Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AAL060W1305128168220.0
KLLA0C10274g1300128738680.0
Kwal_47.181921307129838520.0
YDR301W (CFT1)1357134336420.0
Scas_588.131340132136180.0
CAGL0H01463g1361134434500.0
Kwal_56.22637595115751.4
Sklu_2439.10428191732.3
CAGL0B03289g870112696.4
YDR310C (SUM1)106254689.1
Scas_713.2537849679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL060W
         (1281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH] complement(2...  2632   0.0  
KLLA0C10274g complement(879403..883305) similar to sgd|S0002709 ...  1494   0.0  
Kwal_47.18192                                                        1488   0.0  
YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-m...  1407   0.0  
Scas_588.13                                                          1398   0.0  
CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces c...  1333   0.0  
Kwal_56.22637                                                          33   1.4  
Sklu_2439.10 YMR067C, Contig c2439 11825-13111                         33   2.3  
CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces c...    31   6.4  
YDR310C (SUM1) [1138] chr4 complement(1081120..1084308) Protein ...    31   9.1  
Scas_713.25                                                            30   9.4  

>AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH]
            complement(241008..244925) [3918 bp, 1305 aa]
          Length = 1305

 Score = 2632 bits (6822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1269/1281 (99%), Positives = 1269/1281 (99%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV
Sbjct: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60

Query: 61   HGLSLVPHKSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAAP 120
            HGLSLVPHKSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAAP
Sbjct: 61   HGLSLVPHKSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAAP 120

Query: 121  RLEQEPAARCLLVHNGDCLAVLPLRGHXXXXXXXXXXXXHPAKRARTDADGRLVGASTVM 180
            RLEQEPAARCLLVHNGDCLAVLPLRGH            HPAKRARTDADGRLVGASTVM
Sbjct: 121  RLEQEPAARCLLVHNGDCLAVLPLRGHEEEGEEAEEEEEHPAKRARTDADGRLVGASTVM 180

Query: 181  PASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILSLDLDDEK 240
            PASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILSLDLDDEK
Sbjct: 181  PASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILSLDLDDEK 240

Query: 241  STVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGLNTRIQ 300
            STVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGLNTRIQ
Sbjct: 241  STVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGLNTRIQ 300

Query: 301  DNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQLPIVNE 360
            DNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQLPIVNE
Sbjct: 301  DNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQLPIVNE 360

Query: 361  IFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETDEDYM 420
            IFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETDEDYM
Sbjct: 361  IFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETDEDYM 420

Query: 421  ELYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDEL 480
            ELYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDEL
Sbjct: 421  ELYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDEL 480

Query: 481  SIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSD 540
            SIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSD
Sbjct: 481  SIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSD 540

Query: 541  IYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFE 600
            IYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFE
Sbjct: 541  IYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFE 600

Query: 601  VVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNK 660
            VVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNK
Sbjct: 601  VVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNK 660

Query: 661  YINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDIN 720
            YINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDIN
Sbjct: 661  YINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDIN 720

Query: 721  PDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKCDHELLITGAPENA 780
            PDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKCDHELLITGAPENA
Sbjct: 721  PDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKCDHELLITGAPENA 780

Query: 781  YPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRWGE 840
            YPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRWGE
Sbjct: 781  YPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRWGE 840

Query: 841  NSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTFIV 900
            NSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTFIV
Sbjct: 841  NSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTFIV 900

Query: 901  SYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLINDM 960
            SYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLINDM
Sbjct: 901  SYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLINDM 960

Query: 961  RTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDI 1020
            RTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDI
Sbjct: 961  RTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDI 1020

Query: 1021 FQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGNLM 1080
            FQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGNLM
Sbjct: 1021 FQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGNLM 1080

Query: 1081 IIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLK 1140
            IIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLK
Sbjct: 1081 IIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLK 1140

Query: 1141 YAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQAD 1200
            YAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQAD
Sbjct: 1141 YAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQAD 1200

Query: 1201 GTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTV 1260
            GTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTV
Sbjct: 1201 GTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTV 1260

Query: 1261 LKRFATLSIPTRMTMASKAGR 1281
            LKRFATLSIPTRMTMASKAGR
Sbjct: 1261 LKRFATLSIPTRMTMASKAGR 1281

>KLLA0C10274g complement(879403..883305) similar to sgd|S0002709
            Saccharomyces cerevisiae YDR301w CFT1 pre-mRNA 3 -end
            processing factor CF II, start by similarity
          Length = 1300

 Score = 1494 bits (3868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1287 (55%), Positives = 956/1287 (74%), Gaps = 17/1287 (1%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MNVFDE++  TVVN  + G+FT+  REE ++ RTN+LSV       +LVLAYEWKL+G++
Sbjct: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60

Query: 61   HGLSLVPH-KSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAA 119
              + L+P   S L  LA+L+ + +VS+VRFD   ++LET SLHYY  KF  LS  ++   
Sbjct: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLSTSSLKTE 120

Query: 120  PRLEQEPAARCLLVHNGDCLAVLPLR--GHXXXXXXXXXXXXHP-AKRARTDADGRLVGA 176
              +  +P  RCLLV N D LA+LPL+                 P AKR + +    +   
Sbjct: 121  SIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLKRNQG--ITSD 178

Query: 177  STVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILSLDL 236
            S +MP S LH  +K+V D+++L   +K  VG+LYQP L+WCGNEK+   TM++++LSLD+
Sbjct: 179  SIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNTMRYMVLSLDV 238

