Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL061C42041220870.0
KLLA0C10296g41840814760.0
Scas_588.1442340914510.0
Kwal_47.1818742141114480.0
YDR300C (PRO1)42841314330.0
CAGL0H01441g42741113850.0
YHR033W42341212621e-173
CAGL0D03894g48546411971e-162
Scas_690.3642441311891e-162
Scas_715.44528100800.092
Kwal_47.18163522108750.33
YER052C (HOM3)52746720.70
KLLA0F27599g52254720.71
YDR007W (TRP1)22443691.3
CAGL0J02882g53046691.9
Sklu_2260.352346673.3
Kwal_23.6125491148646.4
Sklu_1961.362799638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL061C
         (412 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   808   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   573   0.0  
Scas_588.14                                                           563   0.0  
Kwal_47.18187                                                         562   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   556   0.0  
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   538   0.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   490   e-173
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   465   e-162
Scas_690.36                                                           462   e-162
Scas_715.44                                                            35   0.092
Kwal_47.18163                                                          33   0.33 
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    32   0.70 
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...    32   0.71 
YDR007W (TRP1) [863] chr4 (461839..462513) Phosphoribosylanthran...    31   1.3  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    31   1.9  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement         30   3.3  
Kwal_23.6125                                                           29   6.4  
Sklu_1961.3 YMR086W, Contig c1961 3351-5234 reverse complement         29   8.6  

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/412 (96%), Positives = 396/412 (96%)

Query: 1   MDGTDRKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVG 60
           MDGTDRKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVG
Sbjct: 1   MDGTDRKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVG 60

Query: 61  LKTVGTDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKN 120
           LKTVGTDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKN
Sbjct: 61  LKTVGTDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKN 120

Query: 121 AQNTFHELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYT 180
           AQNTFHELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYT
Sbjct: 121 AQNTFHELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYT 180

Query: 181 DNPRTNPDAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIM 240
           DNPRTNPDAKPILVVPDLSQGLP                MATKILAADLATNAGVHTIIM
Sbjct: 181 DNPRTNPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIM 240

Query: 241 KSERPVDMVRIVEFMEWREQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLN 300
           KSERPVDMVRIVEFMEWREQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLN
Sbjct: 241 KSERPVDMVRIVEFMEWREQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLN 300

Query: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRK 360
           KREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRK
Sbjct: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRK 360

Query: 361 ADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
           ADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR
Sbjct: 361 ADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/408 (69%), Positives = 329/408 (80%), Gaps = 1/408 (0%)

Query: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65
           ++F IV+KLGSSSLVDE T EPKLSIMS IVETVVKLRR GHKV+IVSSG IAVGLKT+ 
Sbjct: 3   KQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKTMN 62

Query: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125
              RPKKLS++QAIAAVGQGRLI RWDSLF  F+++IAQIL+TRNDIVDW+QYKNAQNT 
Sbjct: 63  MKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQNTI 122

Query: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185
            ELL+MGV PIVNENDTLS+S +KFGDNDTLSAITA L GADYLFL+TDVDCLYTDNPR 
Sbjct: 123 SELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRA 182

Query: 186 NPDAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERP 245
           NPDAKPILVVPD+SQGLP                M TK++AA+LATNAGVHTIIMKS+ P
Sbjct: 183 NPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSDTP 242

Query: 246 VDMVRIVEFMEWREQ-CTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLNKREF 304
            ++ +IV +M+ R+     ++ D   LQ  E+  L  + VPLHTRFIAN     L  R+F
Sbjct: 243 ENISKIVLYMQERDDGVNELTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHHHLKNRQF 302

Query: 305 WILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKADGS 364
           W+LHGLVS G VIID GAY+ALTRKNKAGLLPAGVI V+GSFHE E +D+K+GVR +DG+
Sbjct: 303 WMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVRDSDGN 362

Query: 365 LDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
           LD+S  L+TVGRARCNY+S E+ KIKGLQS QIE +LGY DSEY+AHR
Sbjct: 363 LDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHR 410

>Scas_588.14
          Length = 423

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/409 (67%), Positives = 328/409 (80%), Gaps = 4/409 (0%)

Query: 8   FTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTD 67
           +T+V+KLGSSSLVDE T EPKL+IMS +VETVVKLRR+GHKV+IVSSG IAVGL+T+  D
Sbjct: 7   YTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLNLD 66

Query: 68  RRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHE 127
           +RPK L+++QAIAAVGQGRLI RWD LF  F ++IAQIL+TRNDIVDW+QYKNAQNT +E
Sbjct: 67  KRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTINE 126

Query: 128 LLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNP 187
           LL MGV PIVNENDTLSIS +KFGDNDTLSAIT+ L+GADYLFL+TDVDCLYTDNPRTNP
Sbjct: 127 LLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNP 186

