Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL174C75674236970.0
Kwal_33.1520077376327770.0
KLLA0F12892g77577627590.0
CAGL0D05808g77678726300.0
YLL001W (DNM1)75776126080.0
Scas_690.2075576424930.0
YKR001C (VPS1)70475714050.0
Scas_668.2872276913790.0
Sklu_2326.469054113581e-179
Kwal_26.792469154113501e-177
CAGL0L02299g70054313471e-177
ABL001W68555613411e-176
KLLA0B13277g68454512731e-166
ACR164C8682474442e-45
Kwal_26.86138612454414e-45
KLLA0D06721g8833184396e-45
CAGL0L02783g8912484343e-44
Scas_605.178912454272e-43
Sklu_1555.28842504263e-43
YOR211C (MGM1)9022554263e-43
YOR165W (SEY1)77628770.44
AGR264C79128750.73
Sklu_2179.478234750.79
Sklu_2434.1157767740.92
CAGL0M12859g94165721.8
Scas_628.251406144722.0
YEL043W956154703.3
CAGL0M12276g64969684.7
CAGL0G07381g50552675.3
Sklu_2412.71127108668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL174C
         (742 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1428   0.0  
Kwal_33.15200                                                        1074   0.0  
KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1067   0.0  
CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1017   0.0  
YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1009   0.0  
Scas_690.20                                                           964   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   545   0.0  
Scas_668.28                                                           535   0.0  
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           527   e-179
Kwal_26.7924                                                          524   e-177
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   523   e-177
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   521   e-176
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   494   e-166
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   175   2e-45
Kwal_26.8613                                                          174   4e-45
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   173   6e-45
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   171   3e-44
Scas_605.17                                                           169   2e-43
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         168   3e-43
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   168   3e-43
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    34   0.44 
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    33   0.73 
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         33   0.79 
Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement      33   0.92 
CAGL0M12859g 1268191..1271016 highly similar to sp|P32565 Saccha...    32   1.8  
Scas_628.25                                                            32   2.0  
YEL043W (YEL043W) [1384] chr5 (70478..73348) Protein of unknown ...    32   3.3  
CAGL0M12276g 1223585..1225534 highly similar to sp|P39722 Saccha...    31   4.7  
CAGL0G07381g 698805..700322 similar to sp|P06778 Saccharomyces c...    30   5.3  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          30   8.5  

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1428 bits (3697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/742 (94%), Positives = 703/742 (94%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDF 120
           VTRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDF
Sbjct: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDF 120

Query: 121 TEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIER 180
           TEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIER
Sbjct: 121 TEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIER 180

Query: 181 QIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGT 240
           QIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGT
Sbjct: 181 QIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGT 240

Query: 241 NAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKCGT 300
           NAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKCGT
Sbjct: 241 NAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKCGT 300

Query: 301 RFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQMMN 360
           RFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQMMN
Sbjct: 301 RFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQMMN 360

Query: 361 KFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAIRN 420
           KFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAIRN
Sbjct: 361 KFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAIRN 420

Query: 421 STGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGSPALARYPRLQ 480
           STGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGSPALARYPRLQ
Sbjct: 421 STGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGSPALARYPRLQ 480

Query: 481 AKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQKQQN 540
           AKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQKQQN
Sbjct: 481 AKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQKQQN 540

Query: 541 AKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVXXXXXXXXXXXXXXXXRDPKQNKDSFL 600
           AKRSADLKKKRQQELEKAAAVGEPTNGNPSPKV                RDPKQNKDSFL
Sbjct: 541 AKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVDSDSTITSSDSEGEDERDPKQNKDSFL 600

Query: 601 NYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEADFMAMETLKIQDTVAAPVXXXXXX 660
           NYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEADFMAMETLKIQDTVAAPV      
Sbjct: 601 NYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEADFMAMETLKIQDTVAAPVEAEHPE 660

Query: 661 XXXXXXXXXXXXXXXXXSYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESL 720
                            SYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESL
Sbjct: 661 LTEREELECELIRRLIISYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESL 720

Query: 721 FEELLMEDETLAQDRAKCIKLL 742
           FEELLMEDETLAQDRAKCIKLL
Sbjct: 721 FEELLMEDETLAQDRAKCIKLL 742

>Kwal_33.15200
          Length = 773

 Score = 1074 bits (2777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/763 (71%), Positives = 607/763 (79%), Gaps = 25/763 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDAGID+LDLPVLAVIGSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEP----------TLENRLRGQSG----ARDTW 106
           VTRRPLVLQLNNI  DSPLI  Y  E   P          TLE+ LR   G     +D W
Sbjct: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120

Query: 107 GEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGI 166
           GEFLHLPGRRFY+F +IR EIENETARIAGKNKGISRIPINLK++SP VLNLTL+DLPGI
Sbjct: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180

Query: 167 TKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 226
           TKVPIGEQP DIE+QI+NLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT
Sbjct: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240

Query: 227 IGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFS 286
           IGV+TK+DLMDSGTNA DIL+GKLYPLRLGFVG+VNRSQQDIQ N++VE+AL  EE FFS
Sbjct: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300

Query: 287 KHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNII 346
           +HP YRTIS++CGTR+LAK LNQIL+NHIR+KLPDIKARLNTL+GQTEQEL +YGG  II
Sbjct: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360

Query: 347 SPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPT 406
           + E+RAGLVLQ+MNKFA  F+SSIEGTSSDISTKELCGGARIYYIYN+IFG+SL+SINPT
Sbjct: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420

Query: 407 ANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICH 466
           ANLS  DIRTAIRNSTGPRPSLFVPELAFDLLVKPQI LLL+PSQRCVELVYEELMKICH
Sbjct: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480

Query: 467 NCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEA 526
           NCGSP LARYP+LQAKLIEVVS+LLRERLGPTRSYVESLIDIHRA+INTNHPNFLSATEA
Sbjct: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540

Query: 527 MADIAEARRQKQQ-NAKRSADLKKKR---QQELEKAAAVGEPTNGNPSPKVXXXXXXXXX 582
           M+DIAEA+R  Q+ + K++ DL++ +     +  K        N +              
Sbjct: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600

Query: 583 XXXXXXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQ---EADFM 639
                     KQ+KDSFLNYFFGKDQQ          FSD  + +  + ++Q   +    
Sbjct: 601 SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGN---YKGFSDNSQFSNFNRYEQTEHQKHLA 657