Query: 237  DDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGLN 296
            +DEK+TVI  L  LPN LHT++PL  G VL GVNELLY+  +GALQ  I LN F+ S +N
Sbjct: 239  EDEKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFATSSIN 298

Query: 297  TRIQDNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQLP 356
            TRI DNS +  F  +   YF       D+L+L+DE  RMYN+I E+EG LLT F+CVQ+P
Sbjct: 299  TRITDNSDMNIFLSKSSIYFYKALKRHDLLILIDENCRMYNIITESEGNLLTKFDCVQVP 358

Query: 357  IVNEIFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETD 416
            IVNEIFK + +P S+CG++NLETG + IGF SGDAM ++L NLK +   K  + ET++ D
Sbjct: 359  IVNEIFKNSRLPLSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKRQLVETVDDD 418

Query: 417  E-DYMELYGNNAEK-EKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLAN 474
            + +Y  LYG +      + +ET+ PFDI  LD + NIGP+TSL +GK +S+E T+ +L N
Sbjct: 419  DDEYSALYGESQNNTHTRIVETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPN 478

Query: 475  PNKDELSIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDS 534
            PNKDE SIVATSG G GSHLT L +T+ P ++QALKF S T+IWNLKIKGKDKYLVTTD+
Sbjct: 479  PNKDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDA 538

Query: 535  SQTRSDIYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMT 594
             + +SD+Y IDR+F+PF+A DFRK+  T+        KRI+QVTS G++LFD++FKR+  
Sbjct: 539  DKEKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLAR 598

Query: 595  MNFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILE 654
            +  D E+VH CI DP++L T+++G+IKIY+L+ K+KKKF+K  LP+AL EIIIT G I +
Sbjct: 599  LTIDIEIVHACIIDPYILFTDARGNIKIYQLDSKNKKKFIKFKLPEALNEIIITSGSIFK 658

Query: 655  SNMCNKYINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQ 714
            SN+CNK+++GLE S + QLLFTFVT DNQ++FFT+ HNDRIFQLNG+D     LFISTYQ
Sbjct: 659  SNICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQ 718

Query: 715  LPEDINPDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKCDHELLIT 774
            +PE++NPDPSIKQ++++RLGH  K+E+LTILTFGGE+Y Y+K   +  + +KC    LIT
Sbjct: 719  IPEEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLIT 778

Query: 775  GAPENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVS 834
            GAP NAYP+GV  +ERVAHY  +YNGYSV+FITG VPYIIIKEDNSV RIF   NI +V+
Sbjct: 779  GAPNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVT 838

Query: 835  MTRWGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHER 894
            M RWG+NSVMCVD++KNAR+M   LD + YYGN   L KI +ED +E+F+TL NI YHER
Sbjct: 839  MARWGKNSVMCVDNIKNARVM--KLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHER 896

Query: 895  TQTFIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKN 954
            T  +I+SY K I+Y ALSE+ EPLVGY+P K ++ G++SG++L++P +W IID+++  +N
Sbjct: 897  TGMYIISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSEN 956

Query: 955  SLINDMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTN 1014
            S++ND++TM+IQLNS T+R+RE +++G+++V++ED   TG   + DITEVV EPGKPD+N
Sbjct: 957  SMVNDIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSN 1016

Query: 1015 YKFKDIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAK 1074
            +KFK +F+E+IRG+V+ VCEISGRFMI QSSKA+VRD+QEDNS VPVAFLDMPVFITDAK
Sbjct: 1017 FKFKQLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAK 1076

Query: 1075 SFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNN 1134
            SF NLMIIGDSMQGF+F+GFDAEPYRM+ LGKS SK + M +EFLVNNG++ F+VTDR N
Sbjct: 1077 SFSNLMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQN 1136

Query: 1135 LMHVLKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQC 1194
             +HVL+YAPDE NSLSGQRLVHC SFN+ +TN  M+L++K+ EFG  +        ++  
Sbjct: 1137 HLHVLRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTS-------NYIA 1189

Query: 1195 IGSQADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRP 1254
            +G Q DG+IF+++PL+EASYR  YL+QQQL+D E+ L G N +MERL+N +Y  GH LRP
Sbjct: 1190 LGCQTDGSIFRMIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRP 1249

Query: 1255 MLDFTVLKRFATLSIPTRMTMASKAGR 1281
             LD  VLK++  L I  R T+ ++ GR
Sbjct: 1250 TLDSQVLKKYIHLPITKRTTIENRVGR 1276

>Kwal_47.18192
          Length = 1307

 Score = 1488 bits (3852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/1298 (55%), Positives = 967/1298 (74%), Gaps = 29/1298 (2%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MNV+DE+ +AT V++++ GHFT+   ++LI  RTN+LSV   D+E +LVL +E+KL GR+
Sbjct: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHE-KLVLLHEYKLHGRI 59

Query: 61   HGLSLVPH-KSGLGRLAVLTGRGRVSIVRFDAENQT-LETESLHYYDAKFEELSALTVGA 118
             G+ LVP  +S L  L + TG+ ++S+VRFD      LET SLHYY+A+F E S L +  
Sbjct: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119