Query: 188 DAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERPVD 247
           +AKPILVVPDL++GLP                M TK++AADLATNAGVHTIIMKS+ P +
Sbjct: 187 EAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMKSDIPGN 246

Query: 248 MVRIVEFMEWREQCT----AVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLNKRE 303
           +++IVE+M+ ++  T        D  +LQ  EL  LQ   VPLHT FIAN     L  RE
Sbjct: 247 ILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHHLKNRE 306

Query: 304 FWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKADG 363
           FWILHGLV+ G+VIID+GAY ALTRKNKAGLLP G+I +EG+FHELE VDLK+G R  +G
Sbjct: 307 FWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGKRLPNG 366

Query: 364 SLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
            LD + PLQTVGRARCNY+S+E+ +IKGLQS QIE  LGY DSEY AHR
Sbjct: 367 ELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHR 415

>Kwal_47.18187
          Length = 421

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/411 (66%), Positives = 329/411 (80%), Gaps = 4/411 (0%)

Query: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65
           + +TIV+KLGSSSLVDE T EPKL+ M+ +VETVV+LRRMGH+VV+VSSG IAVGLKT+ 
Sbjct: 3   KTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLN 62

Query: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125
            D+RPK L+Q+QAIAAVGQGRLI RWD+LF  F+++IAQIL+TRNDIVDW+QYKNAQNT 
Sbjct: 63  LDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTI 122

Query: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185
           HELL MGV PIVNENDTLS+S +KFGDNDTLSAITA L GADYLFL+TDVDCLYTDNPRT
Sbjct: 123 HELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRT 182

Query: 186 NPDAKPILVVP---DLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKS 242
           NP+AKPILVVP    +S+G                  M TK++AA+LATNAGV+TIIMKS
Sbjct: 183 NPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIMKS 242

Query: 243 ERPVDMVRIVEFMEWREQCTAVSAD-AETLQTDELNLLQEHGVPLHTRFIANVWQPSLNK 301
             P ++ ++V +M+  E  T  +AD  E LQ  E+  LQE+ VPLHTRF+A+  Q  L+ 
Sbjct: 243 AEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHLSN 302

Query: 302 REFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKA 361
           REFW+LHGLVS G ++ID+GAY ALTRKNKAGLLPAG+I VEG+FHE E +DLK+G R A
Sbjct: 303 REFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSRLA 362

Query: 362 DGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
            G LD + P+ T+GRARCNY+SVE+ KIKGLQS QIE VLGY DSEY+AHR
Sbjct: 363 TGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHR 413

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/413 (67%), Positives = 325/413 (78%), Gaps = 6/413 (1%)

Query: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65
           + +TIV+KLGSSSLVDE T EPKL+IMS IVETVVKLRRMGHKV+IVSSG IAVGL+T+ 
Sbjct: 8   KSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMR 67

Query: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125
            ++RPK L+++QAIAA+GQGRLI RWD LF  F+++IAQILLTRNDI+DW+QYKNAQNT 
Sbjct: 68  MNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTI 127

Query: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185
           +ELL MGV PIVNENDTLS+  +KFGDNDTLSAIT+ LI ADYLFL+TDVDCLYTDNPRT
Sbjct: 128 NELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRT 187

Query: 186 NPDAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERP 245
           NPDA PILVVPDLS+GLP                M TK++AADLATNAGVHT+IMKS+ P
Sbjct: 188 NPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMKSDTP 247

Query: 246 VDMVRIVEFMEWREQ------CTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSL 299
            ++ RIVE+M+  E         A + D   LQ  E   L+   VPLHT+FIAN  +  L
Sbjct: 248 ANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHHL 307

Query: 300 NKREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVR 359
             REFWILHGLVS G V+ID+GAY ALTRKNKAGLLPAGVI V+G+FHELE VD+K+G +
Sbjct: 308 KNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGKK 367

Query: 360 KADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
             DG+LD   PLQTVG+ARCNY+S E+ KIKGL S QIE  LGY DSEY+AHR
Sbjct: 368 LPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHR 420

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/411 (64%), Positives = 314/411 (76%), Gaps = 4/411 (0%)

Query: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65
           + FTIV+KLG+SSLVDE T EP+L+IMS IVETVVKLRR+GH VVIVSSG I VGL  +G
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125
            ++RPK LS++QAIAA+GQ +LI RWDSLF  F + IAQILLTRNDI+DWSQY+NAQNT 
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185
            ELL MGV PI+NENDTLS+  +KFGDNDTLSAITAGLI ADYLFL+TDVDCLYT +PR+
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 186 NPDAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERP 245
           +PDAKPIL+VPDLS+GLP                M TK++AA+LATNAGVHTIIMKS+ P
Sbjct: 189 DPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIMKSDAP 248

