ R+VKCD GKP+C++C    L+C    I LR
Sbjct: 31 KKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLR 86

>Scas_679.26
          Length = 775

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 24  QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR---- 79
           +K   + T  R+   K+  GC  C+ R+VKCD  KP+CQ+C    L+C     K R    
Sbjct: 38  KKVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKAKG 97

Query: 80  WSNPIRFDKFGNQMAGEDRDG-DGEQPAQPFQRRN 113
            S  +R+       + +D  G DGE+       RN
Sbjct: 98  SSTSVRYVTHKQMTSEDDEQGQDGEESMHSSSTRN 132

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 24  QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           +K   + T  R+   K+  GC  C+ R+VKCD GKP CQ+C K  L C
Sbjct: 69  KKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 35  RPRAK------TFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
           RPR K      + TGCW CRLRK KC   KP C  C +  L+C  YDI
Sbjct: 526 RPRRKNTTGSRSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 28 GSGTAV-RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWS 81
          G+GT   +R R +    C  CR RKVKCD G+P CQ+C K+G+    + ++  W+
Sbjct: 8  GTGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWA 62

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          + T  R+   K+ TGC  C+ R+VKCD GKP C++C    L C
Sbjct: 33 TSTGKRKFHKKSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 39  KTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           ++ TGCW CRLRK KC   +P C  CE+  LDC
Sbjct: 766 RSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>Scas_717.33
          Length = 904

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 13/67 (19%)

Query: 16 AARNDEALQKKEGSGTAVRRPR-----AKTFTGCWTCRLRKVKCDLG------KPSCQRC 64
          +A N+ A+   E   TA +R        ++F  C +CR+RKVKCDLG      KP C RC
Sbjct: 3  SASNERAID--EAGTTASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRC 60

Query: 65 EKSGLDC 71
           + G  C
Sbjct: 61 RREGKTC 67

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 24 QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +K   + T  R+   K+  GC  C+ R+VKCD GKP C +C K  L+C
Sbjct: 34 KKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>Kwal_23.3122
          Length = 788

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 24 QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +K   + T  R+   K+  GC  C+ R+VKCD  KPSCQ+C    L+C
Sbjct: 30 KKVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>Kwal_23.3178
          Length = 611

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 38  AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           +++ TGCW CRLRK KC   KPSC  C +  L C
Sbjct: 539 SRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>Kwal_56.24566
          Length = 755

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 16 AARNDEALQKKEGSGTAVRRP-RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          AA    A+     +   + RP R ++  GC+TCRLR+ KCD  +P C  C K  L C
Sbjct: 3  AATTQPAISTGNSATALMLRPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>Scas_721.94
          Length = 869

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 10 SARCTPAARNDEAL--------QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSC 61
          SA  TP  R  E +        +K   + T  R+   K+  GC  C+ R+VKCD  KP+C
Sbjct: 13 SASATPTKRTKEKVIELIEVDGKKVSATSTGKRKFHNKSKQGCTHCKRRRVKCDELKPAC 72

Query: 62 QRCEKSGLDC 71
          +RC    + C
Sbjct: 73 RRCLNWNVPC 82

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRW-SNPIRFDK 88
          GT   +  A+++ GC  C+  K KCD  KP C  C+K G  C  Y   L+W   P + ++
Sbjct: 3  GTIEMKKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKWGGRPFKDNR 61

Query: 89 FGNQMAGE 96
             +M  E
Sbjct: 62 VSKKMKFE 69

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 2  IKDEKDTASARCTPAARNDEALQKKEGSGTAVRR----PRAKTFT--GCWTCRLRKVKCD 55
          I+DE+ TA         N   ++   G  ++  +     R  T++  GC  C+    KCD
Sbjct: 23 IRDEELTAHDHVFNVNSNSSEIRTTTGDSSSEEKLSTKKRKSTYSRKGCLQCKKAHTKCD 82

Query: 56 LGKPSCQRCEKSGLDC 71
            KP C RCEK  +DC
Sbjct: 83 ERKPKCSRCEKRSIDC 98

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
           + ++R R +    C  CR RKVKCD  +P CQ+C K+G+
Sbjct: 50 SSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGV 89

>Kwal_26.6732
          Length = 676

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 36 PRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          P+ ++ TGC TCR R+ KCD  KP C  CE + L C
Sbjct: 4  PKKRSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          + T  R+   K+  GC  C+ R+VKCD  +P C  C+K  LDC
Sbjct: 42 TATGKRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWS 81
          G A ++ R +    C  CR RKVKCD  +P C +C K+G+    + ++  W+
Sbjct: 9  GAAPKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWA 60

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          EG  + + + R +    C  CR  K KCD  KP+C RC K G+ C  YD+
Sbjct: 6  EGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDL 54

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 3   KDEKDTASARCTPAAR-NDEALQK-KEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS 60
           KDE++  SA  TP  + N   +   K+  G  V+R  ++   GC  C+ R++KCD  KP 
Sbjct: 164 KDEQN-HSANGTPVIKPNINVISTIKDAEGNTVKRKYSRN--GCAECKRRRMKCDESKPK 220

Query: 61  CQRCEKSGLDC 71
           C +C +   DC
Sbjct: 221 CWQCTRLNRDC 231

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 24 QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          +++E +  + +R R  +F  C  CR  K KCD  KPSC RC K+G++C  YDI+
Sbjct: 10 KQEEQNSHSSKRNRI-SFV-CKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIE 60

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 16 AARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          ++R DE +    G  T  +  R K    C +CR  K KCD  KPSC RC K+G  C  YD
Sbjct: 14 SSRRDEGVS---GKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYD 69

Query: 76 IK 77
          ++
Sbjct: 70 VE 71

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 38 AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          +K+ T C  CRL+K+KCD   PSC+RC K  + C   D
Sbjct: 28 SKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>Kwal_23.2905
          Length = 881

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 18 RNDEALQKKEGSGTAVRRPRA------KTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R++  +Q KE S    RRP +      ++   C  CR+RKVKCD   PSC RC  +   C
Sbjct: 18 RDNNDVQLKEQSNRK-RRPTSAIMGISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPC 76