Query: 640 AMETLKIQDTVAAPVXXXXXXXXXXXXXXXXXXXXXXXSYFGIVREMVEDQIPKAVMCFL 699
             E LKI D V                           SYFGIVREM++DQIPKAVMC L
Sbjct: 658 NFENLKISDPVVEE-RNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLL 716

Query: 700 VNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           VNF KE +QNRLV+KLYKESLFE+LLMED+ LAQDR KC+KLL
Sbjct: 717 VNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLL 759

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/776 (69%), Positives = 607/776 (78%), Gaps = 49/776 (6%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLITAY----------------TAEEAEPTLENRLRGQSG--- 101
           VTRRPLVLQLNNI  +SPL+  Y                   E E TLE+ LR  S    
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120

Query: 102 -ARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTL 160
             ++ WGEFLH+PGRRFYDF+EIR EIENETARIAGK KGISRIPINLKIYSPHVLNLTL
Sbjct: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180

Query: 161 IDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVD 220
           +DLPGITKVPIGEQPPDIERQI NLILEYVAKPNCIILA+SPANVDLVNSESLKLAR++D
Sbjct: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240

Query: 221 PHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAR 280
           PHGKRTIGV+TKLDLMD GTNA DIL+GKLYPL+LGFVGVVNRSQQDIQ+NKSVE+AL  
Sbjct: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300

Query: 281 EEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASY 340
           EE+FF+KHP YRTIS++CGTR+LAK LNQ+L+NHIR+KLPDIKARLNTLIGQTEQELA+Y
Sbjct: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360

Query: 341 GGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSL 400
           G   +I+ E+RAGLVLQ+MNKFAT F+SSI+GTSS+ISTKELCGGARIYYIYN +FG SL
Sbjct: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420

Query: 401 KSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEE 460
             INPT+NLS+TDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI+LLLDPSQRCVELVYEE
Sbjct: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480

Query: 461 LMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNF 520
           LMKICHNCGSP LARYP+LQ+KL+EVVS+LLRERLGPTRSYVESLIDIH+A+INTNHPNF
Sbjct: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540

Query: 521 LSATEAMADIAEARRQKQQNAKRSADLKKKR---------QQELEKAAAVGEPTNGNPSP 571
            SATEAMA+I EAR+ K+Q  +    L+K+R         QQ+ E+     +  +     
Sbjct: 541 PSATEAMAEIVEARKNKKQTER----LQKQREYEKQLLLEQQQAEREMKKSDSVDETEQD 596

Query: 572 KVXXXXXXXXXXXXXXXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSF 631
                              D KQ+KDSFLNYFFGK+Q+         S + K    +D  
Sbjct: 597 LKLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQK---------SSNTKLSSRID-- 645

Query: 632 FQQEADFMAMETLKIQD-----TVAAPVXXXXXXXXXXXXXXXXXXXXXXXSYFGIVREM 686
           +    +   +E L+IQD       A                          SYF IVREM
Sbjct: 646 YNGSDNSYDIENLQIQDFKDKSADAHTKSEAATEFTEREELECELIRRLIVSYFSIVREM 705

Query: 687 VEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           +EDQ+PKAVMC LVN+ KE VQNRLV+KLYKESLF+ELLMED+TLAQDR KC+ LL
Sbjct: 706 IEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLL 761

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/787 (65%), Positives = 605/787 (76%), Gaps = 70/787 (8%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLI--------TAYTAEEAEPTLE------------NRLRGQS 100
           VTRRPLVLQLNNI A SPLI        +   A  ++ +L             N   G S
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120

Query: 101 GA----------RDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKI 150
            A          RD WGEFLH+PGRRFYDF+EIR EIE+ETARIAGKNKGIS+IPINLKI
Sbjct: 121 SAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLKI 180

Query: 151 YSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNS 210
           YSPHVLNLTL+DLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNCIILAVSPANVDLVNS
Sbjct: 181 YSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVNS 240

Query: 211 ESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQE 270
           ESLKLAR+VDPHG RTIGV+TKLDLMDSGTNA DIL+GKLYPL+LGFVGVVNRSQQDIQ 
Sbjct: 241 ESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQM 300

Query: 271 NKSVEDALAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLI 330
           NK+VE+AL +EEE+F++HP YRT+S +CGTR+LAK LNQ L++HI+EKLPDIK RLNTLI
Sbjct: 301 NKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTLI 360

Query: 331 GQTEQELASYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYY 390
            QTEQEL+ YG +  I+ E+RAGLVLQ+MNKFAT F+SSI+GTSS+ISTKEL GGARIYY
Sbjct: 361 SQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIYY 420

Query: 391 IYNNIFGNSLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPS 450
           IYNNIFGN+LKSI+PT NL+I DIRTAIRNSTGPRP+LFVPELAFDLLVKPQIKLLL+PS
Sbjct: 421 IYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS 480

Query: 451 QRCVELVYEELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHR 510
           Q+CVELVYEEL+KICH CG+P L+RYP+L++KLIEVVSDLLRERL PTRSYVESLIDIHR
Sbjct: 481 QQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIHR 540

Query: 511 AFINTNHPNFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPS 570
           A+INTNHPNFL+AT+AM+DI ++R++ Q+N +    L+K++Q E+++     + +  +  
Sbjct: 541 AYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDIE 600

Query: 571 PKVXXXXXXXXXXXXXXXXRDPKQNKDSFLNYFFGKDQQ------RKDG---------DD 615
           P +                +D  ++KD+FLNYFFGKD++       +DG         DD
Sbjct: 601 PSI--------DGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRDGRFSELNGYKDD 652

Query: 616 IAPSFSDKQERTMDSFFQQEADFMAMETLKIQDTVAAPVXXXXXXXXXXXXXXXXXXXXX 675
            +  F   Q+   +S    + D  A E                                 
Sbjct: 653 FSSQF---QQLNFNSNLNSDDD--AFEN------------ANHPKLTEREDLECELIRRL 695

Query: 676 XXSYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDR 735
             SYF IVREM+EDQIPKA+MC LVNFCK+ VQNRLV++LY+ES+FEELL+ED+TL QDR
Sbjct: 696 IVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDR 755

Query: 736 AKCIKLL 742
              +K L
Sbjct: 756 ENALKSL 762

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/761 (66%), Positives = 593/761 (77%), Gaps = 37/761 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLI-------------TAYTAEEA-EPTLENRLRGQSGARDTW 106
           VTRRPLVLQLNNI  +SPLI             T  +  EA    LE R + ++ A D W
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHA-DEW 119

