MUSCLE (3.8) multiple sequence alignment

AGR093W         MNIASGADERGTSGHIEGRLLVV---QQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQE
Ecym_4314       MKVVVAVN-----------LIVLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQD
                *::. ..:           *:*:   :*:: .**:*:*::*****:**.*******::*:

AGR093W         DPGGGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQRTETIAAET--TRAVITPTRC
Ecym_4314       GNNVCIDVDALFKLLMSSTPELLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRC
                . .  ****::*:***  *****.*******:**:**:..* :*:::.  :*::******

AGR093W         YNFLKEDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDS
Ecym_4314       LNFLKNDVHAFKHSSETCKGILGALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDT
                 ****:** :* *.:*.  *:: **:***:****:* *****:* ***** * :*****:

AGR093W         PTTLQLLHSLVHDSATGSGKLGGLAHDDTALLSRDMLDRSAAHAHGHYPQQEP----QES
Ecym_4314       AIAIQFLNSLPANQVTPLGRINSYTGRSHGSSQNGMLHQPVMQIHSQYQDQEPSLKDQQI
                . ::*:*:**  :..*  *.:.. :  . .  ...** ... : *.:* :***    *: 

AGR093W         QDEEQDASQLP---------HSQSLGPESR----SSTAPQASHMLPQQQHQQH-------
Ecym_4314       RQQLEQQQQSPIQSQLLLQHHQQQQGQDQERQPPSKEKPFHQHQQQQQQHQQHQEQQQDL
                .:: :: .* *         *.*. * :.     *.  *  .*   *******       

AGR093W         -------------------------------------------------HQEEPQLQPGD
Ecym_4314       LHDHNDEKPAKLTSQLLEQSSGQQALSERLILPHPQKQQAPLPSTALALHHSEPQPQQQD
                                                                 *:.*** *  *

AGR093W         DQKPKVQQQVEDRRRDKEEQEQHQKPQQQQQQKSQKQHSQTSTT--------------PL
Ecym_4314       LQQDSQKQQQQQQHHHQQQQQQQQQEQEEEKKKKQKKQSATPAHSLLLLPPPPAPPAPPA
                 *: . :** ::... :::*:*:*: *:::::*.**::* *.:               * 

AGR093W         AKRTPPQPQD----HQHQQNQQHQHQHQHQKRNRPQLHLPLQKSSTSNRQTVPLQQPQ--
Ecym_4314       TTTTPPLPTSRLLPHQQQQRQQRQYHLQPDHQNQHQQALPVRSPPPPPSPPLPLPQQQQL
                :. *** * .    **:**.**.*:: * ::.*. *  **:......   .:** * *  

AGR093W         ------------------------SASSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIY
Ecym_4314       KHPQYPRQQCLQQMHPNLQQLQNYPNGSTTPCYYQNYFYDSVA---LFQQGIPEINQRLH
                                        . .****  *    ***..   ****.**:****::

AGR093W         HLTLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSLATGTTPVKGKVTKLKRSAATT
Ecym_4314       HLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSISL-TNSVSTKGKVTKLKQSTATT
                ***::*********:***:**.*.*:*:********:** *.:...********.*:***

AGR093W         PIRSTFINESNNSSMTSISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRS
Ecym_4314       PICSKFTYDSNISGVTSVSGHMNYSETNVSNTGDQELVNPLLESYESFIVKNDPRSNTKT
                ** *.*  :** *.:**:** :****:*.:*:.*:***:****.**.**:*.: *.::.:

AGR093W         A--NHEPSSSSQGMQSVLSFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLAR--P
Ecym_4314       AESSHQAPVTAQKDRGELPFQSENIFEVQKDDEGSILSYHPITFADSATSYSNILPRSMP
                *  .*:.. ::*  .. *.**.: :*:: .** .*:***:.:...**::***.:*.*  *

AGR093W         VGASVDIF-----------------SETESCCYTHE------------------------
Ecym_4314       PSGTVSIPLKRGRMATLMSSALPQDSTSSTICYSNSTSNIHNNAKEGQLVSSEVASNTNN
                 ..:*.*                  * :.: **::.                        

AGR093W         ------------------------------------------------------------
Ecym_4314       LSSSTEHKLKKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSI
                                                                            

AGR093W         ------------------------------------------------------------
Ecym_4314       YSIYNEFYQSLKLQVDSFVQDYGKSKLTQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQV
                                                                            

AGR093W         ---------------------------------------------
Ecym_4314       LDIVDDVRIKEGKSVVWVCNNLGSLKYALVKYRPKLKDIIMGYND
                                                             

FASTA FORMAT for MUSCLE Version 3.6

>AGR093W
MNIASGADERGTSGHIEGRLLVV---QQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQE
DPGGGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQRTETIAAET--TRAVITPTRC
YNFLKEDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDS
PTTLQLLHSLVHDSATGSGKLGGLAHDDTALLSRDMLDRSAAHAHGHYPQQEP----QES
QDEEQDASQLP---------HSQSLGPESR----SSTAPQASHMLPQQQHQQH-------
-------------------------------------------------HQEEPQLQPGD
DQKPKVQQQVEDRRRDKEEQEQHQKPQQQQQQKSQKQHSQTSTT--------------PL
AKRTPPQPQD----HQHQQNQQHQHQHQHQKRNRPQLHLPLQKSSTSNRQTVPLQQPQ--
------------------------SASSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIY
HLTLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSLATGTTPVKGKVTKLKRSAATT
PIRSTFINESNNSSMTSISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRS
A--NHEPSSSSQGMQSVLSFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLAR--P
VGASVDIF-----------------SETESCCYTHE------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------
>Ecym_4314
MKVVVAVN-----------LIVLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQD
GNNVCIDVDALFKLLMSSTPELLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRC
LNFLKNDVHAFKHSSETCKGILGALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDT
AIAIQFLNSLPANQVTPLGRINSYTGRSHGSSQNGMLHQPVMQIHSQYQDQEPSLKDQQI
RQQLEQQQQSPIQSQLLLQHHQQQQGQDQERQPPSKEKPFHQHQQQQQQHQQHQEQQQDL
LHDHNDEKPAKLTSQLLEQSSGQQALSERLILPHPQKQQAPLPSTALALHHSEPQPQQQD
LQQDSQKQQQQQQHHHQQQQQQQQQEQEEEKKKKQKKQSATPAHSLLLLPPPPAPPAPPA
TTTTPPLPTSRLLPHQQQQRQQRQYHLQPDHQNQHQQALPVRSPPPPPSPPLPLPQQQQL
KHPQYPRQQCLQQMHPNLQQLQNYPNGSTTPCYYQNYFYDSVA---LFQQGIPEINQRLH
HLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSISL-TNSVSTKGKVTKLKQSTATT
PICSKFTYDSNISGVTSVSGHMNYSETNVSNTGDQELVNPLLESYESFIVKNDPRSNTKT
AESSHQAPVTAQKDRGELPFQSENIFEVQKDDEGSILSYHPITFADSATSYSNILPRSMP
PSGTVSIPLKRGRMATLMSSALPQDSTSSTICYSNSTSNIHNNAKEGQLVSSEVASNTNN
LSSSTEHKLKKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSI
YSIYNEFYQSLKLQVDSFVQDYGKSKLTQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQV
LDIVDDVRIKEGKSVVWVCNNLGSLKYALVKYRPKLKDIIMGYND