Query: 72 GGYD 75
             D
Sbjct: 77 VSID 80

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 37 RAKTFT-GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          + K F+  C  CRL+K+KCD  KPSC  C+K G  C   D
Sbjct: 55 KVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSD 94

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++  R +    C  C  RK+KCD  KP C+ C K+G +C
Sbjct: 35 IQHKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 8   TASARCTPA-ARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEK 66
           T+S+   P  ++N +    K  S T +  P  +    C  CR +K +CD  +P C +C  
Sbjct: 33  TSSSEANPHFSKNVKEAMIKTASPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAA 92

Query: 67  SGLDCGGYDIKLRWSNP 83
            G +C   D  LR + P
Sbjct: 93  VGFECRISDKLLRKAYP 109

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 25 KKEGSGTAVRR--PRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71
          KK  SG A      R +T+  C +CR RKVKCDLG       P C RC++    C
Sbjct: 4  KKRPSGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 22  ALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           +++K    G   R  R  +  GC  C+ R++KCD GKP C +C +   +C
Sbjct: 175 SIKKASAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>Kwal_23.6529
          Length = 598

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 43  GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRW-SNPIRFDKFGNQMAGEDRDGD 101
           GC  C+  K+KCD  KP C +C K G D   Y + L+W   P +  K G ++       D
Sbjct: 13  GCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQWGGRPYKNAKKGKKVLPNTTCID 72

Query: 102 G 102
           G
Sbjct: 73  G 73

>Scas_663.12
          Length = 944

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 25 KKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          K        ++ R +    C  CR  KVKCD  KP C RC K  L+C  YD+
Sbjct: 21 KSINDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDV 71

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGY 74
          ++  A+  ++G+   V+  R +    C  C  RKVKC+  +P C  CEK+   C  +
Sbjct: 12 KDQSAVVLEDGTVYKVQHKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYF 68

>Kwal_26.6805
          Length = 944

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          C +CR  K KCD  KPSC RC K G+ C  YD+
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDV 60

>Kwal_26.7095
          Length = 838

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++ R +    C  C+ RK+KCD  +PSC RC K  L+C
Sbjct: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 8/110 (7%)

Query: 2   IKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSC 61
           I    D   +  TP       +  K+G+   V+R  ++   GC  C+ R++KCD  KP+C
Sbjct: 121 ISQADDNGHSSLTPNPAVTSTVTDKKGN--TVKRKYSRN--GCSECKRRRMKCDETKPTC 176

Query: 62  QRCEKSGLDC----GGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGEQPAQ 107
            +C +    C       + K R SN  R  +F       D D +  +  Q
Sbjct: 177 WQCARLNRQCVYVLNPKNKKRRTSNAQRVKEFRKHSTSLDNDHNNARKRQ 226

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          EG+    R+    +F  C  CR  K +CD  KP C RC+K  L+C  YD+
Sbjct: 11 EGNAARTRKRNRISFV-CQACRRSKTRCDKEKPICTRCKKLKLEC-VYDM 58

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 26  KEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
           +E S     RP  K    C  CR R+ KCDL  P C  C+K GL+C   +  LR
Sbjct: 59  RESSANVTSRPTKKRL-ACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 20/37 (54%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          + R +    C  CR RK KCD GKPSC  C K G  C
Sbjct: 12 KKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 19 NDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          +DE  ++ + S  A +R R  +F  C  CR  K KCD  KP C RC K  L C  YD++
Sbjct: 12 DDEKSREDQTSNGACKRQRI-SFV-CQACRKNKTKCDREKPRCGRCVKYHLKC-VYDVE 67

>Scas_702.7
          Length = 1113

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
          ++RPR K    C  CR RK+KC  G   C  C     +C   D+K   SNP
Sbjct: 26 IKRPRKKVSKACANCRRRKIKCT-GTYPCSNCAAYQCECIFDDLKEDSSNP 75

>Kwal_55.20722
          Length = 827

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCG 72
          V RPR      C  CR RK+KCD  +P C RC+++ L C 
Sbjct: 8  VNRPRLV----CLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC------GGYDIK 77
          G    +R+PR+K    C  CR RK+KC+ GK  C  CE    +C      GG  IK
Sbjct: 30 GFSGKIRKPRSKVSKACDNCRKRKIKCN-GKFPCASCEIYSCECTFSTRQGGARIK 84

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 16 AARNDEALQKKEGSGTAVRR---------PRAKTFTGCWTCRLRKVKCDLGKPSCQRCEK 66
          AAR+D A     G  TA+ R         PR K    C +CR +K+KC  G   C+ CE 
Sbjct: 18 AARSDSASSGVNGDRTAIPRDSNGNGTGKPRRKVSRACDSCRKKKIKCS-GTLPCKSCET 76

Query: 67 SGLDC 71
           G +C
Sbjct: 77 YGCEC 81

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          + ++ TGC  CR RK KCD  KP+C  C+++ L+C
Sbjct: 4  KKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (76%)

Query: 42 TGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +GC+TCRL+++KCD   P C RC+++ L C
Sbjct: 41 SGCFTCRLKRMKCDEQHPICGRCKRNLLTC 70

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          +R R +    C  CR RKVKCD  +P C +C K+G+
Sbjct: 9  KRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGV 44

>Scas_556.6
          Length = 1022

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          GS   +++    +F  C  CR  K KCD  KP+C RC K  L C  YD+
Sbjct: 31 GSNRQIKKRNRISFV-CQECRKAKTKCDKEKPACTRCVKQNLAC-VYDV 77

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          C  CR  K KCD  KP+C RC + GL C GYDI+
Sbjct: 24 CIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIE 56

>Kwal_56.23058
          Length = 775

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 21  EALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           +A       G  V+R  ++   GC  C+ R++KCD GKP+C +C +   +C
Sbjct: 128 QATSSSGADGKTVKRKYSRN--GCTECKRRRMKCDEGKPTCWQCARLNREC 176

>Scas_674.12*
          Length = 909

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          C  CR +KVKCD  +PSC RC K+   C
Sbjct: 15 CLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 17/76 (22%)

Query: 36 PRAKTFT----GCWTCRLRKVKCDLGK------PSCQRCEKSGLDC-------GGYDIKL 78
          P+ +TF      C  C++RKVKCDLG       P C RC++   +C       GG+ +  
Sbjct: 12 PKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRVAK 71

