Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL062W32732117270.0
Sklu_1023.23523487428e-97
Kwal_47.181843373226895e-89
KLLA0C10318g3333276679e-86
Scas_690.373323326087e-77
CAGL0D03916g3443345759e-72
YHR034C3443555358e-66
Scas_694.21313155720.42
Scas_690.33142345691.4
KLLA0D11022g35977644.0
Kwal_26.681066422645.3
Kwal_26.732465083627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL062W
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   669   0.0  
Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           290   8e-97
Kwal_47.18184                                                         270   5e-89
KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   261   9e-86
Scas_690.37                                                           238   7e-77
CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   226   9e-72
YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   210   8e-66
Scas_694.21                                                            32   0.42 
Scas_690.33                                                            31   1.4  
KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyce...    29   4.0  
Kwal_26.6810                                                           29   5.3  
Kwal_26.7324                                                           28   7.9  

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/321 (100%), Positives = 321/321 (100%)

Query: 1   MDFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLPDVP 60
           MDFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLPDVP
Sbjct: 1   MDFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLPDVP 60

Query: 61  FDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLREIL 120
           FDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLREIL
Sbjct: 61  FDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLREIL 120

Query: 121 VEWCLESCELRQSVGISREAVVFPRMKSKGALPAVEVLQQDLTHDYKHEIAENSSLGMDD 180
           VEWCLESCELRQSVGISREAVVFPRMKSKGALPAVEVLQQDLTHDYKHEIAENSSLGMDD
Sbjct: 121 VEWCLESCELRQSVGISREAVVFPRMKSKGALPAVEVLQQDLTHDYKHEIAENSSLGMDD 180

Query: 181 PRQILHMRGALDEEASGDDGTLPSLFPERPATRPLIEEVNTGRHSASVEAPKTLPACGLP 240
           PRQILHMRGALDEEASGDDGTLPSLFPERPATRPLIEEVNTGRHSASVEAPKTLPACGLP
Sbjct: 181 PRQILHMRGALDEEASGDDGTLPSLFPERPATRPLIEEVNTGRHSASVEAPKTLPACGLP 240

Query: 241 RLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQAYEPKEICI 300
           RLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQAYEPKEICI
Sbjct: 241 RLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQAYEPKEICI 300

Query: 301 PLPGVVAGTRSMRALFLKRSN 321
           PLPGVVAGTRSMRALFLKRSN
Sbjct: 301 PLPGVVAGTRSMRALFLKRSN 321

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  290 bits (742), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 157/348 (45%), Positives = 204/348 (58%), Gaps = 39/348 (11%)

Query: 2   DFLLRPIDSKE--CSVITFVPTPGFVIKSKLEHGKDAT-LVVGTKTFVNVCHHTQVPLPD 58
           +FLLRPI+S E   SV+   P PGFVIKSKL+     T L +GTK F+NVC   QVP P+
Sbjct: 4   NFLLRPINSTESTASVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPKPN 63

Query: 59  VPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLRE 118
             F+ SIVYPLIM N+WEIPI+TS VR D DKKG  CYVWDCCIN+ECM W+ KDYQLRE
Sbjct: 64  TEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQLRE 123

Query: 119 ILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAENSSLG 177
           ILVEWCLESCELRQSV ISR+ + FP++K KG  +P +E+L  DL  D++ EI       
Sbjct: 124 ILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVEKD 183

Query: 178 MDDPRQILHMR---------GALDEEASGDDGTLPSLFPERPAT--------RPLIEEVN 220
             DP  IL M+         G        D GTLP LFP    T        +PLIEE+ 
Sbjct: 184 RTDPTSILEMQRDLVFGETLGGRKNNGDEDTGTLPPLFPTTATTTTNNTTQKKPLIEEIQ 243

Query: 221 T---------GRHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGH 271
                      R   ++  PKT        LE+  TM + ++D  +K+K+++ S L+S  
Sbjct: 244 DLSIREKQAETRKPRAIVEPKT--------LEYQATMVKTKDDKKFKLKIEIISELDSSL 295

