Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL173C42041220450.0
KLLA0F12914g4304298531e-111
Kwal_33.151954283987604e-97
YLL002W (RTT109)4364157188e-91
CAGL0D05786g4233956663e-83
Scas_629.204404206396e-79
Sklu_2439.1439259710.82
CAGL0L05126g39172710.92
Kwal_14.100639258638.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL173C
         (412 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   792   0.0  
KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   333   e-111
Kwal_33.15195                                                         297   4e-97
YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   281   8e-91
CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   261   3e-83
Scas_629.20                                                           250   6e-79
Sklu_2439.14 YKL080W, Contig c2439 20406-21584                         32   0.82 
CAGL0L05126g complement(577581..578756) highly similar to sp|P31...    32   0.92 
Kwal_14.1006                                                           29   8.5  

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/412 (95%), Positives = 393/412 (95%)

Query: 1   MGLKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCSPTTIAAQHFFTLSNNSKVFYA 60
           MGLKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCSPTTIAAQHFFTLSNNSKVFYA
Sbjct: 1   MGLKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCSPTTIAAQHFFTLSNNSKVFYA 60

Query: 61  LQVVVYICIEGTSGDRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSIDPSHYLQRVRR 120
           LQVVVYICIEGTSGDRMLFVSKADTNGYC        ATRALLQFLLSIDPSHYLQRVRR
Sbjct: 61  LQVVVYICIEGTSGDRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSIDPSHYLQRVRR 120

Query: 121 MRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLAL 180
           MRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLAL
Sbjct: 121 MRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLAL 180

Query: 181 FTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAALLIPGEDSAV 240
           FTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAALLIPGEDSAV
Sbjct: 181 FTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAALLIPGEDSAV 240

Query: 241 TAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGRNPSLRAFWT 300
           TAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGRNPSLRAFWT
Sbjct: 241 TAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGRNPSLRAFWT 300

Query: 301 ELVARQEFRLXXXXXXXXXXXLYTGPCARPAPEDLLCPASPADYVHVKHYVTAEEYATAA 360
           ELVARQEFRL           LYTGPCARPAPEDLLCPASPADYVHVKHYVTAEEYATAA
Sbjct: 301 ELVARQEFRLGVVVGVVGAAGLYTGPCARPAPEDLLCPASPADYVHVKHYVTAEEYATAA 360

Query: 361 GASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAVNDLTAR 412
           GASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAVNDLTAR
Sbjct: 361 GASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAVNDLTAR 412

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 242/429 (56%), Gaps = 29/429 (6%)

Query: 1   MGLKELLAEALPAGHDFDVLHLQSPATERPPLT-------EASGCSPTTIAAQHFFTLSN 53
           M L+  + +ALP GH+F++++LQS   E  P+T       + +G +  TI  QHF  L  
Sbjct: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60

Query: 54  NSKVFYALQVVVYICIEGTSG---DRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSID 110
             KV +AL++VVY  +   +    +R+LFVSKADTNGYC         T++++ ++L+I 
Sbjct: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120

Query: 111 PSHYLQRVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRAR------ 164
           P HYL+ V+ +     +   +I  +T+   AL IL+ R     LD +    R +      
Sbjct: 121 PGHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNR----PLDSKGITSRVKIPDQDL 176

Query: 165 YTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFD 224
           Y SFP P +  T+++LFTRAEP YLFS S++NP KHVL GD+LL+WWL  VD ++V  FD
Sbjct: 177 YVSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD 236

Query: 225 PATDAALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLD 284
             T A L IPGE+  V ++YLR   +  W VG +F  S +D AL RIP FPDDPKGRFLD
Sbjct: 237 NKTKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLD 296

Query: 285 DLAHEGR--NPSLRAFWTELVARQEFRLXXXXXXXXXXXLYTGPCARPAPEDLLCPASPA 342
            L  +GR    ++  FWTEL ARQEFRL            Y G C  P   D++ P S  
Sbjct: 297 HLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKK 356

Query: 343 DYVHVKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATK 402
           ++ ++K+Y+T EEY T  GA EA+ N+ D   + Y   M +V G H            TK
Sbjct: 357 NFKNLKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIGNHHKIA-------TTK 409

Query: 403 RPAVNDLTA 411
           RP +N +  
Sbjct: 410 RPEINTINV 418

>Kwal_33.15195
          Length = 428

 Score =  297 bits (760), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 158/398 (39%), Positives = 227/398 (57%), Gaps = 11/398 (2%)

