Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL063C53552526350.0
KLLA0C10340g54151213700.0
Kwal_47.1817857147011951e-159
Kwal_56.230524854657145e-88
KLLA0F04279g4834567102e-87
Scas_688.116334657161e-86
AEL099W6674607083e-85
KLLA0A06952g7164797062e-84
CAGL0M01078g6954967042e-84
Kwal_23.55866074786862e-82
KLLA0F21802g6104736818e-82
YDR338C6954676791e-80
AER234W6144836695e-80
CAGL0J00495g6654506501e-76
Scas_373.16944836483e-76
YHR032W5813796064e-71
Kwal_47.1834337248720.86
YAL060W (BDH1)38248721.0
YPL082C (MOT1)1867141666.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL063C
         (525 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1...  1019   0.0  
KLLA0C10340g 886390..888015 weakly similar to sp|Q05497 Saccharo...   532   0.0  
Kwal_47.18178                                                         464   e-159
Kwal_56.23052                                                         279   5e-88
KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida ...   278   2e-87
Scas_688.11                                                           280   1e-86
AEL099W [2407] [Homologous to ScYDR338C - SH] complement(439214....   277   3e-85
KLLA0A06952g complement(628173..630323) similar to sp|Q05497 Sac...   276   2e-84
CAGL0M01078g 118018..120105 highly similar to sp|Q05497 Saccharo...   275   2e-84
Kwal_23.5586                                                          268   2e-82
KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces...   266   8e-82
YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Membe...   266   1e-80
AER234W [2736] [Homologous to ScYHR032W - SH] complement(1071224...   262   5e-80
CAGL0J00495g complement(40807..42804) similar to sp|P38767 Sacch...   254   1e-76
Scas_373.1                                                            254   3e-76
YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the mul...   238   4e-71
Kwal_47.18343                                                          32   0.86 
YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R, 3R)-...    32   1.0  
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...    30   6.7  

>AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1608
           bp, 535 aa]
          Length = 535

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/525 (95%), Positives = 502/525 (95%)

Query: 1   MQXXXXXXXXXXXXFDKKLGTYRSINAGNYADDAVSGSYSVVVNSRYAMLCGSDFEEPLD 60
           MQ            FDKKLGTYRSINAGNYADDAVSGSYSVVVNSRYAMLCGSDFEEPLD
Sbjct: 1   MQTEEEALTASLAAFDKKLGTYRSINAGNYADDAVSGSYSVVVNSRYAMLCGSDFEEPLD 60

Query: 61  GAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITG 120
           GAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITG
Sbjct: 61  GAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITG 120

Query: 121 LSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLI 180
           LSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLI
Sbjct: 121 LSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLI 180

Query: 181 PEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIVFVLGF 240
           PEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIVFVLGF
Sbjct: 181 PEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIVFVLGF 240

Query: 241 TRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLW 300
           TRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLW
Sbjct: 241 TRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLW 300

Query: 301 DLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRV 360
           DLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRV
Sbjct: 301 DLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRV 360

Query: 361 AHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSY 420
           AHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSY
Sbjct: 361 AHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSY 420

Query: 421 ILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLW 480
           ILAVNQIYDAFNTFGAAI           IWNMIAYYIVSLPLGWWLAFGPLKLKLAGLW
Sbjct: 421 ILAVNQIYDAFNTFGAAILRGQGRQRLGGIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLW 480

Query: 481 YGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVENDMLHS 525
           YGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVENDMLHS
Sbjct: 481 YGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVENDMLHS 525

>KLLA0C10340g 886390..888015 weakly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 541

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/512 (50%), Positives = 355/512 (69%), Gaps = 11/512 (2%)

Query: 22  YRSINAG-NYADDAVSGSYSVVVNSRYAMLC---------GSDFEEPLDGAQTLRAECIS 71
           Y +IN    Y  D  S S    +++RY ++            DF E L    + R E   
Sbjct: 17  YDTINDNTRYESDGESASSGDAIDNRYRLMSPDADRDDFIDEDFIEDLTAPTSSRNEVSY 76

Query: 72  ILRSSLPISMAFLMEFSMTICSLFIIGHLCTAME-LASASLAVMTYNITGLSLVEGLATA 130
           IL +S  I++ FLME+S+ I SLF+IGH+C + + LASASLAVMTYNITGL+ VEG+AT+
Sbjct: 77  ILSNSALITLTFLMEYSLAIISLFVIGHVCKSSDALASASLAVMTYNITGLAFVEGMATS 136

Query: 131 LDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLIPEADLIPKIQ 190
           LDT C QAYG+++Y+KVGLY  R +AMIM G+    I W+FSASWL  +I E D++P+IQ
Sbjct: 137 LDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYVIAEQDILPEIQ 196

Query: 191 LYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIVFVLGFTRHFGFVGAP 250
           L+LRI+  G+P L+ F TGKR+LQ+Q  ++A TY L I  P+ I+ V  FTR+ G+ GAP
Sbjct: 197 LFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYSFTRYIGYAGAP 256

Query: 251 IGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVML 310
           +GI  S W M ++L V+ +  R +TL CWYP   S  HFKR+F  W+P+W+LAFPGL+M+
Sbjct: 257 LGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSWKPMWNLAFPGLLMI 316

Query: 311 EAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRVAHYVGSGLIK 370
           EAE+LS E LT++STY GV AIA+Q+V++N+ SLIYQIPFA+GCV+S RVA+YVG+  + 
Sbjct: 317 EAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTRVANYVGTESVN 376

Query: 371 NAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSYILAVNQIYDA 430
           NA++ I  SY +A+ VG++ C  +   +K LA LFT ++EVVEL   V+ ILAVNQ+YDA
Sbjct: 377 NAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVAPILAVNQLYDA 436