Query: 107 GEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGI 166
           GEFLH+PG+RFYDF +I+ EIENETARIAGK+KGIS+IPINLK++SPHVLNLTL+DLPGI
Sbjct: 120 GEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGI 179

Query: 167 TKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 226
           TKVPIGEQPPDIE+QI+NLIL+Y+A PNC+ILAVSPANVDLVNSESLKLAR+VDP GKRT
Sbjct: 180 TKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRT 239

Query: 227 IGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFS 286
           IGV+TKLDLMDSGTNA DIL+GK+YPL+LGFVGVVNRSQQDIQ NK+VE++L +EE++F 
Sbjct: 240 IGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFR 299

Query: 287 KHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNII 346
           KHP YRTIS+KCGTR+LAK LNQ LL+HIR+KLPDIK +LNTLI QTEQELA YGG    
Sbjct: 300 KHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGAT 359

Query: 347 SPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPT 406
           + ESRA LVLQ+MNKF+TNF+SSI+GTSSDI+TKELCGGARIYYIYNN+FGNSLKSI+PT
Sbjct: 360 TNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPT 419

Query: 407 ANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICH 466
           +NLS+ D+RTAIRNSTGPRP+LFVPELAFDLLVKPQIKLLL+PSQRCVELVYEELMKICH
Sbjct: 420 SNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICH 479

Query: 467 NCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEA 526
            CGS  LARYP+L++ LIEV+S+LLRERL PTRSYVESLIDIHRA+INTNHPNFLSATEA
Sbjct: 480 KCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEA 539

Query: 527 MADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVXXXXXXXXXXXXX 586
           M DI + RR      KR+ +L K +  + E     G     + S  +             
Sbjct: 540 MDDIMKTRR------KRNQELLKSKLSQQENGQTNGINGTSSISSNIDQDSAKNSDYDDD 593

Query: 587 XXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSF--SDKQERTMDSFFQQEADFMAMETL 644
               + KQ KD FLNYFFGKD++ +      P F  SDK+          + +      L
Sbjct: 594 GIDAESKQTKDKFLNYFFGKDKKGQ------PVFDASDKKRS-----IAGDGNIEDFRNL 642

Query: 645 KIQDTVAAPVXXXXXXX---XXXXXXXXXXXXXXXXSYFGIVREMVEDQIPKAVMCFLVN 701
           +I D     +                          SYF I+REM+EDQ+PKAVMC LVN
Sbjct: 643 QISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVN 702

Query: 702 FCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           +CK+ VQNRLV+KLYKE+LFEELL+ED+TLAQDR  C+K L
Sbjct: 703 YCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743

>Scas_690.20
          Length = 755

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/764 (62%), Positives = 582/764 (76%), Gaps = 45/764 (5%)

Query: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY +GID+LDLP+LAV+GSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIKADSPLITAYTAEEAEPT------------------LENRLRGQSG- 101
           VTRRPLVLQLNN+  DS         +A P                   +E+ + GQ+  
Sbjct: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120

Query: 102 ---ARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNL 158
               R  WGEFLH+PGRRFYDF EIR EIENETAR+AGKNKGIS++PINLKI+SPHVLNL
Sbjct: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180

Query: 159 TLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARD 218
           TL+DLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNC+ILAVSPANVDLVNSESLKLAR+
Sbjct: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240

Query: 219 VDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDAL 278
           VDP GKRTIGV+TKLDLMDSGTNA DIL+GKLYPL+ GFVG+VNRSQQDIQ NKSV++AL
Sbjct: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300

Query: 279 AREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELA 338
             EEE+F +HP YRTIS+KCGTR+LAK LN+IL+NHI++KLPDIK +LNTL+ QTEQEL 
Sbjct: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360

Query: 339 SYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGN 398
           SYGGS + + E+RA L+LQ+MNKFAT+F+SSIEG SSDI+TKELCGGARIYYIYNN+FG 
Sbjct: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420

Query: 399 SLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVY 458
           SLKSI+PT NL+  DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLL+PSQRCVELVY
Sbjct: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480

Query: 459 EELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHP 518
           EELMKICH CGSP L RYPRL++ LIEVV DLL+ERL PTR YVESLIDIH+A+INTNHP
Sbjct: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540

Query: 519 NFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVXXXXX 578
           +FL ATEA +DI ++ ++++    ++ ++  +++   +++++  E    +    +     
Sbjct: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDRSSSSEETGYIDGKNNI----- 595

Query: 579 XXXXXXXXXXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEADF 638
                      ++  ++K  F + FF  ++Q   G+      ++    T+     ++ + 
Sbjct: 596 ----------SKEADESKALFFDNFFATEKQDSSGN-----LANTSHDTL--VINEDLNG 638

Query: 639 MAMETLKIQDTVAAPVXXXXXXXXXXXXXXXXXXXXXXXSYFGIVREMVEDQIPKAVMCF 698
             +  L I +  +                          SYFGI+REM+EDQIPKA+M F
Sbjct: 639 SLLGNLHITEN-SQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFF 697

Query: 699 LVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           LVN+CKE VQNRLV+KLYKES+ EELL+ED+T+AQDRA C +LL
Sbjct: 698 LVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLL 741

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/757 (40%), Positives = 440/757 (58%), Gaps = 87/757 (11%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN---IKADSPLITAYTAEEAEPTL--ENRLRGQSGA----------RDTW 106
           TRRPLVLQL N    K++   +     E  +  +  +++ + +SG           ++ W
Sbjct: 63  TRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEW 122

Query: 107 GEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGI 166
           GEFLHLPG++FY+F EIR EI  ET ++ G N GIS +PINL+IYSPHVL LTL+DLPG+
Sbjct: 123 GEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGL 182

Query: 167 TKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 226
           TKVP+G+QPPDIERQI++++L+Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RT
Sbjct: 183 TKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRT 242

Query: 227 IGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFS 286
           IGV+TK+DLMD GT+  DILAG++ PLR G++ V+NR Q+DI+  K++ +AL  E +FF 
Sbjct: 243 IGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFE 302

Query: 287 KHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNII 346
            HP+Y + +  CGT +LAKKLN ILL+HIR+ LP+IKA++   + + + EL + G   + 
Sbjct: 303 NHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLGPETM- 361

Query: 347 SPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPT 406
             +S + +VL M+  F+  +   ++G + ++S++EL GGARI Y+++  F N + S++P 
Sbjct: 362 --DSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPF 419