Query: 79 RWSNPIRFDKFGNQMA 94
          +    ++ +  G  MA
Sbjct: 72 QSLVSLKEESAGKSMA 87

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
           C  CRL+K+KCD  +PSC  C+K G  C   D
Sbjct: 28 ACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSD 60

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 22  ALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           A    +  G  V+R  ++   GC  C+ R++KCD GKP+C +C +    C
Sbjct: 135 ATPSTDADGKIVKRKYSRN--GCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          C  CR RK+KCD  +P C +C + GL C  YDI+
Sbjct: 25 CLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIE 57

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 1  MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPS 60
          M+  EK T+  +        E   K +    A   P AK    C  CR R+ KCDL  P 
Sbjct: 1  MVNFEKHTSHQQHKNETSQHET--KLQMDSEASSEPPAKRL-ACANCRRRRKKCDLEYP- 56

Query: 61 CQRCEKSGLDCGGYDIKLR 79
          C RC++ GL C    + LR
Sbjct: 57 CGRCQELGLGCNINKVDLR 75

>Kwal_34.15751
          Length = 628

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          C  CR+RK+KC+  KPSC RC K  L C
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Scas_521.2
          Length = 890

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          + D+    K GS ++     +K+ + C  CR +K+KCD   PSC RC    + C   D
Sbjct: 15 KKDDGNSLKNGSPSSSTFNTSKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVD 72

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 27/63 (42%), Gaps = 11/63 (17%)

Query: 14 TPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGG 73
          +PA  N E   +K          R +    C  C   K KCD  KP C RC K GL C  
Sbjct: 46 SPAPENSETHNRK----------RNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-V 94

Query: 74 YDI 76
          YD+
Sbjct: 95 YDV 97

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR  + KCD GKP+C RC K  +DC
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 37  RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           R  +  GC  C+ R++KCD GKPSC +C +   +C
Sbjct: 157 RKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          + ++   C  CRL+K+KCD  KP+C  C+K G  C   D
Sbjct: 22 QERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSD 60

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          + S  A+     +    C  CRL+K+KCD  KP+C  C K    C   D
Sbjct: 29 QSSSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          S  +V R R K    C  CR RK+KCD  KP C  C    L
Sbjct: 4  SQASVIRKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNL 44

>Scas_711.31
          Length = 932

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 26/57 (45%)

Query: 15 PAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          P A N +  +K  G          K    C  CRL+K+KCD   P C  C K+G+ C
Sbjct: 16 PNANNLQKKRKNSGQVFVQDSIFIKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 26 KEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
          KE SG   R     +   C  CR+RK+KCD   PSC +C ++   C   D   R   P
Sbjct: 7  KESSGNIYR-----SVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIP 59

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor,
          hypothetical start
          Length = 1372

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          R +    C  CR RKVKCD  +P+C +C K+G+
Sbjct: 64 RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGV 96

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 32 AVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG-LDC 71
          AV   + K    C  CR RK+ CD GKP C  C K G  DC
Sbjct: 4  AVLTKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDC 44

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          C  CR  K KCD  KP C RC K+ + C  YDI+
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 10/50 (20%)

Query: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71
          GSG   RR     +  C  CR RKV+CDLG      +P C RC +   +C
Sbjct: 20 GSGRKWRR----IYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 24 QKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          QKK  S + +   R+     C  CRL+KVKCD   PSC +C  +   C   D
Sbjct: 25 QKKRPSSSILGISRS--IAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
           [1839 bp, 612 aa]
          Length = 612

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 27  EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRF 86
           E     V R    +  GC  C+ RKVKCD  KP+C +C   G  C    + +  ++ IRF
Sbjct: 5   EAGRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRC----VYMVNNSKIRF 60

Query: 87  DKFGN-QMAGEDRDGDGEQPAQ 107
            +     + G +R  D +  A+
Sbjct: 61  KEINVLSLRGRERVTDKKACAR 82

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 28 GSGTAVR--RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
          GS T  R   P  +    C  CRL+K KCD   P C +C   G +C   D   R S P
Sbjct: 42 GSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          G   RR  +K   GC TC++RK +C   +P C+ C +  LDC
Sbjct: 8  GEPKRRRHSKK--GCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 11/54 (20%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R D  LQ K+G      R R+     C  CR RK +CD   PSC  C K+G+ C
Sbjct: 26 RTDVLLQDKKG------RSRS-----CLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           ++ R  +  GC  C+ +KVKCD  KP C +C    L+C
Sbjct: 17 AKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC 55

>Kwal_56.24670
          Length = 643

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R    TGC  C++RK +C   KP+C  CE+ G  C
Sbjct: 20 RTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 17  ARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGK---PSCQRCEKSGLDC 71
           A  D +   K+ +G +  RP     T C  CR  K+KC+  +    SC RCE+ GL C
Sbjct: 69  ASPDRSKVSKQQNGASGHRP----VTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
          + R K    C  C+ RK KCD   PSC  C K G +C  Y++ L+
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ 46

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          R  +  + K  + T V +  ++   GC TCR R  KCD  KP C  C+++ L C   D +
Sbjct: 9  RQSKLFKNKSSATTLVEKRSSR---GCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRDNE 65

Query: 78 LRWSNPIRFDKF 89
               P  F  F
Sbjct: 66 EAQEEPHMFLNF 77

>Scas_630.14
          Length = 701

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 21 EALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          +A + K+G     R P++     C  CRLRK KCD  KP C  C   G+    YD
Sbjct: 8  KAAKSKDGIRKRNRVPKS-----CTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>Kwal_47.17681
          Length = 854

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLG-KPSCQRCEKSGLDCGGYDIK 77
          E SG  VR+PR  T   C  C  RKV+CD   +  C  C+  GL C   D+K
Sbjct: 4  ERSGYRVRKPR--TNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVK 53

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 19  NDEALQKKEGSGTA--VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
           NDE     + + T+    R R K    C  CR RK+KCD  +P C  C+  GL
Sbjct: 63  NDEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGL 115

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 42 TGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
            C  CR +KVKCD G PSC+ C ++ + C   D
Sbjct: 23 NACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>Scas_590.2
          Length = 1172