Query: 272 AYSVHYDGKENSLLVTSTS-QAYEPKEICIPLPGVVAGTRSMRALFLK 318
            YS+ YD K + L + + +   Y  K++ IPLP +      ++  F+K
Sbjct: 296 DYSIKYDVKNSVLAIKNINLHLYNEKKLEIPLPKIFEEQPDIKCFFIK 343

>Kwal_47.18184
          Length = 337

 Score =  270 bits (689), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 201/322 (62%), Gaps = 17/322 (5%)

Query: 1   MDFLLRPIDSKEC---SVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLP 57
           M FLLR ID+      SV+   P PGFV+KSKL    D    +G K FVNVCH  QVP P
Sbjct: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQP 60

Query: 58  DVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLR 117
           ++PF+ S+VYPLIM N+WEIPI+ SA+R+D DKKG  CYV DCCINS CMQW   + QLR
Sbjct: 61  EIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLR 120

Query: 118 EILVEWCLESCELRQSVGISREAVVFPRMKSKGA--LPAVEVLQQDLTHDYKHEIAENSS 175
           EILVEWCLESCELRQ + ISRE + FP+++ KGA  LP +EVL  DL  D++HE+ + + 
Sbjct: 121 EILVEWCLESCELRQRIEISREHLAFPKLRMKGASILP-LEVLTTDLHADFRHEMRDLAK 179

Query: 176 LGMDDPRQILHMRGALD----EEASGDDGTLPSLFPERPATRPLIEEVNTGRHSASVEAP 231
               +P  IL ++  L     +  S D   LP LFP +  TR LI+E+++   S S +AP
Sbjct: 180 REA-EPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDST--STSSQAP 236

Query: 232 KTLPACGLPRLE--FAVTMGRPR-NDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTS 288
               +   P  +  F ++MG+P   ++  K+++ + S L +   Y + Y+  EN+L ++ 
Sbjct: 237 AKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISH 296

Query: 289 TSQA-YEPKEICIPLPGVVAGT 309
           T+   + PKEI I LP VV  +
Sbjct: 297 TNTTHFLPKEITIALPHVVVSS 318

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  261 bits (667), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 202/327 (61%), Gaps = 12/327 (3%)

Query: 1   MDFLLRPIDSKECS----VITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPL 56
           M FLLRP++    +    VI   P P FV+KSK+ +    +L    K F+N+CH+ Q+PL
Sbjct: 1   MSFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60

Query: 57  PDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQL 116
           P++ F+ +IVYPLI+ N+WEIPIVTS++R D DKKG  CYV DCCIN++C+ WI+ D QL
Sbjct: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120

Query: 117 REILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAENSS 175
           REI+VEWCLESCELR  + ISR+ + FP++K KG  +P +E+L++DLT +Y+  I +  +
Sbjct: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180

Query: 176 LGMDDPRQILHMRGALDEEASGDDGTLPSLFPERPATR--PLIEEV-NTGRHSASVEAPK 232
               +P  I+  R     E     G LP L P   ++R  PLIEE+ +   H    + PK
Sbjct: 181 REQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSRRKPLIEEIEDLSLHET--KKPK 238

Query: 233 TLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQA 292
            +       + + ++MG+P++ + + +K++V S LNS   Y++ YD K N L++ +T+  
Sbjct: 239 -VEEIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKNTNLG 297

Query: 293 -YEPKEICIPLPGVVAGTRSMRALFLK 318
            Y  K++ +PLP +      +   F+K
Sbjct: 298 IYPEKKLKVPLPDIFNNPPKLECFFVK 324

>Scas_690.37
          Length = 332

 Score =  238 bits (608), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 195/332 (58%), Gaps = 26/332 (7%)

Query: 2   DFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLPDVPF 61
           DFL+RPI + +  +IT  PTP FVIKSKL           +K F+NVC    VP P +PF
Sbjct: 7   DFLIRPISTAQDPIITIHPTPKFVIKSKLTPT-------NSKLFINVCQDANVPSPSIPF 59