Query: 119  APRLEQEPAARCLLVHNGDCLAVLPLRGHXXXXXXXXXXXXHPAKRART--DADGRLVGA 176
            + +L  +P  RC+ + N D LA+LPL GH            H AK+ +   DA   L G 
Sbjct: 120  SSKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQDHS-HQAKKQKVGNDASRSLTGQ 178

Query: 177  STVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQT-MKFIILSLD 235
            S VM  S LH DIKNV D++FL   N   + +LYQP+L+W GNEK+  +T MKF  ++L 
Sbjct: 179  SLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKF--MALT 236

Query: 236  LDDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGL 295
            L D KST I  ++G+P+ +H+IIPL+N CVL GVNE++ VDNTGALQ  I LN+F++   
Sbjct: 237  LQDNKSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFASKLP 296

Query: 296  NTRIQDNSKLQAFFEQPLCYF-ATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQ 354
             ++  D S LQ  F +P+ +  A  S  ++IL++MD +A +Y+VI ++EGRLL  F  V+
Sbjct: 297  GSKQIDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFTLVK 356

Query: 355  LPIVNEIFKRNMMPTSI---CGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSE 411
            LPI ++IFK + +PT I    G + ++    FIGF SG+A+ V+ NNL+S+ E     + 
Sbjct: 357  LPIASDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEIQAI 416

Query: 412  TL--ETDEDYMELYGNN------AEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKAS 463
             L  + DEDY  LYG++      A +    +E   PF I+ +D L+N+GP+TSLAVGK S
Sbjct: 417  ELPHDEDEDYDALYGDDDDLARPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVS 476

Query: 464  SIEHTVAKLANPNKDELSIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIK 523
            S    +  L NPN++E+++V++SG+G G+++ ++E ++ P VQQALKF SVT+IW LKI+
Sbjct: 477  SANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIR 536

Query: 524  GKDKYLVTTDSSQTRSDIYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVH 583
             KDKYL+TTDS   +SD++ I +     K   F+KN +TV  A  GGGKRIVQVT+K V+
Sbjct: 537  KKDKYLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVY 596

Query: 584  LFDINFKRMMTMNFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALK 643
            LF++ FK++MT++FDFEVVHV I DPF+LLTNSKG+IKIYELEPKH+ K  K  LP+ L+
Sbjct: 597  LFNLGFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLE 656

Query: 644  EIIITFGVILESNMCNKYINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDD 703
            E+IIT GVIL+S++CN+Y++GLE  ++ QLLFTFV ADNQI+ F K+H+DR+FQLNG+D 
Sbjct: 657  EMIITSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDI 716

Query: 704  FRQKLFISTYQLPEDINPDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDR 763
                LF+STYQLPE I PDPSIKQV+I+ LG  +K+EYLT+LTFGGE+Y+Y+K  +   +
Sbjct: 717  LNDMLFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNKFFK 776

Query: 764  FIKCDHELLITGAPENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPR 823
             ++C+ E  ITGAP NAY KGV  +ER+AHY++ +NGYS+I +TG+VPY+IIKED S P+
Sbjct: 777  SMRCN-EFQITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPK 835

Query: 824  IFPFANITLVSMTRWGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDF 883
            IF F NI LVS+T WG +SV+CVDD+KNARI+TLN   +  YGN++ + +I + D   +F
Sbjct: 836  IFKFGNIPLVSLTPWGADSVLCVDDIKNARIVTLN--NEFSYGNRLPVRRIKIGDATNEF 893

Query: 884  QTLNNITYHERTQTFIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSW 943
            Q++  + +HERT  +I SY K I+Y A+SEE E L+G +    HA G+QSGIILL+PK+W
Sbjct: 894  QSITGVAFHERTGMYIASYTKEIEYEAISEEGEKLIGCDDSVPHAKGYQSGIILLNPKTW 953

Query: 944  EIIDKIEYGKNSLINDMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITE 1003
             IID  +YGKNSLINDM+TM+IQ NS  KR+REYLVVGNT+VRDEDIG  GSFYLYDITE
Sbjct: 954  NIIDLADYGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITE 1013

Query: 1004 VVPEPGKPDTNYKFKDIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAF 1063
            VVPEPGKPDTNYK K IF E+ RG VS+VCE+SGRF+ISQS K +VRD+QEDNSVVPVAF
Sbjct: 1014 VVPEPGKPDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAF 1073

Query: 1064 LDMPVFITDAKSFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNG 1123
            LD+PVF+TD+KS GNL+IIGD+MQGF F+GFDAEPYRM+ LG+SVSK E M +EFL+NNG
Sbjct: 1074 LDIPVFVTDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNG 1133

Query: 1124 DVYFLVTDRNNLMHVLKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSR 1183
            ++YFLV+DR+N++HVLKYAPDEPNSLSGQ+LVHCTSFNLHSTNTCM+L+ KN EF   + 
Sbjct: 1134 NIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAAND 1193

Query: 1184 GFGIYMPSFQCIGSQADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLEN 1243
                 +P+FQ IG+Q DG+IFKVVPLSE +YR LY+++QQLI+K++QLCGLNP+MERL+N
Sbjct: 1194 -----LPAFQAIGAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQN 1248

Query: 1244 PFYQMGHILRPMLDFTVLKRFATLSIPTRMTMASKAGR 1281
             FYQ+GH LRPMLDFTV+K +  L+   R  +A+KAGR
Sbjct: 1249 DFYQLGHSLRPMLDFTVIKNYGALASNKRKQVAAKAGR 1286

>YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-mRNA
            cleavage factor II [4074 bp, 1357 aa]
          Length = 1357

 Score = 1407 bits (3642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1343 (51%), Positives = 947/1343 (70%), Gaps = 72/1343 (5%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MNV+D+V++ATVV++S+  HFTT+  EEL++ RTN+LSV     +G+L L  E+K  G +
Sbjct: 1    MNVYDDVLDATVVSHSLATHFTTSDYEELLVVRTNILSVYRPTRDGKLYLTDEFKFHGLI 60

Query: 61   HGLSLVPHK-SGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAA 119
              + L+P K S L  L + TG  ++SI++F+    +++T SLHYY+ KF+  S + +   
Sbjct: 61   TDIGLIPQKDSPLSCLLLCTGVAKISILKFNTLTNSIDTLSLHYYEGKFKGKSLVELAKI 120

Query: 120  PRLEQEPAARCLLVHNGDCLAVLPLRGHXXXXXXXXXXXXHPA----------------- 162
              L  +P + C L+ N D +A LP   +                                
Sbjct: 121  STLRMDPGSSCALLFNNDIIAFLPFHVNKNDDDEEEEDEDENIDDSELIHSMNQKSQGTN 180

Query: 163  ---KRARTDADGRLVGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGN 219
               KR RT    +    S V+ AS L+   KN+ D++FL+   K  + +LYQP+L W GN
Sbjct: 181  TFNKRKRTKLGDKFTAPSVVLVASELYEGAKNIIDIQFLKNFTKPTIALLYQPKLVWAGN 240

Query: 220  EKLTRQTMKFIILSLDLDDEKS------TVINMLQGLPNTLHTIIPLSNGCVLAGVNELL 273
              +++   +++IL+L++   +S      T I  ++ LP  LHTI+P+SNG ++ G NEL 
Sbjct: 241  TTISKLPTQYVILTLNIQPAESATKIESTTIAFVKELPWDLHTIVPVSNGAIIVGTNELA 300

Query: 274  YVDNTGALQGAISLNAFSNSGLN-TRIQDNSKLQAFFEQP---LCYFATQ------SNGR 323
            ++DNTG LQ  + LN+F++  L  T+I +NS L+  F +      +  +       SN  
Sbjct: 301  FLDNTGVLQSTVLLNSFADKELQKTKIINNSSLEIMFREKNTTSIWIPSSKSKNGGSNND 360

Query: 324  DILLLMDEKARMYNVIIEAEGRLLTTFNCVQLPIVNEIFKRNMMPTSIC------GNMNL 377
            + LLLMD K+ +Y + +EAEGRLL  F+  +LPIVN++ K N  P  I        N N+
Sbjct: 361  ETLLLMDLKSNIYYIQMEAEGRLLIKFDIFKLPIVNDLLKENSNPKCITRLNATNSNKNM 420

Query: 378  ETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSETLETDE----------DYMELYGNNA 427
            +   LFIGF SG+A+ +RLNNLKS++E +   + +  T+           +  +LY + A
Sbjct: 421  D---LFIGFGSGNALVLRLNNLKSTIETREAHNPSSGTNSLMDINDDDDEEMDDLYADEA 477

Query: 428  EK-------EKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDEL 480
             +        K  +ET  PFDIE L  L N+GP+TSL VGK SSI+  V  L NPNK+E 
Sbjct: 478  PENGLTTNDSKGTVETVQPFDIELLSSLRNVGPITSLTVGKVSSIDDVVKGLPNPNKNEY 537

Query: 481  SIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSD 540
            S+VATSGNG+GSHLT+++ ++ P ++ ALKFIS+TQIWNLKIKG+D+YL+TTDS+++RSD
Sbjct: 538  SLVATSGNGSGSHLTVIQTSVQPEIELALKFISITQIWNLKIKGRDRYLITTDSTKSRSD 597

Query: 541  IYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFE 600
            IY  D +FK  K    R++ TTV  ++ G  KRI+QVT+  ++L+D +F+R+ T+ FD+E
Sbjct: 598  IYESDNNFKLHKGGRLRRDATTVYISMFGEEKRIIQVTTNHLYLYDTHFRRLTTIKFDYE 657

Query: 601  VVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNK 660
            V+HV + DP++L+T S+GDIKI+ELE K+K+K +K  LP+ L E++IT G+IL+SNMCN+
Sbjct: 658  VIHVSVMDPYILVTVSRGDIKIFELEEKNKRKLLKVDLPEILNEMVITSGLILKSNMCNE 717

Query: 661  YINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDIN 720
            ++ GL KS+E QLLFTFVTADNQI+FFTKDHNDRIFQLNG+D   + L+ISTYQL ++I 
Sbjct: 718  FLIGLSKSQEEQLLFTFVTADNQIIFFTKDHNDRIFQLNGVDQLNESLYISTYQLGDEIV 777

Query: 721  PDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIK--CDHELLITGAPE 778
            PDPSIKQV+I++LGH +K+EYLTILTFGGE+Y YRK      RF +    ++L ITGAP+
Sbjct: 778  PDPSIKQVMINKLGHDNKEEYLTILTFGGEIYQYRKLPQRRSRFYRNVTRNDLAITGAPD 837

Query: 779  NAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRW 838
            NAY KGV  +ER+ HY  DYNGYSVIF+TG+VPYI+IKED+S P+IF F NI LVS+T W
Sbjct: 838  NAYAKGVSSIERIMHYFPDYNGYSVIFVTGSVPYILIKEDDSTPKIFKFGNIPLVSVTPW 897