Query: 246 VDMVRIVEFME----WREQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLNK 301
            ++ +IV++++      E       D   LQ +E   L   GVP HT+F+AN     L  
Sbjct: 249 SNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRHLRN 308

Query: 302 REFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKA 361
           +EFWILHGLV+ G VIID+GAYKALTRKNKAGLLP GVI +EGSFHE+E VDLK+G R  
Sbjct: 309 KEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRLP 368

Query: 362 DGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
           +G LD   PL  VGRARCNY S+E+ KIKG QS +IE  LGY +SEYIAHR
Sbjct: 369 NGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHR 419

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  490 bits (1262), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 245/412 (59%), Positives = 307/412 (74%), Gaps = 5/412 (1%)

Query: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65
           + +TIV+KLGSSSLVDEST EPKLSIM+ IVETV  L+RMGHKV+IVSSG IAVGL  + 
Sbjct: 3   KAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALN 62

Query: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125
              +PK+LS++QAIAAVGQGRLIARW+ LF  + E+ AQILLTRNDI+ W+QY NA+NT 
Sbjct: 63  IPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTI 122

Query: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185
           +ELLAMGV PIVNENDTLSIS ++FGDNDTLSAITA L+GAD+LFL+TDVDCLYTDNPRT
Sbjct: 123 NELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRT 182

Query: 186 NPDAKPILVVPDLSQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERP 245
           NPDA+PI++VP+LS+GLP                M TK++AADLA+NAG+ TI+MKS+RP
Sbjct: 183 NPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSDRP 242

Query: 246 VDMVRIVEFMEW-----REQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLN 300
             + +IV++++      R            LQ  EL  L+ + VP+HT+F+AN  +  L 
Sbjct: 243 EYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHKLK 302

Query: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRK 360
            REFWILHGL++ G +IID+ +Y  L  K+ A L P  VI V  +FHELE VDLKIG R 
Sbjct: 303 NREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQRL 362

Query: 361 ADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
            +G LD S+P+Q+VG  R NY+S+E+ KIKGL S +I  VLGY  SEY+AHR
Sbjct: 363 PNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHR 414

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  465 bits (1197), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 244/464 (52%), Positives = 308/464 (66%), Gaps = 60/464 (12%)

Query: 9   TIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTDR 68
           TIV+KLG+SSLVDE T EPKLSIM+ +VETV++L+R GHKVVIVSSG IAVGL  +  D+
Sbjct: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEMDK 63

Query: 69  RPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHEL 128
           +P  L+++QAIAA+GQGRLI RW  LF+ + EKIAQIL+TRNDI+ W+QYKNAQNT  +L
Sbjct: 64  KPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123

Query: 129 LAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPD 188
           L MGV PIVNENDTLSIS +KFGDNDTLSAITA L+ AD+LFL+TDVDCLYT+NPRTNPD
Sbjct: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183

Query: 189 AKPILVVPDLSQGLP-XXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSERPVD 247
           AKPI++VP++ QG+P                 M TK++AADLATNAGV+TIIMKS+ P +
Sbjct: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243

Query: 248 MVRIVEFM-------------EWREQCT----------------------AVSADAETLQ 272
           +  IV+++               REQ +                          D  +LQ
Sbjct: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303

Query: 273 TDELNLLQEHGVPLHTRFIANVWQPSLNKREFWILHGLVSCGTVIIDKGAYKALTRKN-- 330
             EL  ++E  VPLHT F+A      L  REFWILHGLV+ G +IID+ AY  LT ++  
Sbjct: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363

Query: 331 ----------------------KAGLLPAGVIAVEGSFHELEAVDLKIGVRKADGSLDES 368
                                   GLLP  VI V+GSFHELE VD+K+G R  +G LD  
Sbjct: 364 EEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423

Query: 369 EPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHR 412
            PL+ VGRARCN++SVE+++IKGL   +++ VLGY  SEY+AH+
Sbjct: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHK 467

>Scas_690.36
          Length = 424

 Score =  462 bits (1189), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 294/413 (71%), Gaps = 14/413 (3%)

Query: 9   TIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTDR 68
           TIV+KLGSSSLVDE T EPKLS M+ IVE V  L+R+GHKVVIVSSG IAVGL  +   +
Sbjct: 6   TIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDAMNLKK 65

Query: 69  RPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHEL 128
           +P +LS++QAIAA+GQG+LI RW+ LFR +NE+IAQILLTR DI  W+Q+KNAQNT + L
Sbjct: 66  KPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTINAL 125

Query: 129 LAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPD 188
           L MGV PIVNENDTLS+S +KFGDNDTLSAIT+ L+ ADYLFL+TDVDCLYTDNP+ N D
Sbjct: 126 LKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKVNKD 185