Query: 2   GLKELLAEALPAGHDFDVLHLQSPATERPPL----TEASGCSPTTIAAQHFFTLSNNSKV 57
            L+ LL + LP   + +V HLQSP  E  P+    ++A+G     +  QHFF L  ++K+
Sbjct: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANG-KQQVVKIQHFFGLCTDNKL 63

Query: 58  FYALQVVVYICIEGTSG-DRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSIDPSHYLQ 116
           FY L+V VY+ ++ +   D++LF+SKADTNGYC         T+AL++++ S+DP +YL 
Sbjct: 64  FYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYLV 123

Query: 117 RVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSF-PCPPQYT 175
           +V  M          IT +T    AL+I+  R+  G       ++   YT F  C P +T
Sbjct: 124 KVIPMNRTRQNYANAITKSTTTKRALQIIRNRHTAGKTSTPDISNL--YTQFEKCDPGWT 181

Query: 176 TRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAALLIPG 235
            ++ LFTR+EPHYLFSES++NP KH+L G++LL WWL+ VD +L   F   T A L IPG
Sbjct: 182 CKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKARLQIPG 241

Query: 236 EDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGRNPSL 295
           E+   T  YL   +FP+WRVG +F     D A+ +IP FPDDPKGRFL+ L  E R   +
Sbjct: 242 EEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDENRAKKV 301

Query: 296 R--AFWTELVARQEFRLXXXXXXXXXXXLYTGPCARPAPEDLLCPASPADYVHVKHYVTA 353
           +   FWTEL  +QEFR+               PC  P   +++ P S   +  +K Y+T 
Sbjct: 302 QVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFNMIKTYITG 361

Query: 354 EEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTT 391
           EEY T  GA EA  N+ D + LR G ++ +V+G   T+
Sbjct: 362 EEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTS 399

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  281 bits (718), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 157/415 (37%), Positives = 219/415 (52%), Gaps = 16/415 (3%)

Query: 1   MGLKELLAEALPAGHDFDVLHLQSPATER----PPLTEASGCSPTTIAAQHFFTLSNNSK 56
           M L + L+  LP    F+ L LQS   E      P  +      +TI  QHFF+L +  K
Sbjct: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK 60

Query: 57  VFYALQVVVYICI-EGTSGDRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSIDPSHYL 115
           VF++L+V VY+ + +    +R++FVSKADTNGYC         T+ +L+F+LSIDP++YL
Sbjct: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120

Query: 116 QRVR-RMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRAR-----YTSFP 169
           Q+V+  +R        LI+ A+     LRILA+R +     V    +  R     Y SF 
Sbjct: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180

Query: 170 CPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDA 229
           CP +  T++ LFTR    YLF +S++N  KH+L G+ L++WW   +D LL+  F   T A
Sbjct: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240

Query: 230 ALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHE 289
            L IPGED A    YLR +++P W+VG +F       A+  IP FPDDPK RF+  LA E
Sbjct: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300

Query: 290 GR--NPSLRAFWTELVARQEFRLXXXXXXXXXXXLYTG-PCARPAPEDLLCPASPADYVH 346
            R    SL +FW EL  RQEF+L                P   P+  D++ P S   +  
Sbjct: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360

Query: 347 VKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGA--HSTTPRPAPTQD 399
           +K Y+T EEY T  GA EA  N+ D LLLR    +  + G   H    +P P  +
Sbjct: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASN 415

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  261 bits (666), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 151/395 (38%), Positives = 209/395 (52%), Gaps = 13/395 (3%)

Query: 3   LKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCS--PTTIAAQHFFTLSNNSKVFYA 60
           L+ +L E LP    F++LHLQSP +E  PL   +      TTI  +H F L+   ++FY 
Sbjct: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTIKTEHLFCLAYKGRIFYG 61

Query: 61  LQVVVYICI----EGTSGDRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSIDPSHYLQ 116
           L++ VYI      E    +R++FVSKADTNGYC         T  L++++LSI+P +YL 
Sbjct: 62  LELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYYLH 121

Query: 117 RV--RRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQY 174
           RV  +      +    LIT ATN+  AL+ILA R +  NL +      A YT F    + 
Sbjct: 122 RVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNL-IEPEIFNAFYTKFHSGKEL 180

Query: 175 TTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFD-PATDAALLI 233
            T++ALFTR    YLF  S++NP KH L GD LL+WW + +D+LLV+ F+   T A + I
Sbjct: 181 VTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNKTKAKIRI 240

Query: 234 PGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHEGR-- 291
           PGED      Y   ++   W  G +F  +  D  +  IP FPDDPK RF+  L  E R  
Sbjct: 241 PGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQLFEENRIQ 300