Query: 62  DASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLREILV 121
             ++VYPLIM ++WEIPI+TS +R+D DKKG  C+V DC IN +CMQWI KD QLREIL+
Sbjct: 60  QPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCMQWIAKDLQLREILI 119

Query: 122 EWCLESCELRQSVGISREAVVFPRMKSKGA--LPAVEVLQQDLTHDYKHEIA----ENSS 175
           EWCLE+ ELR++V + R+AV  P++  KG+  LP +E+ +++L  D+K +IA    EN+ 
Sbjct: 120 EWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERDFKRDIASIIEENT- 178

Query: 176 LGMDDPRQILHMRGALDEEASGDDGTLPSLFPERPATR-PLIEEVNTGRHSASV---EAP 231
             +D+P ++L ++   +++    D TLP LFP+    + PLIEE++       +   E  
Sbjct: 179 --VDEPVKVLQLKRTQNDDP---DDTLPPLFPQSGNVQGPLIEEIDVDMDDLKITKQEPT 233

Query: 232 KTLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTSTSQ 291
            +  +  L  L F   M +  N   YK+++ + S ++S     + YD   N L++ + + 
Sbjct: 234 SSRTSPLLKDLHFETVMRKTNNTQRYKLRIDITSEIDSSLDLHLAYDRTNNELILQNLNT 293

Query: 292 A-YEPKEICIPLPGVVA--GTRSMRALFLKRS 320
             +  K+I IPLP +      +     F+K+ 
Sbjct: 294 VEFIEKKIKIPLPNIFTYENIKQSECFFIKKQ 325

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  226 bits (575), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 130/334 (38%), Positives = 191/334 (57%), Gaps = 26/334 (7%)

Query: 1   MDFLLRPIDSKECSVITFV-PTPGFVIKSKLEH-----GKDATLVVGTKTFVNVCHHTQV 54
           MDFLLRPI S + + +T + P P FVIKSK+ +      K   L  G+K FVN+CH  Q 
Sbjct: 1   MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60

Query: 55  PLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDY 114
           P P++PFD +IVYPLI+ NKWEIPIV S++R D DKKGQ CYV DCC+ S+C++W  +DY
Sbjct: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120

Query: 115 QLREILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAEN 173
           QL+EI+VEWCLE+ ELR+ + ISR+ + FP+M+ KG ++P +E+   +L      E  +N
Sbjct: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEATQN 180

Query: 174 SSLGMDDPRQILHMRGAL-----DEEASGDDGT----LPSLFPERPAT--RPLIEEVNTG 222
                +DP  +L +R  L     D   S D       LP LFP+   T  R LI+E++  
Sbjct: 181 DK--GNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPKANETKGRSLIQEIDDL 238

Query: 223 RHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVA-SALNSGHAYSVHYDGKE 281
                 E PK         +E+ V M +  N   YK+++ +   ++      ++ YD   
Sbjct: 239 TLK---EKPKNAAKKVQKNIEYNVVMKKIEN-HKYKLRLDIQIDSITGKSDLNIFYDPTN 294

Query: 282 NSLLVTS-TSQAYEPKEICIPLPGVVAGTRSMRA 314
           N +++ +  +  Y+ K+  IPLP +  G   M +
Sbjct: 295 NDIVLRNLNTDLYDQKDFKIPLPNIFEGKDIMNS 328

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  210 bits (535), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 145/355 (40%), Positives = 189/355 (53%), Gaps = 54/355 (15%)

Query: 2   DFLLRPI-------------DSKECSVITFVPTPGFVIKSKLEHGKD-ATLVVGTKTFVN 47
           DFLLRPI             D+ + SV    P   FVIK+KL        L  G K F+N
Sbjct: 3   DFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFIN 62

Query: 48  VCHHTQVPLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECM 107
           VCH   VP P+V F+A IV+PLI++N+WEIPI+TS  R D DKKGQECYVWDCCINS+C 
Sbjct: 63  VCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCS 122

Query: 108 QWIEKDYQLREILVEWCLESCELRQSVGISREAVVFPRMKSKGA-LPAVEVLQQDLTHDY 166
           +WI  D QLREILVEWCLESCE+R SV + R+ + FP+MK KGA LPA+EVL  +L  DY
Sbjct: 123 RWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDY 182