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 31  TAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFG 90
           T +R  + ++ T C  CR RK KCD   PSC  C K+ + C           P R+++  
Sbjct: 29  TLLRDKKGRS-TACLLCRRRKQKCDHQLPSCTACLKAAVKC---------VQPSRYNEKH 78

Query: 91  NQMAGEDRDGDGEQ 104
                ++ D + EQ
Sbjct: 79  ESDDNDEVDNENEQ 92

>Kwal_14.2619
          Length = 1167

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 42 TGCWTCRLRKVKCDLGKPSCQRC--EKSGLDCGGYDIK 77
          T C TCR RKVKCD  KP C  C   KS  +C  Y++K
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIKYKSISEC-SYEVK 46

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similarity
           to transcription factors, has Zn[2]-Cys[6] fungal-type
           binuclear cluster domain in the N-terminal region,
           involved in resistance to cycloheximide [2499 bp, 832
           aa]
          Length = 832

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 12/86 (13%)

Query: 30  GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKF 89
              V++PR +    C  C+  K KCD  +P+C RC+++ L C   +         R D  
Sbjct: 3   SITVKKPRLRLV--CLQCKKIKRKCDKLRPACSRCQQNSLQCEYEE---------RTDLS 51

Query: 90  GNQMAGEDRDGDGEQPAQPFQRRNIM 115
            N +A  D DG        F+++ ++
Sbjct: 52  AN-VAANDSDGFNSSHKLNFEQQPVL 76

>Kwal_23.6425
          Length = 735

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          R R K+   C  CR RK+KCD  +P C  C   GL
Sbjct: 27 RKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGL 61

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 32 AVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC------GGYD 75
           +++   ++  GC TCR R+ KCD  +P C  C+++ L C      G YD
Sbjct: 38 VLKKTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 39 KTFTGCWTCRLRKVKCDLGKPSCQRCEKSG--LDCGGYDIKLR 79
          K    C  CR RKV+CD  KP C  C K G  ++C  Y+++ R
Sbjct: 4  KNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKR 45

>Kwal_47.17233
          Length = 948

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC------ 71
          ++  AL  ++G    ++  R +    C  C  RK+KC    PSC +C K   +C      
Sbjct: 9  KDQAALVLEDGKIYKIQHRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLND 68

Query: 72 -------GGYDIKLRWSNP 83
                  G ++K+  S+P
Sbjct: 69 RISRGGHSGMEVKVENSDP 87

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
           C TCR R+ KCDL  P C  C+K G++C   D  LR
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLR 48

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71
          GS ++  +    TF  C  C+ +K+KCDLG       P C  C +S   C
Sbjct: 22 GSSSSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71

>Scas_720.58
          Length = 890

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CRL+K+KC    P C +C K+G+ C
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC 47

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 34 RRP--RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGY 74
          +RP  R K    C  CR RK+KCD  KP C  C +  L    Y
Sbjct: 25 KRPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>Scas_588.11
          Length = 835

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL-DCGGYDIKLRW 80
          G  +R+P A     C  CR RK+ CD  KP C  C K+   DC   DI  R+
Sbjct: 5  GRKMRKPPA-----CVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRY 51

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 36  PRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           P  +    C  CR +K++CD  +P C +C   G +C
Sbjct: 175 PSYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          V + R +    C  CR  K KCD  KP C RC K  L C  YD+
Sbjct: 14 VGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDV 56

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL-DCGGYDI 76
          G  +R  + K    C  CR RK+ CD  KP C  C ++G  DC   DI
Sbjct: 2  GVDIRGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFYPDI 49

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          + R K    C  CR  K KCD  KPSC RC++    C  YD++
Sbjct: 12 KKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDLE 53

>Scas_550.5*
          Length = 832

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 23 LQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +QKK   G   +RP       C  CR +K++C+  +PSC RC++ G  C
Sbjct: 1  MQKKSIRG---QRPTH----VCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Scas_625.5
          Length = 1141

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 13/78 (16%)

Query: 4   DEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLG--KPSC 61
           D + + SA  T AA N  + QKK          R K    C  CR +K+KCD    K  C
Sbjct: 46  DRRHSISAAGTNAASNSSS-QKK----------RTKASRACDQCRKKKIKCDFSEEKTLC 94

Query: 62  QRCEKSGLDCGGYDIKLR 79
             C+++G  C    + L+
Sbjct: 95  SNCQRNGEKCTFERVPLK 112

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD-IKLRWSNPI 84
           C  CR+R+VKCD GK  C RC +   DC     +K R S PI
Sbjct: 7  ACDYCRVRRVKCD-GKKPCSRCIEHNFDCTYQQPLKKRGSKPI 48

>Kwal_55.20674
          Length = 252

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           T + + R+     C +CR RK KC   KP CQRC +  + C
Sbjct: 7  ATKMGKDRSGAMFTCKSCRQRKRKCSREKPQCQRCARLSIPC 48

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%)

Query: 38 AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          +++   C  CR +K KCD   PSC RC   G  C   D
Sbjct: 34 SRSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          S +  +R    +  GC  C+   +KCD G+P C +C K  + C
Sbjct: 9  SNSGKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNISC 51

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          ++ R +T   C  C+ RK+KCD  +P+C  C  + +
Sbjct: 18 KKKRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANV 53

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGY 74
          R +T   C  C   K KCD  KPSC RC K  L C  +
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYF 56

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRC 64
          +N E  QKK+    + R+P AK+   C  CR+RK+KCD  +P C  C
Sbjct: 2  KNTELSQKKKLDRQSRRKP-AKS---CHFCRVRKLKCDRVRPFCGSC 44

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          + K    C  CR+++ KCD+ +P C  C K G++C
Sbjct: 10 KRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 39 KTFTGCWTCRLRKVKCDLGKP---SCQRCEKSGLDC 71
          +  T C  CR  K+KCD  +     C RCEK GL C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 33  VRRPRAKTFTGCWTCRLRKVKCDLGKP---SCQRCEKSGLDC 71
           + + + +    C  CR RK KCD   P    C  C K+G+DC
Sbjct: 167 LHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          E  G  V+  R K    C  CR R+VKC+  +P C  C   GL
Sbjct: 3  ESDGKIVKT-RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGL 44