Query: 839  GENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTF 898
             E SVMCVDD+KNAR+ TL  D + YYGNK+ L +I + + L+D++TL  + YHER Q F
Sbjct: 898  SERSVMCVDDIKNARVYTLTTD-NMYYGNKLPLKQIKISNVLDDYKTLQKLVYHERAQLF 956

Query: 899  IVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLIN 958
            +VSY K + Y AL E+ E ++GY+ +  HA GFQSGI+L++PKSW++IDKI++ KNS++N
Sbjct: 957  LVSYCKRVPYEALGEDGEKVIGYDENVPHAEGFQSGILLINPKSWKVIDKIDFPKNSVVN 1016

Query: 959  DMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFK 1018
            +MR+ MIQ+NS TKR+REY++ G      ED   TG+F++YD+ EVVPEPGKPDTNYK K
Sbjct: 1017 EMRSSMIQINSKTKRKREYIIAGVANATTEDTPPTGAFHIYDVIEVVPEPGKPDTNYKLK 1076

Query: 1019 DIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGN 1078
            +IFQE++ GTVSTVCE+SGRFMISQS K +VRDIQEDNSV+PVAFLD+PVF+TD+KSFGN
Sbjct: 1077 EIFQEEVSGTVSTVCEVSGRFMISQSQKVLVRDIQEDNSVIPVAFLDIPVFVTDSKSFGN 1136

Query: 1079 LMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHV 1138
            L+IIGD+MQGF F+GFDAEPYRM++LG+S+SK +TM +EFLVN GD+YF  TD +  +HV
Sbjct: 1137 LLIIGDAMQGFQFIGFDAEPYRMISLGRSMSKFQTMSLEFLVNGGDMYFAATDADRNVHV 1196

Query: 1139 LKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQ 1198
            LKYAPDEPNSLSGQRLVHC+SF LHSTN+CM L+ +N+EFG         +PSFQ +G Q
Sbjct: 1197 LKYAPDEPNSLSGQRLVHCSSFTLHSTNSCMMLLPRNEEFGSPQ------VPSFQNVGGQ 1250

Query: 1199 ADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDF 1258
             DG++FK+VPLSE  YR LY+IQQQ+ID+E+QL GLNPRMERL N FYQMGH +RPMLDF
Sbjct: 1251 VDGSVFKIVPLSEEKYRRLYVIQQQIIDRELQLGGLNPRMERLANDFYQMGHSMRPMLDF 1310

Query: 1259 TVLKRFATLSIPTRMTMASKAGR 1281
             V++RF  L+I  R ++A KAGR
Sbjct: 1311 NVIRRFCGLAIDRRKSIAQKAGR 1333

>Scas_588.13
          Length = 1340

 Score = 1398 bits (3618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1321 (51%), Positives = 946/1321 (71%), Gaps = 45/1321 (3%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MN++++V+ ATVV++S+TGHFT+T + ELII RTN++SV +  ++G+L L  E+ L+ ++
Sbjct: 1    MNIYEDVLTATVVSHSITGHFTSTSQRELIIVRTNIISVYNTTDDGKLNLVEEFNLNAKI 60

Query: 61   HGLSLVPH-KSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELSALTVGAA 119
              ++L+P  KS L  L + +G  ++SIVRFDA   +LET SLHYY+ K  ++S +T+   
Sbjct: 61   TDIALIPQEKSPLSCLVIASGVAKISIVRFDAVTNSLETLSLHYYEDKLSDISLVTLAKT 120

Query: 120  PRLEQEPAARCLLVHNGDCLAVLPL-RGHXXXXXXXXXXXXHPAKRA-----RTDADGRL 173
             +L  +P  R LL+ N D +A+LPL  G+            +   R      R+  + + 
Sbjct: 121  SKLRVDPMNRALLLFNNDSIALLPLFSGNHEDEDEDDEEDDYDVTRGEVTTKRSKKNEKH 180

Query: 174  VGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQTMKFIILS 233
            VG S +     LH +++NV D++FL    K  + VLYQP+L+W GN +L  Q   F+I +
Sbjct: 181  VGQSKIFHVKELHQELQNVLDIQFLNDFTKPTLAVLYQPKLTWVGNTELNPQPTSFMIFT 240

Query: 234  LDL-DDEKST-----VINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISL 287
            L+L  +E  T     +I  L  L      ++P+S GCV+ G NE+ Y+DNTG LQ  I L
Sbjct: 241  LNLRTNELETAFDVVIIATLHDLSWDWFQLLPISRGCVVMGNNEMAYIDNTGVLQSIIHL 300

Query: 288  NAFSNSGLN-TRIQDNSKLQAFFEQPLCYFATQSNGR-----DILLLMDEKARMYNVIIE 341
            N+F++  L   RI D ++L+ FF + + YF + S  +     + LL++D  A +Y V +E
Sbjct: 301  NSFADKSLQRARIIDETELEVFFNEKVTYFWSASTDKKNIDDETLLIIDASANLYYVRLE 360

Query: 342  AEGRLLTTFNCVQLPIVNEIFKRNMMPTSIC---GNMNLETGSLFIGFQSGDAMHVRLNN 398
            AEGRLLT F+ ++LPIVN+  K    PT +     N +  +  LFIG+ SGD++ VRLNN
Sbjct: 361  AEGRLLTKFDLIKLPIVNDALKDTSNPTCVARVDPNSSNSSMDLFIGYLSGDSLVVRLNN 420