Query: 167 K---HEIAENSSLGMDDPRQIL-HMRGALDEEASGDDGTLPSLFP-ERPATRPLIEEVNT 221
           K   H+I E  +    DP  IL       D+    DDGTLP LFP E   +   IEE++ 
Sbjct: 183 KAKMHKIIEEEA---GDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDK 239

Query: 222 GR----------------HSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVAS 265
                             H    + P           E+ V M R +  A YK+++ + +
Sbjct: 240 NEIAHRNLKQAPAPAPAPHEQQEDVP-----------EYEVKMKRFKG-AAYKLRILIEN 287

Query: 266 -ALNSG-HAYSVHYDGKENSLLVTSTSQAYEPKEICIPLPGV-VAGTRSMRALFL 317
            A NS    +S  Y+  EN L +        P++I +    + +   R  R L++
Sbjct: 288 KAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYI 342

>Scas_694.21
          Length = 313

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 24/155 (15%)

Query: 19  VPTPGFVIKSKLEHGKDATL--VVGTKTF--VNVCHHTQVPLPDVPFDASIVYPLIMENK 74
           +PT   V+++ +   +   L  ++GT+ F  +N+C   +V +P    +           +
Sbjct: 43  LPTKRSVVRACIARSRHVPLQYILGTQPFGLLNICCKPKVLIPRWETE-----------E 91

Query: 75  WEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLREILVEWCLESCELR-QS 133
           W + ++   +R     K     +WD C  S C+  +     LR+ L +   +  +L   +
Sbjct: 92  WAMDLIRGIIRAAMQTKKPILTIWDLCTGSGCIALL-----LRKELSQ---QGIDLEVTA 143

Query: 134 VGISREAVVFPRMKSKGALPAVEVLQQDLTHDYKH 168
           V +S  A+   R  SK     + +L+ D+  D  H
Sbjct: 144 VDVSPAAIQLTRENSKKLKIPIRILKSDILSDQLH 178

>Scas_690.33
          Length = 1423

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 127  SCELRQSVGISREAVVFPRMKSKGALPAVEVLQQDLTHDYKHEIA 171
            S E+ +S   + EAV F   K+K  L + E+L+QD  +D   ++A
Sbjct: 1241 SVEIEKSDNNAEEAVAFSDSKAKTELISPEILKQDANNDQLKDVA 1285

>KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 25  VIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLPDVPFDASIVYPLIMENKWEIPIVTSAV 84
           V++S  ++GK+   VV T +F  + H  +   P    D +   P+I    WE     +A 
Sbjct: 112 VLESIQKYGKNVEHVVVTSSFAAIVHRHRSGDPTFINDETTWNPVI----WEDAREDAAT 167

Query: 85  RRDADKKGQECYVWDCC 101
              A KK  E   WD  
Sbjct: 168 SYVASKKYAEKLAWDFV 184

>Kwal_26.6810
          Length = 664

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 76  EIPIVTSAVRRDADKKGQECYV 97
           E+PI+  A++ D DK+ Q CY+
Sbjct: 553 ELPIIFVALKADLDKQQQRCYI 574

>Kwal_26.7324
          Length = 650

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 4/83 (4%)

Query: 200 GTLPSLFPERPATRPLIEEVNTGRHSASVEAPKTLPACGLPRLEFAVT----MGRPRNDA 255
           G +    P   +  PL+ E N G   +  E  + +P      ++  +       R  ND 
Sbjct: 306 GAVDDRTPYERSVEPLLPEHNNGHGGSVSENAQRIPKSRYSAVDLYLGGNSFFDRKFNDT 365

Query: 256 NYKIKVQVASALNSGHAYSVHYD 278
           N  +  +V   L S   +S+ YD
Sbjct: 366 NVPLNAKVLEKLQSNSIFSMDYD 388

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,514,583
Number of extensions: 448377
Number of successful extensions: 999
Number of sequences better than 10.0: 15
Number of HSP's gapped: 980
Number of HSP's successfully gapped: 15
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)