Query: 431 FNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGILIL 490
           F TF AAI           + N+IAYY ++LPL  WL FG  +L L GLWYGCG GIL+L
Sbjct: 437 FTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGLWYGCGTGILLL 496

Query: 491 ALAFSWYIYNSDWQLIIQECNKRENTEVENDM 522
           A A S+ ++NS+W+ I++EC++RE  E E D+
Sbjct: 497 AFALSYCVFNSNWENIVEECHRREKEENEVDL 528

>Kwal_47.18178
          Length = 571

 Score =  464 bits (1195), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/470 (47%), Positives = 315/470 (67%), Gaps = 1/470 (0%)

Query: 51  CGSDFEEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASAS 110
           CG+  + P     T R E  +IL ++LP++  F +E+++ + SLFIIGH  +A  LASAS
Sbjct: 87  CGARCDPPAPPGATAR-EARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHLASAS 145

Query: 111 LAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWF 170
           LA MTYNITGL+++EG+AT+LDT C QAYG++RY+KVGLYF R + MI V +    ++W+
Sbjct: 146 LAAMTYNITGLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWW 205

Query: 171 FSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVF 230
            +ASWL +L+P+  L+  +QL+LR+   G+P LVLF TGKRY+QAQ  YEA T+VLA+  
Sbjct: 206 TAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAV 265

Query: 231 PLTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFK 290
           P+ +   +   R  GF+GAP+ +  + W + ++L  +     P TL+C YP   S  H K
Sbjct: 266 PVNVGLCVALVRQIGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLK 325

Query: 291 RVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPF 350
           R  THW  +W LAFPGLVM+E+E+LS E LTL+ST FGV AIA+Q+V+AN  SLIYQ+PF
Sbjct: 326 RALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPF 385

Query: 351 AIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEE 410
           A+GCV+S RV   VG G +  A+ T++A Y +A++VG   C+ +      +ARLFT +  
Sbjct: 386 AMGCVVSTRVGGRVGRGELAGARRTVRAGYWVAAVVGTVNCVLLVVGRGAVARLFTQDAG 445

Query: 411 VVELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFG 470
           V+ LA  +  ILAVNQ+ DA  TFGAA+             N++AYY V LP+  WLAFG
Sbjct: 446 VIALAERLVPILAVNQVADAVATFGAAVLRGQGRQRVGGALNVVAYYAVGLPVSGWLAFG 505

Query: 471 PLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVEN 520
           PL++ LAGLW GCG GI++LA+A S ++  SDW+ I +    RE+ E E+
Sbjct: 506 PLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARESMEGED 555

>Kwal_56.23052
          Length = 485

 Score =  279 bits (714), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 162/465 (34%), Positives = 268/465 (57%), Gaps = 16/465 (3%)

Query: 60  DGAQT-LRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNI 118
           D A+T  + E   I ++S P+ + F+++ S++  ++  +G L +A++L   SLA +T+  
Sbjct: 27  DVARTDAKTEFKEISKNSGPLILTFVLQMSLSFVTVIFVGRL-SAVDLGGVSLANVTFTA 85

Query: 119 TGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQL 178
           T   + +GLAT LDT+CPQAYG +R+  VGLYF RG A+        A++W++S   L L
Sbjct: 86  TS-GIFQGLATCLDTLCPQAYGGKRFKLVGLYFQRGLAISFAFAIPIAVLWWYSNYVLGL 144

Query: 179 LIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV--F 236
           ++ +  L+     YLR+MI  IP  V+F  GK+YLQAQ  Y    Y+L +  PL +V  +
Sbjct: 145 VVDDLRLVDIACRYLRVMIAAIPGYVMFECGKKYLQAQNDYTTGQYILFVCAPLNVVLNY 204

Query: 237 VLGFTRHFGFVGAPIGIVTSQWLMVIIL--FVFARSIRPDTLRCWYPFMQSSHHFKRVFT 294
           +  F    GF+GAPI       LM   L  +++ ++       CW P       ++ +F+
Sbjct: 205 LFVFKFALGFIGAPIATSLIYTLMGFSLATYIWHQNRNLSETNCWSPL----SEWRPIFS 260

Query: 295 HWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGC 354
           +W  +  LA PG+VM+EAEFL+ E+LT+IS  FG  ++A+Q+VIA++ +L +++PF++G 
Sbjct: 261 NWMTMISLALPGIVMVEAEFLAFESLTVISAKFGTESLAAQSVIASIQTLTFEVPFSVGV 320

Query: 355 VISNRVAHYVGSGLIKNAQMTIKAS-YCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVE 413
             SNR+A+Y+G G +++ Q+  + +   LA +VG++    +      +  +F+N+ EV+ 
Sbjct: 321 AASNRIAYYIGKGRLRDCQIATRTTLVSLACVVGIANFSTLILGRHAIPAIFSNDPEVIR 380

Query: 414 LAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLK 473
           +A  V  I+ +NQI D F+   A +           I N+IAYY+V LP+     F    
Sbjct: 381 IASQVLPIIGLNQILDVFSVLSAGVLRAQGRQRIGGILNIIAYYVVGLPMAVVFGF-RWN 439

Query: 474 LKLAGLWYGCGIGILILALAFSWYIYNSDWQLII---QECNKREN 515
           L L GLW G G GI +L+++  + +  S+W  I+   Q+ +KR N
Sbjct: 440 LGLRGLWMGLGCGIALLSMSLVYCVSRSNWTKILLDSQQLHKRAN 484

>KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida
           albicans ethionine resistance protein (by homology),
           hypothetical start
          Length = 483

 Score =  278 bits (710), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/456 (34%), Positives = 262/456 (57%), Gaps = 14/456 (3%)