>Scas_526.3
          Length = 1109

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R D  LQ K+G      R R+     C  CR RK +CD   PSC  C K+ + C
Sbjct: 26 RTDVLLQDKKG------RSRS-----CLLCRRRKQRCDHKMPSCTACLKAAVKC 68

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CRL+K+KC   KP C +C K+  +C
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC 38

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 30  GTAVRRPRAKTFTGCWTCRLRKVKCDLGK---PSCQRCEKSGLDC 71
           G AV     +  T C  CR  K+KC+  +     C RCE+ GL C
Sbjct: 123 GKAVVNAGHRPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC 167

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 2/64 (3%)

Query: 14  TPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGG 73
           T     D+AL     +     + R +    C  C+ RKVKCD   P C  C K   +C  
Sbjct: 57  TAIGNTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-R 114

Query: 74  YDIK 77
           YD K
Sbjct: 115 YDFK 118

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC-----GGYD 75
           C  C+ RK KCD   PSC  C K+G+ C      GYD
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>Scas_709.51
          Length = 759

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++ R +    C  C+ RKVKCD  KP C  C K  +DC
Sbjct: 24 KKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 15 PAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          P+  ND +L  K+       + R +    C  C+ RK+KCD  +P C  C K+ + C
Sbjct: 3  PSKYNDPSLYGKDNGS----KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54

>Kwal_27.10852
          Length = 1046

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 22  ALQKKEGSG--TAVRRPRA-KTFTGCWTCRLRKVKCDLGK---PSCQRCEKSGLDC 71
           A Q+K GS    AV  P   +  T C  CR  K+KC+        C RCE+ GL C
Sbjct: 75  ASQEKNGSAESKAVSVPTGHRPVTSCTHCRQHKIKCNANDNFPAPCSRCERMGLHC 130

>Scas_699.7
          Length = 935

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWS 81
           C  CR++K+KC   KP C +C K+  +C  Y  K R S
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRS 49

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL-DCGGYDI 76
          +R  + K    C  CR RK+ CD  KP C  C ++G  DC   D+
Sbjct: 5  IRGRKMKKPPACVQCRKRKIGCDRAKPICGNCLRNGKNDCFYPDV 49

>Scas_638.14
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 14 TPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          TP   N  +  K+      VR+P  K    C  CR RK+KC  GK  C  CE     C
Sbjct: 24 TPDLHNTNSKDKR------VRKPTNKVSKACDNCRKRKIKCT-GKQPCATCEAYQCPC 74

>Scas_542.8
          Length = 902

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 25 KKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          K     ++ RRP++     C  CR R +KC  G P C RC K  L C
Sbjct: 13 KNNTEPSSKRRPKS---LACILCRKRHIKCSGGNP-CARCIKHDLKC 55

>Scas_661.23
          Length = 741

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 2   IKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSC 61
           IK E+++ ++     + N             V+R  ++   GC  C+ R++KCD  KP C
Sbjct: 92  IKKEENSPNSETKSNSTNLPDSDTNAKKTNIVKRKYSRN--GCAECKRRRMKCDETKPIC 149

Query: 62  QRCEKSGLDC 71
            +C +   +C
Sbjct: 150 WQCARLSREC 159

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEK-SGLDCGGYDI 76
          +R  + K    C  CR RK+ CD  KP C  C K + +DC   D+
Sbjct: 3  IRGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDV 47

>Scas_449.1
          Length = 636

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 15 PAARNDEALQKKEGSGTAV--RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCG 72
          P     E L+ ++G+   +    P+ K    C  CR R+ KCDL  P C  C + GL+C 
Sbjct: 7  PTKSKRELLEGEDGNELDILDDYPKRKRL-ACSNCRRRRKKCDLNFP-CANCIRLGLNCN 64

Query: 73 GYDIKLR 79
            +  +R
Sbjct: 65 VNEEDMR 71

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEK-SGLDC 71
          VR+P A     C  CR RK+ CD  KP C  C K +  DC
Sbjct: 9  VRKPPA-----CTQCRKRKIGCDRAKPICGNCVKYNKPDC 43

>Scas_696.44
          Length = 1164

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 43  GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
            C  CR +K +CD  +P C +C   G +C   D   R S P
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFP 120

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          GC TC++RK +C   KP C+ C +    C
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 21/96 (21%)

Query: 402 RLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGALGYTS 461
           +L  MG+Q++       +YY+ ++A+++S+  + +N +  I+ P A              
Sbjct: 113 KLDSMGLQLY-------NYYRSHLANIISIAPMNQNYYLNIFLPMA-------------- 151

Query: 462 HSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLG 497
           H  + +L A+LA S  HL        ++ + FV+L 
Sbjct: 152 HENDGILFAILAWSANHLSISSSNELRKDEIFVNLA 187

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 27 EGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRC 64
          E   +  +  R K    C  CR RK+KC   +P CQ+C
Sbjct: 14 EPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQC 51

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR+R+VKCD GK  C  C ++ LDC
Sbjct: 12 ACDCCRIRRVKCD-GKRPCSSCLQNSLDC 39

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 10/54 (18%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGE 96
           C  CR+R+VKCD  +P C RC +  L C        +  P+R  K G +  GE
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRCT-------YLQPLR--KRGPKSIGE 50

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 44  CWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGE 103
           C  C+ RK+KCD   P+C +C+ S   C  Y+++     P R +K         RD    
Sbjct: 15  CLRCKQRKIKCDKLWPTCSKCKASSSIC-SYEVE-----PGRINKSPTIENAPHRDIRNI 68

Query: 104 QPA 106
            PA
Sbjct: 69  TPA 71

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 28  GSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
           G+ T       +    C  CR R+ KCDLG P C  C +  L C   D  LR
Sbjct: 54  GANTLTNGGSTRKRLACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLR 104

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 42 TGCWTCRLRKVKCDLGKPSCQRCEKSGL--DCGGYDIKLRWSNPIRFDK 88
          T C  C  + ++CDLG+P CQ C K G+   C   + K R   P +  K
Sbjct: 18 TACVFCHEKHLQCDLGRP-CQNCSKRGIGDTCRDKERKPRKRGPRKVKK 65

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 9   ASARCTPAARNDEALQKKEGSGTAVRRP-RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKS 67
           A+   +PAA    A Q   G+  +   P   +    C  CR +K +CD  +P C +C   
Sbjct: 46  ATGGASPAA----APQSTTGTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAV 101