Query: 407 ANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICH 466
             +  +DIRT + NS+G  PSLFV   AF++LVK QI+   +PS R V LV++EL+++  
Sbjct: 420 DQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLK 479

Query: 467 NCGS-PALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATE 525
              S P  +RYP L+  +       L++   PT  +V  +I   + +INT HP+ L  ++
Sbjct: 480 QIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGSQ 539

Query: 526 AMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVXXXXXXXXXXXX 585
           AM  + E    +Q                     AV +P  G P P              
Sbjct: 540 AMVMVEEKLHPRQ--------------------VAV-DPKTGKPLPTQPSSSKAPVM--- 575

Query: 586 XXXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQEADFMAMETLK 645
                   + K  F   FF    ++K     +P    K    M      E + M  E +K
Sbjct: 576 --------EEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQM-----TERETMETEVIK 622

Query: 646 IQDTVAAPVXXXXXXXXXXXXXXXXXXXXXXXSYFGIVREMVEDQIPKAVMCFLVNFCKE 705
           +                               SYF IV+  + D IPKA+M  L+   K 
Sbjct: 623 L----------------------------LISSYFSIVKRTIADIIPKALMLKLIVKSKT 654

Query: 706 EVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           ++Q  L+ KLY +   EEL  E++   Q R +C K++
Sbjct: 655 DIQKVLLEKLYGKQDIEELTKENDITIQRRKECKKMV 691

>Scas_668.28
          Length = 722

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/769 (39%), Positives = 435/769 (56%), Gaps = 93/769 (12%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIKADSPLITAYTA--------------------EEAEPTLENRLRGQSG 101
           TRRPLVLQL N ++      A  A                    ++  P  +   +G+ G
Sbjct: 63  TRRPLVLQLINRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDADKKEAPASDKTKKGEKG 122

Query: 102 AR-------DTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPH 154
           A        + WGEFLHLPG++F++F EIR EI  ET ++ G N GIS IPINL+IYSP+
Sbjct: 123 ATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIYSPY 182

Query: 155 VLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLK 214
           VL LTL+DLPG+TKVP+G+QPPDIE+QI+N++L+Y++KPN IIL+V+ AN DL NS+ LK
Sbjct: 183 VLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSDGLK 242

Query: 215 LARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSV 274
           LAR+VDP G RTIGV+TK+DLMD GT+  DILAG++ PLR G++ V+NR Q+DI+  K++
Sbjct: 243 LAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGKKTI 302

Query: 275 EDALAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTE 334
             AL  E+ FF +HP+Y + +  CGT +LAKKLN ILL+HIR+ LPDIKA++   + + +
Sbjct: 303 RSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLKKYQ 362

Query: 335 QELASYGGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNN 394
            EL S G   +   +S   +VL M+  F+  +   ++G + +++++EL GGARI ++++ 
Sbjct: 363 NELISLGPETM---DSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFVFHE 419

Query: 395 IFGNSLKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCV 454
           +F N + S++P   +  +DIRT + NS+G  PSLFV   AF++LVK QIK   +PS R V
Sbjct: 420 VFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSLRLV 479

Query: 455 ELVYEELMKICHNC-GSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFI 513
            LV++EL++I       P  ARYP L+  +     D L+E + PT  +V  +ID  + +I
Sbjct: 480 NLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQTYI 539

Query: 514 NTNHPNFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKV 573
           NT          A  D+ +  R      +R   L   RQ  L+       P  G P P+ 
Sbjct: 540 NT----------AHPDLLKGSRAMAMVEER---LHPPRQIALD-------PKTGKPLPQQ 579

Query: 574 XXXXXXXXXXXXXXXXRDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQ 633
                               ++K+ F   FF    ++K                      
Sbjct: 580 QQQQQNPSNDVLVS------EDKNGFFGGFFTTKNKKK---------------------- 611

Query: 634 QEADFMAMETLKIQDTVAAPVXXXXXXXXXXXXXXXXXXXXXXXSYFGIVREMVEDQIPK 693
                 A+E+         PV                       SYFGIV+  V D IPK
Sbjct: 612 ----LAALES-------PPPVLKATGQMTERETTETEVIKLLIESYFGIVKRTVADIIPK 660

Query: 694 AVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742
           A+M  L+   + ++Q  L+ KLY     ++L  E+E   Q R +C +++
Sbjct: 661 ALMLKLIVKSRTDIQKVLLEKLYSSGQLKDLTKENELTIQRRKECNRMV 709

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  527 bits (1358), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 267/541 (49%), Positives = 375/541 (69%), Gaps = 10/541 (1%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN--IKADSPLITAYTAEEAEPTLENRLRGQS-GARDTWGEFLHLPGRRFY 118
           TRRPLVLQL N   K DS L +A          +++ +GQS    + WGEFLH+PG++FY
Sbjct: 63  TRRPLVLQLINKRTKKDSTLQSAKNELLDLNVADDQKKGQSEDNAEEWGEFLHIPGKKFY 122

Query: 119 DFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDI 178
           +F +IR EI  ET +  GKN GIS IPINL+IYSPHVL LTL+DLPG+TKVP+G+QP DI
Sbjct: 123 NFDQIRQEIVIETEKTTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPADI 182

Query: 179 ERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDS 238
           E+QI++++L+Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RTIGV+TK+DLMD 
Sbjct: 183 EKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDH 242

Query: 239 GTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKC 298
           GT+  DILAG++ PLR G++ V+NR Q+DI+ +K++  AL  E++FF  HP+Y + +  C
Sbjct: 243 GTDVIDILAGRVIPLRYGYIPVINRGQKDIEAHKTIRAALEDEKKFFENHPSYSSKAHYC 302

Query: 299 GTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQM 358
           GT +LAKKLN ILL+HIR+ LP+IK ++   + + + EL S G   + SP S   +VL M
Sbjct: 303 GTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLKKYQAELLSLGPETMDSPNS---IVLSM 359

Query: 359 MNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAI 418
           +  F+  +   ++G + ++S++EL GGARI ++++ IF N + +++P   +  +DIRT +
Sbjct: 360 ITDFSKEYTGILDGEARELSSQELSGGARISFVFHEIFKNGVNALDPFDQIKDSDIRTIM 419

Query: 419 RNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGS-PALARYP 477
            NS+G  PSLFV   AF++LVK QI+   +PS R V LV++EL++I     S P  +RYP
Sbjct: 420 YNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSLRLVSLVFDELVRILKQIISHPKYSRYP 479