Query: 60  DGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNIT 119
           DG  +L  E   + ++S+P+ + FL++ S++  +L   G + T +E+   S+  +T+ +T
Sbjct: 28  DGETSLEYEFWYMTKTSIPLIITFLLQCSLSSSALVFAGRVGT-LEVGGISIGNVTFAVT 86

Query: 120 GLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLL 179
               + G+AT LDTVCPQAYG+ +Y+ VGLYF RG A+  +        W+ S   L  L
Sbjct: 87  SAIFI-GIATCLDTVCPQAYGAGKYNMVGLYFQRGVAISFLFAVPVIAFWYNSEYVLSFL 145

Query: 180 IPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTI----V 235
           + +AD++    +YLRIMIL +P  ++F  GK+YLQAQ  +     +L +  PL I    +
Sbjct: 146 VEDADVVHIAAVYLRIMILSLPGYIIFECGKKYLQAQGDFVTGQNILFVCAPLNILLNYL 205

Query: 236 FVLGFTRHFGFVGAPIGIVTSQWLMVIILFVF-ARSIRPDTLRCWYPFMQSSHHFKRVFT 294
           FVL +   FG++G+PI +V S  LM + +  +  R I      CW+P    + +F  +F 
Sbjct: 206 FVLKY--KFGYIGSPISMVLSYTLMGLTIVAYICRQIYFGNSSCWHPI---TGNFSAIFK 260

Query: 295 HWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGC 354
           +W PL  LA PGL+M+EAEF + E +T++S  FG   +A+Q+++A L +  +Q+PF+   
Sbjct: 261 NWGPLIALALPGLIMIEAEFFAFEIITVLSAKFGTEVLAAQSIVATLQTFFFQLPFSCSV 320

Query: 355 VISNRVAHYVGSGLIKNAQMTIKAS-YCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVE 413
             SNR+A+++GSG+ +N +   KA+ + +    G+     + F    L  LF  +  +V 
Sbjct: 321 AASNRIAYHIGSGITENCKTATKATMFGVGPAAGIINFTVLYFGRYKLCSLFNADPVLVN 380

Query: 414 LAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLK 473
            A  +  ++A+NQIYD FN   A +             N++AYY+V L +G  LAF   K
Sbjct: 381 KAAGLLCVVALNQIYDCFNVMAAGVLRAQGRQRIGGYLNIMAYYLVGLEVGILLAF-KFK 439

Query: 474 LKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQE 509
           +++ G W G G+G+L LA+  ++++Y S+W+ II +
Sbjct: 440 MEVLGFWIGIGVGVLFLAIGENYFVYISNWRNIISK 475

>Scas_688.11
          Length = 633

 Score =  280 bits (716), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/465 (34%), Positives = 269/465 (57%), Gaps = 17/465 (3%)

Query: 64  TLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITGLSL 123
           T + EC  I  ++LP+   F+++ S+++ S+F + HL T  EL   +L  MT NITGL+ 
Sbjct: 176 TYKRECKVIAVNALPLIFTFILQNSLSLASIFSVSHLGTK-ELGGVTLGSMTANITGLAA 234

Query: 124 VEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAM-IMVGMSLTAIIWFFSASWLQLLIPE 182
           ++GL T LDT+C QAYG++ Y  VG+   R + + I+  + +  I W +S + L  +IPE
Sbjct: 235 IQGLCTCLDTLCSQAYGAKNYRLVGVLIQRCAVITILAFLPVMYIWWSWSETILSWMIPE 294

Query: 183 ADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTI----VFVL 238
            +L      YLRI   G+P  ++F  GKR+LQ Q ++ AST VL I  PL      + V 
Sbjct: 295 KELCKLAANYLRITAFGVPGFIIFECGKRFLQCQGIFHASTIVLFICAPLNALMNYILVW 354

Query: 239 GFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDT--LRCWYPFMQSSHHFKRVFTHW 296
             T   G++GAP+ +  + WLM + L V+A + + +   ++CW   ++ +    +VF +W
Sbjct: 355 DKTIGIGYLGAPLSVAINYWLMALGLMVYAVTTQHEARPMKCWNGIIKKT----QVFKNW 410

Query: 297 RPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVI 356
           R +++LA PG++M+EAEFL  E LT+ +++ G   +A+Q+++A ++SL YQ+PF+I    
Sbjct: 411 RKMFNLALPGIIMVEAEFLGFEILTIFASHLGTAPLAAQSIVATVASLAYQVPFSISVST 470

Query: 357 SNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKP-LARLFTNNEEVVELA 415
           S RVA+++G+ L ++   T   +  L S V  SM + + F  K  +A++F+N  +VV L 
Sbjct: 471 STRVANFIGASLYRSCIKTCTMAL-LLSFVCSSMNMVIIFECKDRIAKMFSNESDVVNLV 529

Query: 416 HSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLK 475
            S   ILA  Q++DAFN   A               N+ A+Y V +P+ + L F   K+ 
Sbjct: 530 ISTLPILACMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCVGIPMAYMLTFN-FKMG 588

Query: 476 LAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKR--ENTEV 518
           ++GLWYG    ++++++   + +++ DW+ II     R  E+T V
Sbjct: 589 ISGLWYGITCALIMMSICQGYAVFHCDWKQIINAAKNRNAESTRV 633

>AEL099W [2407] [Homologous to ScYDR338C - SH]
           complement(439214..441217) [2004 bp, 667 aa]
          Length = 667

 Score =  277 bits (708), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 155/460 (33%), Positives = 258/460 (56%), Gaps = 15/460 (3%)

Query: 56  EEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMT 115
           E+  D   T+++E + +L  S+P+   FL+E    +    ++GHL    ELA+ SLA MT
Sbjct: 198 EDLDDEPATVKSESLVLLCYSVPLIFTFLLEQMFPVVCALVVGHLGKN-ELAAVSLASMT 256