Query: 68  GLDC 71
           G +C
Sbjct: 102 GFEC 105

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          R K    C  CR RK++CD  KP C  C+  G
Sbjct: 24 RRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRG 55

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +R    +  GC  C+    KCD  KP+C +C K  ++C
Sbjct: 11 KRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL-DCGGYDI 76
          +R  + K    C  CR RKV CD  +P C  C ++G  DC   D+
Sbjct: 3  IRGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYPDV 47

>Scas_659.10
          Length = 757

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRC 64
          + R K    C  CR RK+KCD  KP C +C
Sbjct: 12 KRRRKPIKSCAFCRGRKLKCDKNKPICNQC 41

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 26  KEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           K  +G      R +    C+ CR RK +CD G P C +C     +C
Sbjct: 57  KNNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTEC 101

>Scas_688.17
          Length = 769

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEK 66
          +    R+P+      C  CR RK+ CD G P C  C K
Sbjct: 4  NNIPTRKPKKNP--ACIQCRKRKIGCDRGHPKCGNCIK 39

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR RK +CD   PSC  C K+ + C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 20 DEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLR 79
          +E  +++  +G + +R        C  CR R+ KCDL  P C  C +  L+C   D  LR
Sbjct: 29 EEPAERESYTGVSKKR------LACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLR 81

>Kwal_27.10232
          Length = 1209

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 43  GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
            C  CR +K +CD  +P C +C   G +C   D   R + P
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 12/75 (16%)

Query: 32 AVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP-------- 83
           + R + +    C  CR +K+KCD  +P C  C K G +C   D   R   P        
Sbjct: 17 VLTRTKKRHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGYTDLLE 75

Query: 84 ---IRFDKFGNQMAG 95
             ++  K  N++AG
Sbjct: 76 CEVVKLQKIVNEIAG 90

>Scas_715.3
          Length = 1115

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 39  KTFTGCWTCRLRKVKCDLGK---PSCQRCEKSGLDC 71
           +  T C  CR +K+KCD  +     C RC+K  L C
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC 136

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          + R +    C  C+ RK +CD GKP+C  C + G
Sbjct: 5  KKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLG 38

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 16  AARNDEALQKKEGSGTAVRRPRAKTFT-GCWTCRLRKVKCD----LGKPSCQRCEKSGLD 70
           +AR  E  +         ++PR K  T  C TCR  K +CD    +GK  C RC    LD
Sbjct: 43  SARAKERSETNSPKNNGNKKPRKKRKTFSCDTCRRVKTRCDFEPFIGK--CYRCNVLQLD 100

Query: 71  CG 72
           C 
Sbjct: 101 CS 102

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGY 74
          + R K    C  CR RK++CD  KP C  C    L    Y
Sbjct: 45 KKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQY 84

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 7/78 (8%)

Query: 9   ASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDL-------GKPSC 61
           AS    P     +++     + T   R R+K    C  CR +K+KCD           SC
Sbjct: 82  ASTVPEPDNTRRDSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSC 141

Query: 62  QRCEKSGLDCGGYDIKLR 79
             C K G  C    I L+
Sbjct: 142 TGCRKIGEKCSFERIPLK 159

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 39  KTFTGCWTCRLRKVKCDLGK---PSCQRCEKSGLDC 71
           +  T C  CR  K+KCD  +     C RC K+G  C
Sbjct: 82  RPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 23 LQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          L+     G  +R+ + ++   C  CR R VKC  G P C +C  + + C
Sbjct: 27 LEDLHDEGGQLRKRQKRSSMACVRCRRRHVKCPGGNP-CSKCIAANIAC 74

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 20/42 (47%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          ++ R      C  C+ R+ +CD G P C  C  +G+ C   D
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIK 77
          R K    C +CR RK+KC+  KP C  C   G +C   D K
Sbjct: 24 RTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAK 63

>Kwal_23.6537
          Length = 552

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDI 76
          R  R +    C  CR RK KCD G P C  C   G +C   D+
Sbjct: 10 RNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51

>KLLA0A01298g complement(117215..117769) highly similar to sp|P40029
           Saccharomyces cerevisiae YER042w MXR1 responsible for
           the reduction of methionine sulfoxide singleton, start
           by similarity
          Length = 184

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 822 CTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKC 866
            T  S  L++   T +L+ F  G +WG + I L+ +  ++ DGK 
Sbjct: 2   ATGISKTLKYNAQTDKLITFAAGCFWGTQHIFLKHFGDKIIDGKV 46

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 32 AVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          A+RR R +    C  C+ RK KCD  KP+C  C + G
Sbjct: 2  ALRR-RNRPTVVCSNCKRRKSKCDKQKPACSNCVRLG 37

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 13  CTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCG 72
           C  A  +  A +    + T +R+  +K    C  CR +K++C+ G+  C  CEK  L C 
Sbjct: 53  CAAALTHRFAPEAMTETKTVMRKRVSK---ACDICRAKKIRCN-GEEPCVNCEKFNLGCT 108

Query: 73  -GYDIKLRWSNPIR 85
             + IK R + P R
Sbjct: 109 YTHVIKRRQAAPTR 122

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 30 GTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNP 83
           TA+   R +    C  CR RK KC+ GK  C+ C   G  C   D ++  ++P
Sbjct: 6  STALPHKRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYIDGRVPSASP 58

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 44 CWTCRLRKVKCDLGKPSCQRC-EKSGLDCGGYD 75
          C  C+ RKVKCD   P+CQ C E++  +   YD
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNVTELCEYD 47

>Kwal_47.17506
          Length = 924

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 32 AVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           V++ R+K    C  CR RK+KC   +P C  C+    +C
Sbjct: 7  VVKKKRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 44 CWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          C  C+ RK +CD   PSC  C K+G+ C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 43  GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
            C  CR +K KC    P+C  C K  LDC
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDC 122

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++ + ++   C +CR R +KC  G P CQ+C  S   C
Sbjct: 24 QKRQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAIC 60

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  C+ RK KC  G P CQ C K+ + C
Sbjct: 35 ACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
          with similarity to transcription factors, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 31 TAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          + +++ R    T C  C  + ++CD+G+P CQ C K  +
Sbjct: 7  SELKQTRKSIQTACEFCHTKHIQCDVGRP-CQNCLKRNI 44