Query: 478 RLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQK 537
            L+  L       L+E + PT  +V  +I   + +INT HP+ L  ++AMA + E    +
Sbjct: 480 GLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQTYINTAHPDLLKGSQAMATVEEKLHPR 539

Query: 538 Q 538
           Q
Sbjct: 540 Q 540

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%)

Query: 678 SYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAK 737
           SYFGIV+  V D IPKA+M  L+   K ++Q  L+ KLY      EL  E++   Q R +
Sbjct: 613 SYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYGNQDIAELTKENDITIQRRKE 672

Query: 738 CIKLL 742
           C K++
Sbjct: 673 CHKMV 677

>Kwal_26.7924
          Length = 691

 Score =  524 bits (1350), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 267/541 (49%), Positives = 372/541 (68%), Gaps = 11/541 (2%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+G+QSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLR--GQSGAR-DTWGEFLHLPGRRFY 118
           TRRPLVLQL N K  S   T+ +++     L N+ +  GQS    D WGEFLHLPG++F+
Sbjct: 63  TRRPLVLQLVN-KRSSKGNTSQSSKNDLLELGNQEQKGGQSEDNVDEWGEFLHLPGKKFF 121

Query: 119 DFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDI 178
           +F EIR EI NET +  GKN GIS +PINLKI SPHVL LTL+DLPG+TKVP+G+QP DI
Sbjct: 122 NFDEIRQEIVNETEKTTGKNAGISPVPINLKICSPHVLTLTLVDLPGLTKVPVGDQPADI 181

Query: 179 ERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDS 238
           E+QI++++L Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RTIGV+TK+DLMD 
Sbjct: 182 EKQIKDMLLRYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQ 241

Query: 239 GTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKC 298
           GT+  DILAG++ PLR G++ V+NR Q+DI+  K++  AL  E  +F  HP+Y + +  C
Sbjct: 242 GTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRAALEDERRYFENHPSYSSKAHYC 301

Query: 299 GTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQM 358
           GT +LAKKLN ILL+HIR+ LPDIK ++   + + + EL S G   + SP S   ++L M
Sbjct: 302 GTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAELMSLGPETMDSPNS---IILSM 358

Query: 359 MNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAI 418
           +  F+  +   ++G + ++S++EL GGARI ++++ I+ N +++++P   +  +DIRT +
Sbjct: 359 ITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNGVRALDPFDQIKDSDIRTIM 418

Query: 419 RNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGS-PALARYP 477
            NS+G  PSLFV   AF++LVK QI    +PS R V LV++EL++I     S P   RYP
Sbjct: 419 YNSSGSAPSLFVGTQAFEVLVKQQINRFEEPSLRLVSLVFDELVRILKQIISQPKYGRYP 478

Query: 478 RLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQK 537
            L+  +       L+E + PT S+V  +I   + +INT HP+ L  ++AMA I E    +
Sbjct: 479 GLREAMSNYFIQFLKEAIIPTNSFVTDIIQAEQTYINTAHPDLLKGSQAMAMIEEKLHPR 538

Query: 538 Q 538
           Q
Sbjct: 539 Q 539

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%)

Query: 678 SYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAK 737
           SYF IV+  V D IPKAVM  L+   K ++Q  L+ KLY      EL  E++   Q R +
Sbjct: 614 SYFNIVKRTVADVIPKAVMLKLIVKSKNDIQKILLEKLYGNQDIAELTKENDITIQRRKE 673

Query: 738 CIKL 741
           C K+
Sbjct: 674 CHKM 677

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  523 bits (1347), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 263/543 (48%), Positives = 373/543 (68%), Gaps = 18/543 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN----------IKADSPLITAYTAEEAEPTLENRLRGQS-GARDTWGEFL 110
           TRRPLVLQL N           KA   L+     + ++       +GQS    + WGEFL
Sbjct: 63  TRRPLVLQLINRRSKKSDKEVQKASDQLLDLNMDDHSKKEDPAGKKGQSEDNAEEWGEFL 122

Query: 111 HLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVP 170
           HLP ++FY+F EIR EI  ET ++ G N GIS IPINL+IYSPHVL LTL+DLPG+TKVP
Sbjct: 123 HLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLRIYSPHVLTLTLVDLPGLTKVP 182

Query: 171 IGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVV 230
           +G+QPPDIE+QI++++L+Y++KPN IIL+V+ AN DL NS+ LKLAR+VDP G RTIGV+
Sbjct: 183 VGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVL 242

Query: 231 TKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPA 290
           TK+DLMD GT+  DILAG++ PLR G++ V+NR Q+DI+  K++  AL  E++FF +HP+
Sbjct: 243 TKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIRAALQDEKKFFEEHPS 302

Query: 291 YRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPES 350
           Y + +  CGT +LAKKLN ILL+HIR+ LPDIK ++ + + +   EL S G   +   +S
Sbjct: 303 YSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIESTLKKYVNELESLGPETM---DS 359

Query: 351 RAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLS 410
            + +VL M+  F+  +   ++G + +++++EL GGARI ++++ IF N + S++P   + 
Sbjct: 360 ASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARISFVFHEIFKNGVDSLDPFDQIK 419

Query: 411 ITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGS 470
            +DIRT + NS+G  PSLFV   AF++LVK QI+   +PS R V LV++EL+++     S
Sbjct: 420 DSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIIS 479

Query: 471 -PALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMAD 529
            P  ARYP L+  +     D L+E + PT  +V+ +I   + +INT HP+ L  ++AM+ 
Sbjct: 480 QPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKSEQTYINTAHPDLLKGSQAMSM 539

Query: 530 IAE 532
           + E
Sbjct: 540 VEE 542

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  521 bits (1341), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 268/556 (48%), Positives = 374/556 (67%), Gaps = 23/556 (4%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQLNNIK--------ADSPLITAYTAEEAEPTLENRLRGQS-GARDTWGEFLHL 112
           TRRPLVLQL N +        A   L+    A + +        GQS    + WGEFLH 
Sbjct: 63  TRRPLVLQLINRRGKKGDKRNAHGDLLELDVAADQK-------TGQSEDNAEEWGEFLHA 115

Query: 113 PGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIG 172
           PG++FY+F +IR EI NET ++ GKN GIS IPINL+IYSPHVL LTL+DLPG+TKVP+G
Sbjct: 116 PGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLTKVPVG 175