Query: 116 YNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASW 175
            NIT  ++ EG++T+LDT+CPQAYG++ Y  VGL+  R     +      A +++FS   
Sbjct: 257 TNIT-FAIFEGISTSLDTLCPQAYGARNYYGVGLHMQRCVLFSLAFFVPFAALFWFSEGI 315

Query: 176 LQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV 235
           L  LI E  L+P    +LR+MI+G P  +LF   KRYLQAQ +++A  YVL I  PL IV
Sbjct: 316 LPYLIKEKSLVPLTSQFLRVMIVGGPGFILFENLKRYLQAQGIFDAGIYVLLICCPLNIV 375

Query: 236 ----FVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKR 291
                V       GF+GAPI +  + W M ++L ++   I  +  +CW          ++
Sbjct: 376 MSYLLVWNPVIGLGFIGAPIAVALNFWCMFLLLLLYC--IYFNGSKCWGGLS------RK 427

Query: 292 VFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFA 351
            F HW+ L  LA PG++MLEAE +S E LTL S+Y G   +A+Q+ ++   +++Y IP+A
Sbjct: 428 AFDHWKDLSKLAVPGIIMLEAEDMSSEILTLFSSYLGTEYLAAQSAVSTTVAMLYMIPYA 487

Query: 352 IGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEV 411
           +G  +S R+A Y+G+    NA++  +     +++VG+  C  +      + R+++++ EV
Sbjct: 488 VGISVSTRIAQYIGARNPDNARLASRVGIASSAVVGIVNCTMLILGRDLIPRIYSSDAEV 547

Query: 412 VELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGP 471
           + L   +  +L + +I+DA N    +            + N++ YY+ ++PLG  L++  
Sbjct: 548 IRLMREILPLLGLVEIFDALNAIAGSCLRGQGMQYVGSVVNLVVYYLFAIPLGMLLSW-T 606

Query: 472 LKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECN 511
             +KL+GLW G G G+L++ L   +Y+  +DW ++I    
Sbjct: 607 FDMKLSGLWVGIGSGMLVIGLIEGYYVLFADWDMLIDRAE 646

>KLLA0A06952g complement(628173..630323) similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 716

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/479 (35%), Positives = 275/479 (57%), Gaps = 23/479 (4%)

Query: 52  GSDFEEPLDGAQTLRAECISILRS-SLPISMAFLMEFSMTICSLFIIGHLCTAMELASAS 110
           GS  EE L  A+      + +L S S+P+   FL+E    +     +GHL    ELA+ S
Sbjct: 222 GSMKEEDLSHAKVTANSELKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGRT-ELAAVS 280

Query: 111 LAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLT---AI 167
           LA MT NIT  ++ EG+AT+LDT+CP AYGS  Y  VG++  R    IM   ++      
Sbjct: 281 LASMTTNIT-YAIFEGIATSLDTLCPLAYGSGNYYSVGVHMQR---CIMFSFTVFIPFGF 336

Query: 168 IWFFSASWLQLLIP-EADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVL 226
           IW++S + L L++P E +LI     +LR+ ILG PA ++F + KR+LQAQ +++A  YVL
Sbjct: 337 IWWWSETLLTLVMPHEPELIHMTAKFLRVSILGAPAYIIFESLKRFLQAQGIFDAGIYVL 396

Query: 227 AIVFP--LTIVFVLGFTRH--FGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPF 282
            I  P  + + + L +      GF+GAPI +V + W MV +L ++A  I  D  +CW  F
Sbjct: 397 MICAPWNMFVSYTLVWNERIGMGFIGAPIAVVLNFWTMVTLLSLYA--IYVDGYKCWGGF 454

Query: 283 MQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLS 342
              S        HW+ L +LA PG+VMLEAE LS E LTL S+YFG   +A+Q+ ++  +
Sbjct: 455 NSKS------LKHWKALSELAVPGIVMLEAEDLSYEILTLFSSYFGTPYLAAQSAVSTTA 508

Query: 343 SLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLA 402
           +L+Y IPF++G   S R+ +++G      A+++ +     +  VG+  CL +    + +A
Sbjct: 509 ALLYMIPFSVGISSSTRIGNFIGCRRPNCAKLSAELGIGSSLFVGLLNCLIINVDKRSIA 568

Query: 403 RLFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLP 462
            ++T +EEV++L   +  ++ + +I+D+ N    +            I N++ Y++V++P
Sbjct: 569 NIYTKDEEVIQLMCQLLPLVGIVEIFDSLNAISGSCLRGLGLQYIGSIVNLVVYHLVAIP 628

Query: 463 LGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVEND 521
           LG +LA+  + +KL GLW G G+G+LI+ L  S+Y+  +DW  +++   KR + + + D
Sbjct: 629 LGIFLAW-YMDMKLNGLWIGIGVGMLIIGLVQSYYVIFADWNDVMERAEKRRDHDRDAD 686

>CAGL0M01078g 118018..120105 highly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 695

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 176/496 (35%), Positives = 277/496 (55%), Gaps = 22/496 (4%)

Query: 22  YRSINAGNYADDA--VSGSYSVVVNSRYAMLCGSDFEEP-LDGAQTLRAECISILRSSLP 78
           Y SI +  Y      +S S    V + Y  + G+D  +  L    T R E   +   S P
Sbjct: 177 YDSIASHKYRRRPSLISVSSRGTVPTIYQEINGTDGADVCLPEKITFREEAKVLSSFSFP 236

Query: 79  ISMAFLME--FSMTICSLFIIGHLCTAMELASASLAVMTYNITGLSLVEGLATALDTVCP 136
           +   FL+E  F M +CSL  +GHL    +LA+ SLA MT NIT L++ EG+AT+LDT+CP
Sbjct: 237 LIFTFLLEQIFPM-VCSL-TVGHLGKN-QLAAVSLASMTSNIT-LAVFEGIATSLDTLCP 292