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR R +KC  G P C +C K+G+ C
Sbjct: 45 ACTRCRRRHIKCPGGNP-CSKCLKAGVAC 72

>KLLA0D15356g 1301848..1303722 no similarity, hypothetical start
          Length = 624

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 28 GSGTAVRRPRA--KTFTGCWTCRLRKVKC--DLGKPSCQRCEKSGLDC 71
          G G   +R RA  +T T C +C   K KC  +  +  CQ CE  G++C
Sbjct: 22 GDGRGKKRARASGRTPTSCRSCAKSKKKCTRESDRGPCQLCENRGIEC 69

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 4  DEKDTASARCTPAARND------EALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLG 57
          +E +T S   + + +N       + +     +  A+++ R K    C  CR +K+KCD  
Sbjct: 2  NELNTVSTNSSDSTKNGGTSNSPDDMDSAAAASHAIKK-RTKASRACDQCRKKKIKCDYK 60

Query: 58 --KPSCQRCEKSGLDCGGYDIKLR 79
            K  C  C+++G  C    + L+
Sbjct: 61 DEKGVCSNCQRNGDRCSFDRVPLK 84

>Scas_657.3
          Length = 856

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (60%)

Query: 42 TGCWTCRLRKVKCDLGKPSCQRC 64
          T C  CR RK+KCD  +P C  C
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTC 65

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  C+ RK KCD  KP C+RC K  + C
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKC 29

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +  R+K  T C  CR RK+KC  GK  C  C      C
Sbjct: 5  KSTRSKVSTACVNCRKRKIKCT-GKYPCTNCISYDCTC 41

>Kwal_26.8109
          Length = 970

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 35 RPRAKTFTGCWTCRLRKVKCDLG--KPSCQRCEKSGLDC 71
          R R+KT   C  CR +K +CD     P C  C++    C
Sbjct: 30 RRRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTC 68

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
          complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +RP  +    C  CR R V+C  G P C +C  + + C
Sbjct: 51 KRPAKRAPLACLRCRRRHVRCPGGTP-CAKCAVANIAC 87

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
           (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 5/68 (7%)

Query: 37  RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGE 96
           R      C +CR RK+KC    P C +C +    C  Y  K+R S   R     +    E
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRSPLTR----AHLTEVE 56

Query: 97  DRDGDGEQ 104
            R G  EQ
Sbjct: 57  TRLGQMEQ 64

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 17/38 (44%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R  R      C  CR  K KC    P+C  C+K+G  C
Sbjct: 12 RSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHC 49

>KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029
          Candida albicans unknown function, hypothetical start
          Length = 771

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 44 CWTCRLRKVKCDLGKP-SCQRCEKSGLDC 71
          C +C+L KVKC+  +   C+RC K G+ C
Sbjct: 12 CISCKLSKVKCEYTEALPCKRCLKLGIHC 40

>Kwal_23.3514
          Length = 579

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 38 AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          +KT T C  C  RKVKCD   P C  C K G
Sbjct: 6  SKTRTPCVVCTKRKVKCDRNIP-CSNCVKRG 35

>KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces
          cerevisiae YDR520c, hypothetical start
          Length = 636

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 27 EGSGTAVR-RPRAKTFTGCWTCRLRKVKCDLGKPS---CQRCEKSGLDCG 72
          E   T +R R + KT++ C  CR  K +CD  +PS   C RC    LDC 
Sbjct: 4  EEKQTTIRPRKKRKTYS-CELCRKFKTRCDF-EPSEGKCYRCRMLNLDCS 51

>Kwal_26.7448
          Length = 714

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 34  RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCE 65
           RR    +  GC  C+ R++KCD   P C  C+
Sbjct: 85  RRRHRNSRLGCDECKRRRIKCDETLPECNNCK 116

>Scas_637.7
          Length = 998

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%)

Query: 31  TAVRRPRAKTFTGCWTCRLRKVKCDLGKPS---CQRCEKSGLDC 71
           T +   + +    C  CR RK+KCD   PS   C  C K   +C
Sbjct: 93  TKITSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANC 136

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 44 CWTCRLRKVKCDLGKPSCQRC 64
          C  CR RK+KCD  +P C  C
Sbjct: 40 CAFCRRRKLKCDNARPMCSTC 60

>Kwal_8.580
          Length = 638

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 17/76 (22%)

Query: 43  GCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDG 102
            C  CRLRK KC    P C+ C  +G       IK  +S           +A + R  + 
Sbjct: 16  ACDNCRLRKAKCSGDLPVCRNCSTAG------TIKCTYS-----------LADKRRKTNK 58

Query: 103 EQPAQPFQRRNIMFVR 118
           +  A+  +R +   VR
Sbjct: 59  DSKARSLERDHCFLVR 74

>Kwal_14.819
          Length = 568

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 40 TFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          +   C  CR RKV+C    P C+ C K   +C
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 43 GCWTCRLRKVKCDLGKPS---CQRCEKSGLDC 71
           C  CR +K KCD    +   C RC+K G+ C
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>Scas_669.8
          Length = 637

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLD 70
          R KT   C  C+ RKVKCD   P C  C + GL+
Sbjct: 9  RRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGLE 41

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 8/45 (17%)

Query: 35 RPRAKTFTGCWTCRLRKVKCD--------LGKPSCQRCEKSGLDC 71
          R R      C  CR RK+KCD         G   C  C +S L+C
Sbjct: 18 RKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLEC 62

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 29 SGTAVRRP-RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          +GT   +P + +    C  CR RKV+C  G   C+ C+ +  +C  YD
Sbjct: 31 AGTNELKPTKGRAHRACIACRKRKVRCS-GNIPCRLCQTNSYEC-KYD 76

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++  R +    C  CR +KVKCD GK  C  C     +C
Sbjct: 3  LQNKRRRVTRACDECRKKKVKCD-GKQPCIHCTVYNYEC 40

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 34 RRPRAK-TFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          ++P+ + +  GC  C+   +KCD  +P C  C K  + C
Sbjct: 50 KKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>Scas_680.25
          Length = 738

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 14/29 (48%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR  K KC    PSC  CEK+   C
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATC 43