Query: 399  LKSSLEHKGTVSETLETDEDYM-------ELYGNNAEKEKKN---------LETESPFDI 442
            LKS++E +    E+ +    Y         LY ++  KEK +         ++T  PFDI
Sbjct: 421  LKSAIETREEHKESKQIFTGYDDDDDDEDNLYSDDESKEKIDEELPDNKQLIQTVQPFDI 480

Query: 443  ECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDELSIVATSGNGTGSHLTILENTIV 502
            E L  L NIGP+TSL  GK +S++  V  L NPN +E S+VATSG+GTGSHLT ++ ++ 
Sbjct: 481  EQLTSLRNIGPITSLVAGKVTSVDPNVKGLQNPNSNEYSMVATSGSGTGSHLTAIQPSVQ 540

Query: 503  PTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSDIYSIDRDFKPFKAADFRKNDTT 562
            P V+ ALKFISVTQIW LK+K KDKYLVTTDS++++SDIY ID  F   K    R++ TT
Sbjct: 541  PLVELALKFISVTQIWKLKMKNKDKYLVTTDSTKSKSDIYEIDNKFALHKEGRLRRDATT 600

Query: 563  VSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFEVVHVCIKDPFLLLTNSKGDIKI 622
            +  ++ G G RIVQVT+  ++LFD +F+R+  + FDFEVVHV + DP++L+T  +GDIKI
Sbjct: 601  IHISMFGEGTRIVQVTTNHLYLFDTDFRRLTAIKFDFEVVHVSVMDPYILITVLRGDIKI 660

Query: 623  YELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNKYINGLEKSEEPQLLFTFVTADN 682
            YEL+   K+K  +  LP+ LKE+++T GVIL+SNMCN+Y++G E SEE QLLFTFVTADN
Sbjct: 661  YELDALQKRKLFRVDLPEILKEMVVTSGVILKSNMCNEYLHGHEDSEEEQLLFTFVTADN 720

Query: 683  QIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDINPDPSIKQVIISRLGHKHKQEYL 742
            QI+FF ++HNDRIFQL G+D  ++ LFISTYQLPE++ PDPSIKQV+I++LGH +K+EYL
Sbjct: 721  QIIFFLREHNDRIFQLCGVDQLKEGLFISTYQLPEEVVPDPSIKQVMINKLGHNNKEEYL 780

Query: 743  TILTFGGEVYLYRKCIDNPDRFIKCDHE--LLITGAPENAYPKGVQGVERVAHYIEDYNG 800
            TILTFGGE+Y Y+K       F K      + ITGAP+NAY KGV  +ER+ HYI DY+G
Sbjct: 781  TILTFGGEIYQYKKSRTRHSCFFKNTGSTGMCITGAPDNAYAKGVSSIERIMHYIPDYSG 840

Query: 801  YSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRWGENSVMCVDDVKNARIMTLNLD 860
            YSVIF+TG+VPYII++ED+S P+IF FAN+++VS+ +WG+NSVM VDD+KNAR+ +L+ +
Sbjct: 841  YSVIFLTGSVPYIIMREDDSSPKIFRFANLSIVSLAQWGKNSVMAVDDIKNARVYSLD-N 899

Query: 861  RDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTFIVSYAKSIDYVALSEEDEPLVG 920
            +D YYGN + L KI + D LEDF TL  ITYHE++Q F+VSYAK  +Y AL E+ E +VG
Sbjct: 900  KDSYYGNSLPLKKIKISDSLEDFMTLTKITYHEKSQLFLVSYAKEREYEALGEDGEIIVG 959

Query: 921  YNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLINDMRTMMIQLNSNTKRRREYLVV 980
             N    HA  FQSGI+L++P++W +ID++++  NS+I+DMR+M+IQL+S ++++REY+V 
Sbjct: 960  SNDQVPHAKSFQSGILLINPRTWNVIDRVDFEVNSIISDMRSMLIQLDSKSRKKREYIVA 1019

Query: 981  GNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDIFQEDIRGTVSTVCEISGRFM 1040
            G T++  ED+  TG+F++YD+TEV+PEPGKPDTN+K K+IF+EDIRG+V++VC+ISGRF+
Sbjct: 1020 GITFIGTEDLPSTGAFHIYDLTEVIPEPGKPDTNFKLKEIFKEDIRGSVNSVCDISGRFL 1079

Query: 1041 ISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGNLMIIGDSMQGFSFLGFDAEPYR 1100
            I+QS K MVRD+QEDNSVVPVAF D P+F++DAKSFGN +I+GDSMQGF FLGFDAEPYR
Sbjct: 1080 INQSQKIMVRDVQEDNSVVPVAFYDTPIFVSDAKSFGNFLILGDSMQGFQFLGFDAEPYR 1139

Query: 1101 MLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLKYAPDEPNSLSGQRLVHCTSF 1160
            M+ LG+SVS  ET+ VEFL+N G++ F +TDR +++HVLKYAPDEPN+LSGQ+LVHC+SF
Sbjct: 1140 MIPLGRSVSSFETVSVEFLINAGEINFAITDREDILHVLKYAPDEPNTLSGQKLVHCSSF 1199