Query: 137 QAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLIPEADLIPKIQLYLRIM 196
           QAYG+ RY  VG++F R      +     A+ WFFS   L L++PE +LI     +LR++
Sbjct: 293 QAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFLVVPEKELIALTSQFLRVL 352

Query: 197 ILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV--FVLGFTRHFG--FVGAPIG 252
           I G PA +LF   KR+LQAQ +++A  YVL I  PL I   + L + ++ G  F+G+ + 
Sbjct: 353 IFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFVSYTLVWNKYIGIGFIGSAVA 412

Query: 253 IVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVMLEA 312
           +V + WLM I+L ++  +I  D  +CW  F       K+ FTHW+ L  LAF G++MLEA
Sbjct: 413 VVINFWLMFILLLLY--TIYIDGKKCWGGFS------KKAFTHWKDLGHLAFSGIIMLEA 464

Query: 313 EFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRVAHYVGSGLIKNA 372
           E LS E LTL S YFG + +A+Q+ ++ +++L+Y +PFAIG   S R+A+++G+  +  A
Sbjct: 465 EELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISASTRIANFIGAKRVDLA 524

Query: 373 QMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSYILAVNQIYDAFN 432
               +     +   G++ C  + F    +A +F+ ++EV++L   +  ++AV QI+D+ N
Sbjct: 525 HNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDLMTGLLRLVAVVQIFDSLN 584

Query: 433 TFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGILILAL 492
               +            I N++ YY+  +PL   L +    +KL GLW G G  +L++ L
Sbjct: 585 AVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGW-VFNMKLYGLWIGIGCAMLLIGL 643

Query: 493 AFSWYIYNSDWQLIIQ 508
             ++ +   +W  I+ 
Sbjct: 644 IEAYNVLYPNWDYILN 659

>Kwal_23.5586
          Length = 607

 Score =  268 bits (686), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/478 (32%), Positives = 266/478 (55%), Gaps = 23/478 (4%)

Query: 56  EEPLDGAQ----TLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASL 111
           EE L   +    T R EC  +++++ P+   F+M+ S+++ S+F    L    EL   +L
Sbjct: 138 EEALKSGKNITTTYRRECQVLVKNAFPLVFTFVMQNSLSLASVFTTSRL-GIKELGGITL 196

Query: 112 AVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFF 171
             MT NITG + ++GL T LDT+C QAYG++ Y  VG+   R + + ++  +    +W+F
Sbjct: 197 GSMTANITGFAAIQGLCTCLDTLCSQAYGAKNYQLVGILLQRCAIITIIFFTPILFMWWF 256

Query: 172 -SASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVF 230
            S + L  +IPE +L      YL+I+ LG+P  V F  GKR+LQ Q ++ AST VL    
Sbjct: 257 WSEAILAAVIPERELCKLAANYLKIVALGVPGFVFFECGKRFLQCQGIFHASTIVLLFCA 316

Query: 231 PLTIV--FVLGFTRHFG--FVGAPIGIVTSQWLMVIILFVFA----RSIRPDTLRCWYPF 282
           P   +  ++L   + FG  ++GAPI +  + WLM + L  +       I P   +CW   
Sbjct: 317 PFNAIMNYMLVLDKRFGIGYIGAPISVALNYWLMALGLLFYTIFTKHKINPR--KCWSGT 374

Query: 283 MQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLS 342
           ++ +    +VF +W+ ++ LA PG+VM+EAEFL  E LT+ +++ G + + +Q++++ ++
Sbjct: 375 IKPN----QVFKNWKKMFSLALPGVVMVEAEFLGFEILTIFASHLGTSELGAQSIVSTIA 430

Query: 343 SLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLA 402
           SL YQ+PF+I    S RVA+++G+ L +N   T K S  L+++V       + F   PLA
Sbjct: 431 SLAYQVPFSISISTSTRVANFIGASLYRNCIATCKVSLLLSTVVSFFNMSAIYFFRVPLA 490

Query: 403 RLFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLP 462
             F+   EV+ L  +V  +LA  Q++DAFN   A               N++A+Y + +P
Sbjct: 491 HAFSKESEVISLVVNVLPLLAFMQLFDAFNACTAGCLRGQGQQKIGGYINVLAFYCIGIP 550

Query: 463 LGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKR--ENTEV 518
           + ++L F    L +AGLWYG    ++ +++  S+ +++ +++ +I+    R  EN  V
Sbjct: 551 MSYFLTF-KCNLGMAGLWYGITSALIFMSIFQSYAVFSCNYKEVIKAAKYRNSENNRV 607

>KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces
           cerevisiae YHR032w ERC1 ethionine resistance protein,
           start by similarity
          Length = 610

 Score =  266 bits (681), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 275/473 (58%), Gaps = 22/473 (4%)

Query: 56  EEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMT 115
           E   D   T + E I I  ++ P+ + F+++ S+++ S+F + HL  + EL + +L  MT
Sbjct: 145 ESGKDINTTFKREAIVITSNASPLVLTFILQNSLSLASIFSVSHL-GSNELGAVTLGSMT 203

Query: 116 YNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAII--WFFSA 173
            +ITG + ++GL T LDT+C QAYG   Y  VG+ F R  A+I + +SL  +   W +S 
Sbjct: 204 ASITGFAAIQGLCTCLDTLCAQAYGGNHYHLVGVLFQR-CAIITIILSLPVLFTWWQWSE 262

Query: 174 SWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLT 233
             L L IPE +L      YL+I+ LGIPA +LF  GKR+LQ Q ++ AS+ VL +  PL 
Sbjct: 263 QILALFIPERELCALAAKYLQIVSLGIPAFILFECGKRFLQCQGIFHASSIVLLVCAPLN 322