Query: 173 EQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTK 232
           +QP DIE QI+N+I++Y++KPN IILAV+ AN DL NS+ LKLAR+VDP G RTIGV+TK
Sbjct: 176 DQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLAREVDPEGTRTIGVLTK 235

Query: 233 LDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYR 292
           +DLMD GT+  DIL+G++ PLR G+V V+NR Q+DI+  K++ +AL  E+ FF  HP+Y 
Sbjct: 236 IDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREALNDEKRFFENHPSYS 295

Query: 293 TISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRA 352
           + ++ CGT +LAKKLN ILL+HIR+ LP+IK ++   + + + EL + G   + SP S  
Sbjct: 296 SNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAELLALGPETLDSPNS-- 353

Query: 353 GLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSIT 412
            +VL M+  F+  +   ++G + ++S++EL GGARI ++++ IF   + +++P   +  +
Sbjct: 354 -IVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKGGVYALDPFDQIKDS 412

Query: 413 DIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGS-P 471
           DIRT + NS+G  PSLFV   AF++LVK QI+   DPS R V L+++EL++I     S P
Sbjct: 413 DIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIFDELVRILREIISQP 472

Query: 472 ALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIA 531
             ARYP L+  +       L+ER+ P   +V  +I   + +INT HP+ L  ++AMA + 
Sbjct: 473 KYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTAHPDLLKGSQAMAMVE 532

Query: 532 EARRQKQQNAKRSADL 547
           E    KQ + K    L
Sbjct: 533 ERLHPKQVDPKTGKSL 548

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%)

Query: 678 SYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAK 737
           SYF IV+  V D IPKAVM  L+   K ++Q  L+ KLY     EEL  E++   Q R +
Sbjct: 608 SYFSIVKRTVADLIPKAVMLKLIVKSKNDIQKILLEKLYGNQDIEELTKENDITIQRRKE 667

Query: 738 C 738
           C
Sbjct: 668 C 668

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  494 bits (1273), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 258/545 (47%), Positives = 363/545 (66%), Gaps = 13/545 (2%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIKADSPLITAYTAEEA---EPTLENRLRGQSGARDTWGEFLHLPGRRFY 118
           TRRPL+LQL N +      T +  EE    + +  N  + +  A + WGEF HLPG++ +
Sbjct: 63  TRRPLILQLINRRVKKE--TKHATEELLDLDNSAANGGQNEDNAEE-WGEFGHLPGKKLF 119

Query: 119 DFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDI 178
           +F EIR EI  ET +  GKN GIS +PI L++YSPHVL LTL+DLPG+TKVP+G+QP DI
Sbjct: 120 NFNEIRKEIVLETDKSTGKNAGISAVPITLRVYSPHVLTLTLVDLPGLTKVPVGDQPADI 179

Query: 179 ERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDS 238
           ERQI+++IL Y+ KPN IILAV+PAN DL NS+ LKLAR+VDP G RTIGV+TK+DLMD 
Sbjct: 180 ERQIKDMILTYIKKPNAIILAVNPANADLANSDGLKLAREVDPDGSRTIGVLTKVDLMDE 239

Query: 239 GTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFSKHPAYRTISSKC 298
           GT+  DILAG++ PL+ G++ V+NR Q+DI++NK++  AL  E+ FF  HP+Y   +  C
Sbjct: 240 GTDVIDILAGRVIPLKFGYIPVINRGQKDIEKNKTIRSALEDEKRFFENHPSYSARALYC 299

Query: 299 GTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQM 358
           GT +L KKLN ILL+HIR+ LPDIK ++   + + + EL S       S  S + +VL M
Sbjct: 300 GTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKYQTELLS---LGPESLSSSSSIVLSM 356

Query: 359 MNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPTANLSITDIRTAI 418
           +  F+  +   ++G + ++++KEL GGAR+ ++++ IF N + +++P   +  +DIRT +
Sbjct: 357 ITDFSKEYTGILDGEARELTSKELSGGARVSFVFHEIFKNGVYALDPFDQIKDSDIRTIM 416

Query: 419 RNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHN-CGSPALARYP 477
            N +G  PSLFV   AF++LVK QI     PS R V LV++EL++I       P  +RYP
Sbjct: 417 YNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLRLVNLVFDELVRILKQIINQPKYSRYP 476

Query: 478 RLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEAMADIAEARRQK 537
            L+  +       L+E + PT  +V  +I   + +INT HP+ L  ++AMA + E    +
Sbjct: 477 SLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQTYINTAHPDLLKGSQAMAMVEERLHPR 536

Query: 538 QQNAK 542
           Q + K
Sbjct: 537 QVDPK 541

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%)

Query: 678 SYFGIVREMVEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAK 737
           SYF IV+  V D IPKAVM  L+   K ++Q  L+ KLY     +EL  E +   Q R +
Sbjct: 607 SYFSIVKRSVADFIPKAVMLKLIVKSKNDIQKILLEKLYSSENLDELTKESDLTTQRRKE 666

Query: 738 CIKLL 742
           C K++
Sbjct: 667 CQKMV 671

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 149/247 (60%), Gaps = 35/247 (14%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPL 79
           D     + LP + V+GSQSSGKSS+LE++VGRDFLP+G+ +VTRRP+ L L N  + S  
Sbjct: 200 DTNTPGVTLPSIVVVGSQSSGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNTPSGS-- 257

Query: 80  ITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFY---DFTEIRGEIENETARIAG 136
                                   +T  +F   P  R Y   DF E++  I  E      
Sbjct: 258 ------------------------ETTADF---PTHRIYNLKDFREVK-RILMELNLTVP 289

Query: 137 KNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCI 196
            ++ IS  PI L I SP V +L+L+DLPG  +V   +QP +++ +IRN+  +Y+A+PN I
Sbjct: 290 THEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPMELKSKIRNVCQKYLAEPN-I 348

Query: 197 ILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLG 256
           ILA+S A+VDL NS +L+ ++  DP G RTIGV+TKLDL++  + A D+L  K YPL++G
Sbjct: 349 ILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLVEP-SAARDLLMNKKYPLKMG 407

Query: 257 FVGVVNR 263
           +VGV+ +
Sbjct: 408 YVGVITK 414

>Kwal_26.8613
          Length = 861

 Score =  174 bits (441), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 147/245 (60%), Gaps = 29/245 (11%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPL 79
           D+   SL LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N       
Sbjct: 201 DSSSASLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNT------ 254

Query: 80  ITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNK 139
                               SG+ +T  +F  L      DF E++  I  E       ++
Sbjct: 255 --------------------SGSNETTADFPSLRAYNIKDFNEVK-RILMELNMAVPSSE 293