Query: 1161 NLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQADGTIFKVVPLSEASYRSLYLI 1220
            NL+S+NTCM ++ +NDEF    +      P FQ IG Q DG IFK++PL E +YR LY++
Sbjct: 1200 NLYSSNTCMLMLPRNDEFETSDKA----PPKFQAIGGQVDGGIFKIIPLKEDTYRRLYVV 1255

Query: 1221 QQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTVLKRFATLSIPTRMTMASKAG 1280
            QQQ+IDKEVQL GLNPRMERL+N FYQ+ H++RPM+DF +++RF+ LSI  R   A KAG
Sbjct: 1256 QQQIIDKEVQLGGLNPRMERLDNDFYQLTHVMRPMIDFNIIRRFSELSIERRTHFAQKAG 1315

Query: 1281 R 1281
            R
Sbjct: 1316 R 1316

>CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces
            cerevisiae YDR301w CFT1 pre-mRNA 3 -end processing factor
            CF II, start by similarity
          Length = 1361

 Score = 1333 bits (3450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1344 (50%), Positives = 925/1344 (68%), Gaps = 72/1344 (5%)

Query: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60
            MNV+D+VI+ TVV++SV GHFTTT   ELI+ RT++LS+      GRL L  E KLSGR+
Sbjct: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60

Query: 61   HGLSLVP-HKSG-------LGRLAVLTGRGRVSIVRFDAENQTLETESLHYYDAKFEELS 112
            + ++L+P H +G       L  L + TG  ++S++ ++    ++ET SLH+Y+ KFE  +
Sbjct: 61   NDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120

Query: 113  ALTVGAAPRLEQEPAARCLLVHNGDCLAVLP-------------LRGHXXXXXXXXXXXX 159
             L +    +L  EP     ++ N D LA+LP             +               
Sbjct: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINEDEDEDYINNDKSKINDNSKKSL 180

Query: 160  HPAKRARTDADGRLVGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGN 219
               K+ +T  + ++   S ++  S L   IKN+KD++FL G  KS +GVLYQPQL+WCGN
Sbjct: 181  FKRKKGKT-QNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGN 239

Query: 220  EKLTRQTMKFIILSLDLDDE------KSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELL 273
             +L      + I+SLD+            +I+ +  LP+  HTI P  +G ++ GVNE+ 
Sbjct: 240  SQLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIA 299

Query: 274  YVDNTGALQGAISLNAFSNSGL-NTRIQDNSKLQAFFE--QPLCYFATQSNGRDI--LLL 328
            ++DNTG LQ  ++LN++S+  L   R+ D S  + FF          +  N R +  +LL
Sbjct: 300  FLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILL 359

Query: 329  MDEKARMYNVIIEAEGRLLTTFNCVQLPIVNEIFKRNMMPTS---ICGNMNLETGSLFIG 385
             DE   ++NV +++EGRLLT FN  +LP+  ++  +   P+S   I  +  L+T ++FIG
Sbjct: 360  FDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIG 419

Query: 386  FQSGDAMHVRLNNLKSSLE------HKGTVSE------------------TLETDEDYME 421
            FQSGDA  ++LN+L S++E       K  V++                   L +DE+  +
Sbjct: 420  FQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEDDDDDDDDFNLYSDEENDQ 479

Query: 422  LYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDELS 481
            +   N      N E+  PF  + L  L NIGP+ S+ VGK SSIE  V  L NPNK E+S
Sbjct: 480  VNNKNDRTFGTN-ESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEIS 538

Query: 482  IVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSDI 541
            IV TSG G GSHL  +  ++ P V++ALKFIS+T+IWNL IKGKDK+L+TTDS+Q++S+I
Sbjct: 539  IVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNI 598

Query: 542  YSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFEV 601
            Y ID +F   K    R++ TT+  A  G  KRIVQVT+  ++L+D+ F+R  T+ FD+EV
Sbjct: 599  YEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEV 658

Query: 602  VHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNKY 661
            VHV + DP++L+T S+GDIK++ELE ++KKKFVK  LP+ L E++IT G+IL+SNMCN++
Sbjct: 659  VHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEF 718

Query: 662  INGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDINP 721
            ++G+ KS   QLLFTFVTADNQI+FFTKDHNDRIFQLNGID  +  L+ISTYQLP++I P
Sbjct: 719  LSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIP 778

Query: 722  DPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFIKC----DHELLITGAP 777
            DPSIKQ++I++LG+  K EYLTILTFGGE+Y Y+K      RF +     DH   ITGAP
Sbjct: 779  DPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHP--ITGAP 836

Query: 778  ENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTR 837
            +NAYPKGV G+ER+ HYI +++GYSVIF+TG  PYII+KED+S+PRIFPF NI +VSM+R
Sbjct: 837  DNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSR 896

Query: 838  WGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQT 897
            WGE SV+C+DD+KNARI +LN D + YYGNK+ + KI +   L++++TLN+I YHERTQ 
Sbjct: 897  WGEGSVICIDDIKNARIYSLNQD-NIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQL 955

Query: 898  FIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLI 957
            ++VSY K I Y A +E+   L+GY P+  +A  F+SG++L++PKSWE+ID+++   NSL+
Sbjct: 956  YLVSYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLV 1015

Query: 958  NDMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKF 1017
            NDM++  IQ+++ TKR+REY++VG  Y   ED+  TG F++YDITEVVPEPGKP+TN+K 
Sbjct: 1016 NDMKSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKL 1075