Query: 234 IV--FVLGFTRHFG--FVGAPIGIVTSQWLMVIILFVFARSIR--PDTLRCWYPFMQSSH 287
            +  +VL + ++ G  ++GAPI +V + WLM + LF +    +   + ++CW  F++   
Sbjct: 323 ALMNYVLVWDKNIGIGYLGAPISVVLNYWLMALGLFAYTLYTKNEKNPMKCWNGFIKP-- 380

Query: 288 HFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQ 347
              ++  + R +++LA PG++M+EAEFL  E LT+ +++ G + +A+Q++I+ ++SL YQ
Sbjct: 381 --HQILKNSRKMFNLALPGIIMVEAEFLGFEILTIFASHLGTHELAAQSIISTIASLAYQ 438

Query: 348 IPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKP---LARL 404
           +PF+I    S RVA+++G+ L ++  +T K S  L+ I+     L +A + K    +ARL
Sbjct: 439 VPFSISISTSTRVANFIGASLYRSCVITCKVSLLLSFIIS---SLNMAMIYKARYLIARL 495

Query: 405 FTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLG 464
           F++  +VV L  S   ILA  QI+DAFN   A               N+ A+Y + +P+ 
Sbjct: 496 FSSEPDVVRLVSSSLPILAFMQIFDAFNASTAGCLRGQGQQKIGGYINVFAFYCIGIPVS 555

Query: 465 WWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTE 517
           + L F      ++GLW+G   G++ +++  S+ +++ +W  II+    R N+E
Sbjct: 556 YLLTF-HYGFGVSGLWWGITSGLVFMSIFQSYAVFHCNWNDIIRAAKSR-NSE 606

>YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Member
           of the multiple antimicrobiotic resistance (MAR) family
           of membrane transporters [2088 bp, 695 aa]
          Length = 695

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 170/467 (36%), Positives = 270/467 (57%), Gaps = 22/467 (4%)

Query: 64  TLRAECISILRSSLPISMAFLME--FSMTICSLFIIGHLCTAMELASASLAVMTYNITGL 121
           T ++E   +   S P+   FL+E  F M +CSL  +GHL    ELA+ SLA MT NIT L
Sbjct: 224 TFKSEARVLASYSFPLIFTFLLEQIFPM-VCSL-TVGHLGKN-ELAAVSLASMTSNIT-L 279

Query: 122 SLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFFSASWLQLLIP 181
           ++ EG+AT+LDT+CPQAYGS R+  VG++  R  A  +V     A++W++S   L  +IP
Sbjct: 280 AIFEGIATSLDTLCPQAYGSGRFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIP 339

Query: 182 EADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV--FVLG 239
           E +LI     +LR++ILG PA + F   KR+LQAQ +++A  YVL I  PL ++  + L 
Sbjct: 340 EKELINLTSRFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLV 399

Query: 240 FTRHFG--FVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFKRVFTHWR 297
           + ++ G  F+GA I +V + WLM  +L  +A  I  D  +CW  F       ++ FTHW 
Sbjct: 400 WNKYIGVGFIGAAIAVVLNFWLMFFLLLFYALYI--DGRKCWGGFS------RKAFTHWN 451

Query: 298 PLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVIS 357
            L  LAF G++MLEAE LS E LTL S Y+GV+ +A+Q+ ++ +++L+Y IPFAIG   S
Sbjct: 452 DLGHLAFSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTS 511

Query: 358 NRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHS 417
            R+A+++G+     A ++ +     + I G   C  + F    +A +++ + EV++L   
Sbjct: 512 TRIANFIGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQ 571

Query: 418 VSYILAVNQIYDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLA 477
           V  ++ + Q +D+ N    +            I N++AYY+  +PL   L++    +KL 
Sbjct: 572 VLPLVGIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSWF-FDMKLY 630

Query: 478 GLWYGCGIGILILALAFSWYIYNSDWQLII---QECNKRENTEVEND 521
           GLW G G  +L++ L  ++Y+   DW  I+   +   + E+ EV++D
Sbjct: 631 GLWIGIGSAMLLIGLVEAYYVLFPDWDKIMTYAEILKETEDDEVDSD 677

>AER234W [2736] [Homologous to ScYHR032W - SH]
           complement(1071224..1073068) [1845 bp, 614 aa]
          Length = 614

 Score =  262 bits (669), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 162/483 (33%), Positives = 275/483 (56%), Gaps = 27/483 (5%)

Query: 53  SDFEEPLDGAQTL----RAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELAS 108
           S +E  ++  +T+    + E   + +++LP+   F+++ S+++ S+F + HL T  EL  
Sbjct: 141 SAWEHAIESGKTITTSYKRESTVLTKNALPLVATFILQNSLSLASVFSVSHLGTK-ELGG 199

Query: 109 ASLAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAII 168
            +L  MT NITG + ++GL T LDT+C QAYG++ Y+ VGL   R    I+  +    ++
Sbjct: 200 ITLGSMTANITGFAAIQGLCTCLDTLCSQAYGARNYTLVGLLLQR--CCIISLLVFAPVV 257

Query: 169 WF---FSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYV 225
           W    +S   L  L+ + +L      YLRI+  G+PA +LF  GKRYLQ Q +Y AST V
Sbjct: 258 WLWVCYSEQVLGYLVSDPELCLFAAKYLRIVAAGLPAFILFECGKRYLQCQDIYHASTIV 317

Query: 226 LAIVFP----LTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILF---VFARS-IRPDTLR 277
           L    P    L  + V       G++GAP+ +V + WLMV+ L    +F +S I+P   +
Sbjct: 318 LLFCAPANAFLNYLLVWNSKVGIGYLGAPVSVVLNYWLMVLGLLLYTIFTKSEIQPR--K 375