Query: 189 AKPILVVPDL-----SQGLPXXXXXXXXXXXXXXXXMATKILAADLATNAGVHTIIMKSE 243
           AKPIL V D+     S+ L                 M TKI AADLATN G+HTIIM S+
Sbjct: 186 AKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIMSSQ 245

Query: 244 RPVDMVRIVEFMEWREQCTAVSADAETLQTDELNL--LQEHGVPLHTRFIANV-WQPSLN 300
            P ++++I+E+ME     + +  D      ++L L  L  H VPLHT+FIAN   +  L 
Sbjct: 246 TPANILKIIEYME----TSNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENSETYLK 301

Query: 301 KREFWILHGLVSCGTVIIDKGAYKALTRKNK--AGLLPAGVIAVEGSFHELEAVDLKIGV 358
            REFWILHGLV+ G++IIDK +YK L RK +   GLLP  +I  E  FHELE V+LK+G 
Sbjct: 302 NREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVELKVGE 361

Query: 359 RKADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAH 411
           R  +G ++    L+ VGRARCNY+S E++KIKGL+S QI   LGY DS Y+ H
Sbjct: 362 RLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVH 414

>Scas_715.44
          Length = 528

 Score = 35.4 bits (80), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 17/100 (17%)

Query: 91  WDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDTLSISGVKF 150
           +  LF+ F EK+   + ++  ++           F  L+ MG+           ++GV  
Sbjct: 184 YTFLFQAFKEKLQPFIESKERVIP------VFTGFFGLVPMGL-----------LNGVGR 226

Query: 151 GDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190
           G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266

>Kwal_47.18163
          Length = 522

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 15/108 (13%)

Query: 84  QGRL-IARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDT 142
           QG L  + +  L R F EK+A +L   +     +        F  L+ MG+         
Sbjct: 174 QGTLDTSFYTFLVRAFKEKLAPVLEAHSQ---GTPVVPVITGFFGLVPMGL--------- 221

Query: 143 LSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190
             ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 222 --LNGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P+A+
Sbjct: 225 LNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAKPI-LVVPD 197
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+ +  V PD
Sbjct: 222 LNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPD 275

>YDR007W (TRP1) [863] chr4 (461839..462513)
           Phosphoribosylanthranilate isomerase, catalyzes the
           third step in the tryptophan biosynthesis pathway [675
           bp, 224 aa]
          Length = 224

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 106 LLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDTLSISGV 148
           LL  N I DW   + +  + H +LA G+TP  N  D L ++GV
Sbjct: 154 LLDWNSISDWVGRQESPESLHFMLAGGLTP-ENVGDALRLNGV 195

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 225 LNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 222 LNGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267

>Kwal_23.6125
          Length = 491

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 75/148 (50%), Gaps = 20/148 (13%)

Query: 10  IVLKLGSSSLVDESTL---EPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGT 66
           I+  +G++++  ++ +   + KL + S   + + +LRR+GH       G     L  +  
Sbjct: 226 IIPSMGNNAVATQTVINHIKSKLQLKSQ--KHLEELRRLGH-------GEDFKPLSELKN 276

Query: 67  DRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTR--NDIVDWSQYKNAQNT 124
             + +  SQ+ A+  +   R I+R D +F  + ++IA IL++R  +D    +Q      +
Sbjct: 277 VHQLEPTSQVLALRTMLLDRYISRDDFVF--YFDRIATILVSRALDDSPISAQKTIVTAS 334

Query: 125 FHELLAMGVTPIVNENDTLSISGVKFGD 152
            H++    V+P+VN +   SI+ V+ GD
Sbjct: 335 NHKV----VSPVVNFDKVTSINIVRSGD 358

>Sklu_1961.3 YMR086W, Contig c1961 3351-5234 reverse complement
          Length = 627

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 50  VIVSSGCIAVGLKTVGTDRRPKKLSQLQAIAAVGQG---------------RLIARWDSL 94
              ++  I   L   GT   P+KL +  ++ A                   R  AR  S+
Sbjct: 18  AFAAASAIGKALNPNGTTINPEKLPRYNSLTANRTSSMVRSGSMSSRSNSLRKTARTGSI 77

Query: 95  FRPFN-----EKIAQILLTRNDIVDWSQYKNAQNTFHEL 128
            R  +      +++ +   RN  +D S++ +A++TFHE 
Sbjct: 78  SRTGSTATNGRRLSSLQNKRNSTIDESEFYDAEDTFHEF 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,364,324
Number of extensions: 497040
Number of successful extensions: 1138
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1129
Number of HSP's successfully gapped: 21
Length of query: 412
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 308
Effective length of database: 12,995,837
Effective search space: 4002717796
Effective search space used: 4002717796
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)