Query: 140 GISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILA 199
            +S  PI L I S  V +L+L+DLPG  +V   +QP +++ +IR +   Y+A+PN IILA
Sbjct: 294 AVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELKSKIRQVCETYLAEPN-IILA 352

Query: 200 VSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVG 259
           +S A+VDL NS +L+ ++  DP G RTIGV+TKLDL++    A +IL  K YPL++G+VG
Sbjct: 353 ISAADVDLANSSALRASKVADPKGLRTIGVITKLDLVEPA-RAKEILNSKKYPLKMGYVG 411

Query: 260 VVNRS 264
           V+ ++
Sbjct: 412 VITKN 416

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  173 bits (439), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 170/318 (53%), Gaps = 59/318 (18%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VG+DFLP+GT +VTRRP+ L L N    +P 
Sbjct: 213 DSTSANLALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVN----TPT 268

Query: 80  ITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFY---DFTEIRGEIENETARIAG 136
               TA+                          P  R Y   DF E++  I  E      
Sbjct: 269 SQEVTAD-------------------------FPTMRIYNLKDFKEVK-RILTEMNMAVP 302

Query: 137 KNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCI 196
             + +S  PI L I S  V +L+L+DLPG  +V   +QP +++ +IR L  +Y+ +PN I
Sbjct: 303 STEAVSDDPIQLTIKSSRVPDLSLVDLPGYIQVEAVDQPIELKSKIRQLCDKYLEEPN-I 361

Query: 197 ILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLG 256
           ILA+S A+VDL NS +L+ ++  DP G RTIGVVTKLDL+D+ T A  IL  + YPL++G
Sbjct: 362 ILAISAADVDLANSAALRASKVADPQGLRTIGVVTKLDLVDAKT-ARAILNNRKYPLKMG 420

Query: 257 FVGVVNRS-----------------------QQDIQENKSVEDALAREEEFFSKHPAYRT 293
           +VGV+ +S                       + D  E  ++      E EFF +H    T
Sbjct: 421 YVGVITKSPSTTPVQRLFDNRSSGSHLFSKKKTDPTETTAITQTKQFENEFFKEHKKDFT 480

Query: 294 ISSKCGTRFLAKKLNQIL 311
            + +  T+ L +KL +IL
Sbjct: 481 -ACQVSTKKLREKLIKIL 497

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  171 bits (434), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 148/248 (59%), Gaps = 35/248 (14%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L N    +P 
Sbjct: 213 DSASANLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVN----TPN 268

Query: 80  ITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFY---DFTEIRGEIENETARIAG 136
           +   TA+                          P  R Y   DF E++  +  E      
Sbjct: 269 VQETTAD-------------------------FPSLRVYNMKDFREVK-RMLTELNLAVP 302

Query: 137 KNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCI 196
            ++ +S  PI L I S HV +L+L+DLPG  +V   +QP +++ +IR L  +Y+A+PN I
Sbjct: 303 ASEAVSEEPIQLTIKSAHVPDLSLVDLPGYIQVEAADQPMELKSKIRMLCDKYLAEPN-I 361

Query: 197 ILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLG 256
           ILA+S A+VDL NS +L+ ++  DP G RTIGV+TKLDL+ S   A  IL  + YPL +G
Sbjct: 362 ILAISAADVDLANSSALRASKVADPQGLRTIGVITKLDLV-SAEEARKILTNRKYPLTMG 420

Query: 257 FVGVVNRS 264
           +VGV+ +S
Sbjct: 421 YVGVITKS 428

>Scas_605.17
          Length = 891

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 29/245 (11%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N    +P 
Sbjct: 214 DSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN----TP- 268

Query: 80  ITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNK 139
                                G  +T  +F  L      DF E++  I  E        +
Sbjct: 269 ---------------------GVNETTADFPSLRTYNLKDFKEVK-RILMELNMAVPTTE 306

Query: 140 GISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILA 199
            +S  PI L I S  + +L+L+DLPG  +V   +QP +++ +IR L  +Y+ +PN IILA
Sbjct: 307 AVSEEPIQLTIKSSSIPDLSLVDLPGYIQVEAADQPTELKTKIRQLCDKYLNEPN-IILA 365

Query: 200 VSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVG 259
           +S A+VDL NS +L+ A+  DP G RTIGV+TKLDL+ S   A +IL  + YPL++G+VG
Sbjct: 366 ISAADVDLANSSALRAAKMADPQGLRTIGVITKLDLI-SPEAARNILNNRKYPLKMGYVG 424

Query: 260 VVNRS 264
           V+ +S
Sbjct: 425 VITKS 429

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 148/250 (59%), Gaps = 41/250 (16%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQL------NNI 73
           D+   +L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L      N I
Sbjct: 215 DSSSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTPNSNEI 274

Query: 74  KADSPLITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDFTEIRGEIENETAR 133
            AD P +  Y  +                                DF E++  I  E   
Sbjct: 275 TADFPALRVYNLQ--------------------------------DFKEVK-RILMELNM 301

Query: 134 IAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKP 193
               ++ +S  PI L I +  V +L+L+DLPG  +V   +QP +++ +IR L  +Y+A+P
Sbjct: 302 AVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGYIQVEAADQPLELKSKIRLLCEKYLAEP 361

Query: 194 NCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPL 253
           N IILA+S A+VDL NS +L+ ++ VDP G+RTIGV+TKLDL++    A +IL  K YPL
Sbjct: 362 N-IILAISAADVDLANSAALRASKVVDPLGERTIGVITKLDLVEPA-KAREILNNKKYPL 419

Query: 254 RLGFVGVVNR 263
           ++G+VGV+ +
Sbjct: 420 KMGYVGVITK 429

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 145/255 (56%), Gaps = 41/255 (16%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQL------NNI 73
           D+    L LP + VIGSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L      NN+
Sbjct: 223 DSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNV 282

Query: 74  KADSPLITAYTAEEAEPTLENRLRGQSGARDTWGEFLHLPGRRFYDFTEIRGEIENETAR 133
            AD P +  Y  +                                DF E++  +  E   
Sbjct: 283 TADFPSMRLYNIK--------------------------------DFKEVKRMLM-ELNM 309

Query: 134 IAGKNKGISRIPINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLILEYVAKP 193
               ++ +S  PI L I S  V +L+L+DLPG  +V   +QP +++ +IR+L  +Y+  P
Sbjct: 310 AVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAP 369