Query: 292 NPSLRAFWTELVARQEFRLXXXXXXXXXXXLYTGPCARPAPEDLLCPASPADYVHVKHYV 351
             SL  FWTEL  RQEF+L           +Y          D+    S   +  +K+Y+
Sbjct: 301 TTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKPSTDVYRCRSKRQFHCIKNYI 360

Query: 352 TAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRG 386
           T EEY T  GA E+++N+ D  L R G ++  V G
Sbjct: 361 TGEEYDTEEGALESYQNVND-YLSREGTSLLTVTG 394

>Scas_629.20
          Length = 440

 Score =  250 bits (639), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 216/420 (51%), Gaps = 19/420 (4%)

Query: 3   LKELLAEALPAGHDFDVLHLQ-SPATER----PPLTEASGCSPTTIAAQHFFTLSNNSKV 57
           L ELLA  LP GHDF++LHLQ  PA       P  T        T+  QHFFTL +N K 
Sbjct: 9   LDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKKA 68

Query: 58  FYALQVVVYICIEGTSGDRMLFVSKADTNGYCXXXXXXXXATRALLQFLLSIDPSHYLQR 117
            +AL++ VY+ +      +++FVSKADT+GYC         T+  LQ+L+S+DP HYL++
Sbjct: 69  VFALEIYVYLTLSSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYLRK 128

Query: 118 VRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRARY----TSFPCPPQ 173
           V+ +R      + LI   T+   +LRILA R    +L      +  ++            
Sbjct: 129 VKPLRRVNDHDESLIRKGTSVERSLRILAVRV---DLSPHPCQNTDKFYITRNDVGGDTN 185

Query: 174 YTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDAA-LL 232
           + T++ LFTR    YLF  S++N  KH L GD+LL+WW+  +D L+ T FDP   +A L 
Sbjct: 186 WVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDPNNVSARLR 245

Query: 233 IPGEDSA-VTAHYLRP--VRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHE 289
           +PGED+  V+  YL     +   W+VG +FGG+  D A+  +P FPDDPK RF+  L  E
Sbjct: 246 VPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSRFIRHLVQE 305

Query: 290 GR--NPSLRAFWTELVARQEFRLXXXXXXXXXXXLYTG-PCARPAPEDLLCPASPADYVH 346
            R    +L+ +W EL  RQEF+L                P   P   ++   +S   + +
Sbjct: 306 NRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIFICSSRRQFRY 365

Query: 347 VKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAV 406
           ++ YV  EEY    G  E++ N+ D L LRY   + ++ G      R       TKR A+
Sbjct: 366 IRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIRKPVVASTTKRSAI 425

>Sklu_2439.14 YKL080W, Contig c2439 20406-21584
          Length = 392

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 146 AQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPG 204
           A+R +TG+L VR+  D  +   F     Y T + +         F  S +  AK+V+PG
Sbjct: 162 AERKKTGDLSVRSLHDIVKAEDFILDSDYLTTVLVAVPKNLKEDFESSYETLAKNVVPG 220

>CAGL0L05126g complement(577581..578756) highly similar to sp|P31412
           Saccharomyces cerevisiae YKL080w VMA5 H+-ATPase,
           vacuolar, start by similarity
          Length = 391

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 133 TPATNAVDALRILAQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLALFTRAEPHYLFSE 192
           T  TNA   L   A+R +TG+L VR+  D  +   F    +Y T + +         F +
Sbjct: 149 TNYTNAKSNLAA-AERKKTGDLSVRSLHDIVKSDDFILDSEYLTTVLIAVPKNLKADFEK 207

Query: 193 SAQNPAKHVLPG 204
           + +  +K+V+PG
Sbjct: 208 TYETLSKNVVPG 219

>Kwal_14.1006
          Length = 392

 Score = 28.9 bits (63), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 146 AQRYRTGNLDVRAAADRARYTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLP 203
           A+R RTG+L VR+  D  +   F    +Y T + +         F ++ +  AK+V+P
Sbjct: 162 AERKRTGDLSVRSLHDIVKPEDFVLDSEYLTTVLVAVPKSLRDEFQKTYETLAKNVVP 219

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,471,852
Number of extensions: 475877
Number of successful extensions: 837
Number of sequences better than 10.0: 9
Number of HSP's gapped: 819
Number of HSP's successfully gapped: 9
Length of query: 412
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 308
Effective length of database: 12,995,837
Effective search space: 4002717796
Effective search space used: 4002717796
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)