Query: 1018 KDIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFG 1077
            K+IF+EDIRG VS V  ISGRF+ISQS K MVRD+Q+DNSV+PVAFLD+PVF+T  K+FG
Sbjct: 1076 KEIFKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFG 1135

Query: 1078 NLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMH 1137
            NL++IGD+MQG  F+GFDAEPYRM+TLG S++K E + VEFLVNNGD+YFLVTDR+++MH
Sbjct: 1136 NLIVIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMH 1195

Query: 1138 VLKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGS 1197
            VLKYAPD+PN+LSGQRLVHC+SFNLHS N C  L+ KNDEF +  R    Y  SFQ I +
Sbjct: 1196 VLKYAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQR----YSRSFQTITA 1251

Query: 1198 QADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLD 1257
            Q DG+I K+VP+ E +YR LY IQQQ+IDKE QL GLNPRMER +N +Y +GH LRPMLD
Sbjct: 1252 QVDGSISKIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLD 1311

Query: 1258 FTVLKRFATLSIPTRMTMASKAGR 1281
            F ++KRF  +S+  R  +  K G+
Sbjct: 1312 FNIIKRFKDMSMNRRSHIVQKLGK 1335

>Kwal_56.22637
          Length = 595

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 13/115 (11%)

Query: 913  EEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIID-KIEYGKNSLI---NDMRTMMIQLN 968
            ++++P        I    F + I++LS    E ID + E   NS+I   ND  T+M + +
Sbjct: 469  DDNDPSATIQELTIQFAKFLNSILMLSMTHKEHIDERSEPLYNSIIRIRNDFETVMTKCS 528

Query: 969  SNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFKDIFQE 1023
              TK    +L V  TY+ D         Y+  + +     G  D+N+K   I+QE
Sbjct: 529  KKTKHPERFLAVNYTYLLD----ALQQNYISRLRQ-----GHDDSNFKISLIYQE 574

>Sklu_2439.10 YMR067C, Contig c2439 11825-13111
          Length = 428

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 77/191 (40%), Gaps = 33/191 (17%)

Query: 1006 PEPGKPDTNYKFKDIFQEDIR-----GTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVP 1060
            PE GK     +   +F+E I+        STV +I        SSK+   DIQED SV  
Sbjct: 174  PEEGKDVQQDRVNTVFEEPIKKPSQDSQPSTVHKIHKVSAYVPSSKSSTSDIQEDESVFE 233

Query: 1061 VAFLDMPVFITDAKSFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLV 1120
            +        IT A+ +  +            L  +A    MLT  +   + E       +
Sbjct: 234  LT-------ITHARKYQEM------------LSKNAGSSAMLT-RRLREQQEQKNKRNKI 273

Query: 1121 NNGDVYFLVTDRNNLMHVLKYAPDEPNS----LSGQRLVHCT-SFNLHSTNTCMRLIKKN 1175
               DV     DR N+   + + PDE  S    L  Q L+  T +F LH T+   +LI+ +
Sbjct: 274  TRCDVRVRFPDRTNIE--ISFNPDETISTVYQLVAQSLIDETLTFTLHITHP-YQLIEPS 330

Query: 1176 DEFGKVSRGFG 1186
            D+      GFG
Sbjct: 331  DKQLDKDLGFG 341

>CAGL0B03289g 319012..321624 similar to sp|P38149 Saccharomyces
           cerevisiae YBR281c, hypothetical start
          Length = 870

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 541 IYSI---DRDFKPFKAADFRKNDTTVS--TAVTGGGKRIVQVTSKGVHLFDINFKRMMTM 595
           IYSI   D +F  F +   R +DT V   T+ +G G   +   S   +   I F  +   
Sbjct: 221 IYSICKLDNEFHSFFSTQ-RSDDTNVEYITSASGDGINKIWKFSGRANTVTITFMDIQLD 279

Query: 596 NFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIII 647
           N D  V+   ++ PFL    ++G I I++L  +     +KT   D +  I +
Sbjct: 280 NHD-SVISQAVEFPFLYSGLTQGIINIWDLSTRELVSTIKTKNDDDITSISV 330

>YDR310C (SUM1) [1138] chr4 complement(1081120..1084308) Protein
           required for middle sporulation element-mediated
           repression of SMK1, SPR3, and NDT80 during vegetative
           growth, interacts with Hst1p and Rfm1p in a complex with
           histone deacetylase activity [3189 bp, 1062 aa]
          Length = 1062

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 613 LTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNKYINGLE 666
           L NS  + + Y  + KH+K       PD  +E  + F ++ ++ +  KY+N LE
Sbjct: 855 LINSSINEEDYAAKSKHEKMNAHFFKPDIQEETELAFEILSKTTLTEKYVNSLE 908

>Scas_713.25
          Length = 378

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 703 DFRQKLFISTYQLPEDINPDPSIKQV---IISRLGHKHKQEYLTILTFG 748
           D   K+ I+T+   ++   DPS++ V   II RL  KH+ E   I  FG
Sbjct: 3   DSNWKVSITTFNCEKEFPVDPSLENVRSLIIKRLLFKHRHEVKDIYVFG 51

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 42,176,802
Number of extensions: 1925316
Number of successful extensions: 4939
Number of sequences better than 10.0: 24
Number of HSP's gapped: 5042
Number of HSP's successfully gapped: 25
Length of query: 1281
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1168
Effective length of database: 12,684,275
Effective search space: 14815233200
Effective search space used: 14815233200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)