>YBR123C (TFC1) [311] chr2 complement(484698..486647) RNA polymerase
           III transcription initiation factor TFIIIC (tau), 95 kDa
           subunit [1950 bp, 649 aa]
          Length = 649

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 723 CVKIEQRLLSWKPEWIFWKDDSKAEFINDTVEGVYHHTMSFYYGLLIYYFTMA 775
           C+KI + L + +P W+          ++  V    HHTM     L+ Y FTM 
Sbjct: 318 CLKILRELFARRPIWV-------KRHLDGIVPKKIHHTMKIALALISYRFTMG 363

>Scas_234.1
          Length = 337

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 37 RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          R +    C  C+ RK KCD G+P C  C + G
Sbjct: 26 RNRPTVVCTNCKKRKSKCDRGRP-CSTCARLG 56

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
          [1449 bp, 482 aa]
          Length = 482

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGL 69
          R+P ++    C  C  + ++CD+G+P CQ CEK  +
Sbjct: 13 RKPISR---ACVFCHEKHLQCDVGRP-CQNCEKRNI 44

>Kwal_33.13934
          Length = 797

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 18/41 (43%)

Query: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSG 68
          G      + R +    C  C+ RK KCD  KP C  C + G
Sbjct: 7  GENELRTKKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLG 47

>Kwal_33.15184
          Length = 953

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 67/165 (40%), Gaps = 28/165 (16%)

Query: 438 PWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHL-QSKFPKNSKEMKYFVSL 496
           P K I+F R +    ++G+L   +     L   LL   C  L + +  +  K+M+    L
Sbjct: 334 PTKAIFFRRILLKYQDVGSLQEKAQ---FLRKLLLTSPCLQLWKERLEEREKKMRRLQQL 390

Query: 497 GMDFRNQASGFLNACLSSTSRQEHYKDVLT-AILSMNSIDV------VW----GTMSDCQ 545
            + FR + +      +    R  H+K+  + A+ S+N   +      +W       S  Q
Sbjct: 391 ELTFRQKLA------MKVIKRAIHWKERESSAVSSINHTLLRHFFLDIWLERLKERSQLQ 444

Query: 546 YHLTICEE-------FIESRMKSRPLLSEKARCLHRIFSFLKLIQ 583
            HL + +        FI  R  S    +EK  C + +F   KLI+
Sbjct: 445 SHLIVTQSRMCNKFFFIWERQFSINARAEKVYCKNLLFKHFKLIK 489

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRC 64
           C  CR RK+KCD  KP C RC
Sbjct: 15 ACTVCRKRKLKCDGNKP-CGRC 35

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
           C  CR  K KC    P+C+ C ++G +C
Sbjct: 23 SCSRCRRLKKKCSKELPACRNCSRAGEEC 51

>Kwal_47.18089
          Length = 745

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 43 GCWTCRLRKVKCDLGKPSCQRCEKSGL 69
           C  CR RK+KCD  +P C  C    L
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKL 54

>Sklu_2082.1 YER184C, Contig c2082 2025-2273
          Length = 82

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 3/47 (6%)

Query: 29 SGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYD 75
          SG   R+P  K    C  CR RK+KC  G  SC  C   G  C GYD
Sbjct: 2  SGKRKRQP-YKVSKACNECRKRKIKC-TGTFSCSSCVIYGSKC-GYD 45

>AER291C [2793] [Homologous to ScYHR178W (STB5) - SH]
          (1172383..1174374) [1992 bp, 663 aa]
          Length = 663

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 18 RNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          R+D+ LQ  E SG    + R +T++ C  CR  K KC    P C  CE +  +C
Sbjct: 3  RSDD-LQDAEDSG----QQRYETYS-CSRCRRLKKKCSKELPRCFSCEAASKEC 50

>YLR152C (YLR152C) [3561] chr12 complement(442959..444689) Member of
           the auxin efflux carrier family, has moderate similarity
           to uncharacterized C. albicans Orf6.6420p [1731 bp, 576
           aa]
          Length = 576

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 13/105 (12%)

Query: 337 NNQGTDCNSSTG--------YKGLSGVHTPYTVDNVAIHGPESRMPASAIESVPSIVPDP 388
           +N    CNS T         Y+G +G   PY   N A H  ES +P + I  V S    P
Sbjct: 216 SNSDLSCNSITTNEMTPQAFYEGFTGYIKPYKESNGASHKFESDLPHAEIYRVSSTYSSP 275

Query: 389 TIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVA 433
                +    S +   R+     G      SY ++  AD+  +++
Sbjct: 276 GALEFSRIDGSSLSYSRISKNSDG-----RSYRRKRKADMNELIS 315

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 33 VRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          V +  +K    C  CR RK+KC  GK  C  C+     C
Sbjct: 17 VTKSSSKVSRACDNCRRRKIKCT-GKQPCSNCQAYQCHC 54

>YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong
          similarity to the MAL regulatory proteins Mal63p,
          Mal33p, and Mal23p, contains an N-terminal Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [1398 bp, 465 aa]
          Length = 465

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 38 AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71
          A+    C  C +R+VKCD  KP C+ C +  L C
Sbjct: 2  ARNRQACDCCCIRRVKCDRKKP-CKCCLQHNLQC 34

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 39 KTFTGCWTCRLRKVKCDLG--KPS-CQRCEKSGLDCG-GYDIKLRWSNPIR 85
          K    C  CR  KVKCD    +P  C  C K GL C   Y +  R S+ ++
Sbjct: 3  KPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDYVVPPRRSDELK 53

>Scas_703.4
          Length = 609

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 292 GITADTAPPKSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRLLLNNQGTDC 343
           G+   + PP+S SS+ P    PL  A T  PP+ + V K+Y +L  N   D 
Sbjct: 22  GLPPHSIPPES-SSMSPTSNTPLLPAQTGRPPANEFVRKLYTILEKNAYPDI 72

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,659,459
Number of extensions: 1039101
Number of successful extensions: 2705
Number of sequences better than 10.0: 231
Number of HSP's gapped: 2721
Number of HSP's successfully gapped: 239
Length of query: 867
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 757
Effective length of database: 12,788,129
Effective search space: 9680613653
Effective search space used: 9680613653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)