Query: 278 CWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTV 337
           CW  +++      ++F ++  +  LA PG++M+EAEFL  E LT+ +++  VNA+A+Q++
Sbjct: 376 CWTGWIKP----HQIFKNYDKMLGLALPGIIMVEAEFLGFEILTIFASHISVNALAAQSI 431

Query: 338 IANLSSLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFL 397
           IA ++SL YQIPF+I    S RVA+++G+ L ++  +T K S  L+  V ++  L +   
Sbjct: 432 IATIASLAYQIPFSISISTSTRVANFIGASLYRSCIITCKVSLLLSFGVSLTSMLAIFVF 491

Query: 398 NKPLAR-LFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAA-IXXXXXXXXXXXIWNMIA 455
              LA  LF N  EV+ L  +   ILAV QI+D+FN   A  +           + N+ A
Sbjct: 492 RSNLAHILFLNEAEVIMLIETTLPILAVMQIFDSFNASTAGCLRGQGQQKDWWLLSNVFA 551

Query: 456 YYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKREN 515
           +Y + +P+ ++L+F    L + GLWYG    ++++++  S+ ++N  W+ +++  N R +
Sbjct: 552 FYCIGIPMSYFLSF-HCDLGVKGLWYGITCALIVMSVCQSYAVFNCSWEELVKAANLRTS 610

Query: 516 TEV 518
            +V
Sbjct: 611 EDV 613

>CAGL0J00495g complement(40807..42804) similar to sp|P38767
           Saccharomyces cerevisiae YHR032w ERC1 ethionine
           resistance protein, start by similarity
          Length = 665

 Score =  254 bits (650), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 147/450 (32%), Positives = 251/450 (55%), Gaps = 14/450 (3%)

Query: 75  SSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITGLSLVEGLATALDTV 134
           ++ P+   F+++ S+++ S+F + HL T  EL   +L  MT NIT L+ ++GL T LDT+
Sbjct: 219 NAFPLVFTFILQNSLSLASIFSVSHLGTK-ELGGVTLGSMTANITCLAAIQGLCTCLDTL 277

Query: 135 CPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWFF-SASWLQLLIPEADLIPKIQLYL 193
           C QAYG++    VG+   R + +  +       IWFF S   L  +IPE +L      YL
Sbjct: 278 CSQAYGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMIPEKELCSLAASYL 337

Query: 194 RIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV--FVLGFTRHFG--FVGA 249
           +I  +G+P  + F  GKR+LQ Q ++ AST VL I  PL  +  ++L + ++ G  ++GA
Sbjct: 338 KITAIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYILVWDKNIGIGYLGA 397

Query: 250 PIGIVTSQWLMVIILFVFARSIR--PDTLRCWYPFMQSSHHFKRVFTHWRPLWDLAFPGL 307
           P  +  S W M + L  +    +   + ++CW   ++ +    ++F +W+ +++LA PG+
Sbjct: 398 PTSVAISYWAMALGLLAYTVLTKHPANPMKCWNGVIKPN----QLFRNWKKMFNLALPGI 453

Query: 308 VMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRVAHYVGSG 367
           +M+EAEFL  E LT+ ++  G   + +Q+++A ++SL YQ+PF+I    S RVA+++G+ 
Sbjct: 454 IMVEAEFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISVSTSTRVANFIGAS 513

Query: 368 LIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSYILAVNQI 427
           L K+  +T K S  L+        L +    K +A LF++ E+VV L  S   ILA  Q+
Sbjct: 514 LYKSCIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSLVVSTLPILAFMQL 573

Query: 428 YDAFNTFGAAIXXXXXXXXXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGI 487
           +DAFN   A               N+ A+Y + +P+ + LAF      + GLWYG    +
Sbjct: 574 FDAFNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAF-VFNTGVGGLWYGITCAL 632

Query: 488 LILALAFSWYIYNSDWQLIIQECNKRENTE 517
           +++++   + +++ DW+ II E  K  N+E
Sbjct: 633 VMMSICQGYAVFHCDWKQII-EAAKVRNSE 661

>Scas_373.1
          Length = 694

 Score =  254 bits (648), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 165/483 (34%), Positives = 273/483 (56%), Gaps = 30/483 (6%)

Query: 41  VVVNSRYAMLCGSDFEEPLDGAQ---------TLRAECISILRSSLPISMAFLME--FSM 89
           + +NSR ++   + ++E +D A+         T ++E   +   S P+   FL+E  F M
Sbjct: 188 ISINSRGSV--PTIYQEDIDSAEFDRLAHEDVTFKSEAKVLASYSFPLIFTFLLEQIFPM 245

Query: 90  TICSLFIIGHLCTAMELASASLAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGL 149
            +CSL  +GHL    +LA+ SLA MT NIT L++ EG+AT+LDT+CPQAYGS RY  VG+
Sbjct: 246 -VCSL-TVGHLGKN-QLAAVSLASMTSNIT-LAVFEGIATSLDTLCPQAYGSGRYFSVGI 301

Query: 150 YFLRGSAMIMVGMSLTAIIWFFSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTG 209
           +  R  A  +V     A  W++S   L L++PE +LI     +L+++ILG PA + F   
Sbjct: 302 HLQRCIAFSLVIFIPFAFFWYYSEPILYLVVPEKELIHLTSQFLKVLILGAPAYIFFENL 361

Query: 210 KRYLQAQAVYEASTYVLAIVFPLTIV--FVLGFTRHFG--FVGAPIGIVTSQWLMVIILF 265
           KRYLQAQ +++A  YVLAI  P  I+  + L + ++ G  F+G+ + +V + WLM  +L 
Sbjct: 362 KRYLQAQGIFDAGIYVLAICAPTNILVSYTLVWNKYIGIGFIGSAVAVVLNFWLMFFLLL 421

Query: 266 VFARSIRPDTLRCWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLIST 325
            +  +I+ +  +CW  F       ++  THW+ L  LA  G++MLEAE LS E LTL S 
Sbjct: 422 FY--TIKFEGGKCWGGFS------RKALTHWKDLGHLALSGIIMLEAEELSYELLTLFSA 473

Query: 326 YFGVNAIASQTVIANLSSLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASI 385
           YFG + +A+Q+ ++ +++L+Y +PFAIG   S R+A+++G+     A ++ K     +  
Sbjct: 474 YFGASYLAAQSAVSTMAALLYMVPFAIGISTSTRIANFIGARRTDCAHISSKVGLTFSFG 533

Query: 386 VGVSMCLFVAFLNKPLARLFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAIXXXXXXX 445
            G+  C  +      +A +F+ +EEV  L  ++  ++ + Q +D+ N    +        
Sbjct: 534 AGLINCSLLILGRHFIANIFSKDEEVKTLISNLLPLVGIVQNFDSLNAVAGSCLRGQGMQ 593

Query: 446 XXXXIWNMIAYYIVSLPLGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQL 505
               I N+++YY+  +PL   L++    +KL GLW G G  +L++ L  S+Y+   +W  
Sbjct: 594 SLGSIVNLLSYYLFGIPLALILSWH-FDMKLNGLWVGIGSAMLLIGLIESYYVLFPNWNA 652

Query: 506 IIQ 508
           I+ 
Sbjct: 653 IMN 655

>YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the
           multiple antimicrobiotic resistance (MAR) family of
           membrane transporters [1746 bp, 581 aa]
          Length = 581

 Score =  238 bits (606), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 136/379 (35%), Positives = 220/379 (58%), Gaps = 14/379 (3%)

Query: 62  AQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASASLAVMTYNITGL 121
           + T + E   I  ++LP+   F+++ S+++ S+F + HL T  EL   +L  MT NITGL
Sbjct: 158 STTFKRETQVITMNALPLIFTFILQNSLSLASIFSVSHLGTK-ELGGVTLGSMTANITGL 216

Query: 122 SLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWF-FSASWLQLLI 180
           + ++GL T LDT+C QAYG++ Y  VG+   R + + ++       +WF +S   L L+I
Sbjct: 217 AAIQGLCTCLDTLCAQAYGAKNYHLVGVLVQRCAVITILAFLPMMYVWFVWSEKILALMI 276

Query: 181 PEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVFPLTIV----F 236
           PE +L      YLR+   G+P  +LF  GKR+LQ Q ++ AST VL +  PL  +     
Sbjct: 277 PERELCALAANYLRVTAFGVPGFILFECGKRFLQCQGIFHASTIVLFVCAPLNALMNYLL 336

Query: 237 VLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDT--LRCWYPFMQSSHHFKRVFT 294
           V       G++GAP+ +V + WLM + L ++A + +     L+CW   +     FK    
Sbjct: 337 VWNDKIGIGYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKCWNGIIPKEQAFK---- 392

Query: 295 HWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPFAIGC 354
           +WR + +LA PG+VM+EAEFL  E LT+ +++ G +A+ +Q+++A ++SL YQ+PF+I  
Sbjct: 393 NWRKMINLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIASLAYQVPFSISV 452

Query: 355 VISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFV-AFLNKPLARLFTNNEEVVE 413
             S RVA+++G+ L  +  +T + S  L S V  SM +FV     + +A LF+    VV+
Sbjct: 453 STSTRVANFIGASLYDSCMITCRVSL-LLSFVCSSMNMFVICRYKEQIASLFSTESAVVK 511

Query: 414 LAHSVSYILAVNQIYDAFN 432
           +      +LA  Q++DAFN
Sbjct: 512 MVVDTLPLLAFMQLFDAFN 530

>Kwal_47.18343
          Length = 372

 Score = 32.3 bits (72), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 370 KNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEEVVELAHS 417
           K+ +  +   Y LA ++G+++C+   F+ KP   +F +N   +E A S
Sbjct: 205 KDTKSPVDTIYQLAPVMGLTLCVTAMFVEKPFPAVFKSNLFQIEDAFS 252

>YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R,
          3R)-2,3-butanediol dehydrogenase with similarity to
          alcohol/sorbitol dehydrogenases, member of the
          zinc-containing alcohol dehydrogenase family [1149 bp,
          382 aa]
          Length = 382

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 40 SVVVNSRYAMLCGSDFEEPLDGA--QTLRAECISILRSSLPISMAFLM 85
           V+++  +  +CGSD  E LDG        EC  +  ++LP++M   M
Sbjct: 28 EVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEM 75

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score = 30.0 bits (66), Expect = 6.7,   Method: Composition-based stats.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 23/141 (16%)

Query: 276  LRCWYPFMQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQ 335
            LR  +PFM  S     VFT         FP L+      LS+   +   T+  +  I+S 
Sbjct: 1094 LRALFPFMSDSLRSSEVFTR--------FPVLLTFLRSNLSVFRYSAARTFADLAKISSV 1145

Query: 336  TVIANLSSLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVA 395
             V+A      Y I   +  + S        +G + + Q + +  Y L+  +   +  +V 
Sbjct: 1146 EVMA------YTIREILPLMNS--------AGSLSDRQGSTELIYHLSLSMETDVLPYVI 1191

Query: 396  FLNKP-LARLFTNNEEVVELA 415
            FL  P L R+  +NE+V  LA
Sbjct: 1192 FLIVPLLGRMSDSNEDVRNLA 1212

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,534,969
Number of extensions: 540109
Number of successful extensions: 1690
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1660
Number of HSP's successfully gapped: 25
Length of query: 525
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 419
Effective length of database: 12,926,601
Effective search space: 5416245819
Effective search space used: 5416245819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)