Query: 194 NCIILAVSPANVDLVNSESLKLARDVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPL 253
           N IILA+S A+VDL NS +LK ++  DP G RTIGV+TKLDL+D    A  IL  K YPL
Sbjct: 370 N-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPL 427

Query: 254 RLGFVGVVNRSQQDI 268
            +G+VGV+ ++   I
Sbjct: 428 SMGYVGVITKTPSSI 442

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 26 LDLPVLAVIGSQSSGKSSILETLVGRDF 53
          LD  V++V GSQSSGKS++L  L   +F
Sbjct: 35 LDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 26 LDLPVLAVIGSQSSGKSSILETLVGRDF 53
          LD  V++V GSQSSGKS++L  L    F
Sbjct: 41 LDYHVISVFGSQSSGKSTLLNALFNTKF 68

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%)

Query: 20 DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDF 53
          D G+D     V++V GSQSSGKS++L  L    F
Sbjct: 34 DVGVD---YHVISVFGSQSSGKSTLLNALFNTQF 64

>Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement
          Length = 577

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 33  VIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLV--LQLNNIKADSPLITAYTAEEAEP 90
           V+G  +SGKSS+LE+ +GR F    +  +  R  V  L+L   K    LI     E+   
Sbjct: 364 VVGKPNSGKSSLLESFLGRSFTDVYSPTIRPRIAVNSLELKGGK-QYYLILQELGEQEPA 422

Query: 91  TLENRLR 97
            LENRL+
Sbjct: 423 ILENRLK 429

>CAGL0M12859g 1268191..1271016 highly similar to sp|P32565
           Saccharomyces cerevisiae YIL075c SEN3, start by
           similarity
          Length = 941

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 432 ELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGSPALARYPRLQAKLIEVVSDLL 491
           +LA ++  K   ++ LDP    + +V+E++M  C       LA    L+A  ++VV  +L
Sbjct: 111 KLATEIYNKSGEQVNLDPK---LTIVFEKMMTKCTQANEYKLALGIALEAFRLDVVKSIL 167

Query: 492 RERLG 496
           +ERLG
Sbjct: 168 QERLG 172

>Scas_628.25
          Length = 1406

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 67/144 (46%), Gaps = 18/144 (12%)

Query: 218  DVDPHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDA 277
            D+D H +  +G V+ +D  +S     +++          FV V+  S   I  ++S+E+ 
Sbjct: 973  DID-HARTALGCVSGIDFTESIFKNKNLVTS-------NFVEVLLES---IHISRSLEN- 1020

Query: 278  LAREEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQEL 337
                E FF     +   +S   T F   KL+  L   I EK+  I   ++ L   T + L
Sbjct: 1021 ----ERFFEHELLFLIETSIFMTMF--HKLDNTLYQIIFEKVNSILNDVDILSKDTVRRL 1074

Query: 338  ASYGGSNIISPESRAGLVLQMMNK 361
            ASY    + + ++ AGL+++ +N+
Sbjct: 1075 ASYKLILLPNLDNSAGLLIEFINQ 1098

>YEL043W (YEL043W) [1384] chr5 (70478..73348) Protein of unknown
           function [2871 bp, 956 aa]
          Length = 956

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 22/154 (14%)

Query: 311 LLNHIREKLPDIKARLNTLIGQTEQELASYGGSNIISPESRAGLVLQMMNKFATNFV--- 367
           L N+  ++ P +++   +L   T   ++SY  + +ISP S + L  Q  N   TN +   
Sbjct: 685 LDNYWTKQQPQVRSTNESLFSTTGTPMSSYKANPVISPYSSSHL-RQTSNATNTNPMHPQ 743

Query: 368 SSIEGTSSDISTKELCGGARIY-------YIYNNIFGNSLKSINPTANLSITDIRTAIRN 420
           S +  T +D S +        Y        + NNI GN  ++I+P  +   +D    + N
Sbjct: 744 SLLAATLNDPSLQSFVRSGSFYSAPQPANSLQNNINGNETENISPRIS---SDFNLLVPN 800

Query: 421 STGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCV 454
                     P L+ D+ + P     L PS   +
Sbjct: 801 --------LSPRLSNDVPIVPGNNTTLTPSHSNI 826

>CAGL0M12276g 1223585..1225534 highly similar to sp|P39722
           Saccharomyces cerevisiae YAL048c vacuolar aspartic
           protease, start by similarity
          Length = 649

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 33  VIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSP----LITAYTAEEA 88
           V+G ++SGKSS+LE+ +GR F    +   T RP V  +NN++        LI     E+ 
Sbjct: 443 VVGKRNSGKSSLLESFLGRLFSEAYSP--TIRPRV-AVNNVEVTGDKQYYLILQEFGEQE 499

Query: 89  EPTLENRLR 97
           E  L+N  R
Sbjct: 500 EAILQNPSR 508

>CAGL0G07381g 698805..700322 similar to sp|P06778 Saccharomyces
           cerevisiae YML032c RAD52 recombination and DNA repair
           protein, hypothetical start
          Length = 505

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 113 PGRRFYDF-TEIRGEIENETARIAGKNKGISRIPINLKI---YSPHVLNLTL 160
           P RRF +   E  G+I   TAR A   +    +P NLK    Y PH + LT+
Sbjct: 282 PDRRFNNAPKENTGDITFVTARAADSYQSTENVPENLKFDPKYVPHSMKLTI 333

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 11/108 (10%)

Query: 145 PINLKIYSPHVLNLTLIDLPGITKVPIGEQPPDIERQIRNLIL--EYVAKPNCIILAVSP 202
           PI +   S  V   TL+  PG  K    E  P +E+Q+R  +L  +++       LA  P
Sbjct: 112 PIQISGSSNTVSPNTLLSSPGAVKRRKKEYGPRLEKQLRPSVLWHKFIGSIQVNALATRP 171

Query: 203 ANVDLVNSESLKL---------ARDVDPHGKRTIGVVTKLDLMDSGTN 241
               L     LK+         AR  + +GK+   +   + L+D+  N
Sbjct: 172 TAKPLKYGSELKIVKNSTGISPARIYNTNGKKKTSLANYIRLIDAAQN 219

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,294,592
Number of extensions: 943418
Number of successful extensions: 3770
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3800
Number of HSP's successfully gapped: 51
Length of query: 742
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 633
Effective length of database: 12,822,747
Effective search space: 8116798851
Effective search space used: 8116798851
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)